RPSBLAST alignment for GI: 254780436 and conserved domain: COG4785

>gnl|CDD|34396 COG4785, NlpI, Lipoprotein NlpI, contains TPR repeats [General function prediction only]. Length = 297
 Score = 41.9 bits (98), Expect = 2e-04
 Identities = 29/104 (27%), Positives = 45/104 (43%), Gaps = 9/104 (8%)

Query: 155 LQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGR 214
             +A  D +RA  L        + R ++Y   G    +  DFSQA+++   + P+ +N  
Sbjct: 55  ASRALTDEERAQLL--------FERGVLYDSLGLRALARNDFSQALAIRPDM-PEVFNYL 105

Query: 215 GISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSY 258
           GI      N+D+A E F   + LDP       N G+     G Y
Sbjct: 106 GIYLTQAGNFDAAYEAFDSVLELDPTYNYAHLNRGIALYYGGRY 149