RPSBLAST alignment for GI: 254780436 and conserved domain: COG5010

>gnl|CDD|34615 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]. Length = 257
 Score = 48.1 bits (114), Expect = 3e-06
 Identities = 31/127 (24%), Positives = 49/127 (38%), Gaps = 6/127 (4%)

Query: 58  LTAVIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMG 117
           L     A+P D E    +G     NG+F +A+   + A  L P  ++ +        ++G
Sbjct: 89  LQKSAIAYPKDRELLAAQGKNQIRNGNFGEAVSVLRKAARLAPTDWEAWNLLGAALDQLG 148

Query: 118 DVPMAIRDYGTALKINPDYDVAY--IGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRA 175
               A R Y  AL++ P+       +G   + R     DL+ A      A     +D R 
Sbjct: 149 RFDEARRAYRQALELAPNEPSIANNLGMSLLLRG----DLEDAETLLLPAYLSPAADSRV 204

Query: 176 WYGRALV 182
               ALV
Sbjct: 205 RQNLALV 211