RPSBLAST alignment for GI: 254780436 and conserved domain: COG5010

>gnl|CDD|34615 COG5010, TadD, Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]. Length = 257
 Score = 40.4 bits (94), Expect = 6e-04
 Identities = 17/77 (22%), Positives = 33/77 (42%), Gaps = 1/77 (1%)

Query: 151 RYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDY 210
           R  +  +A +   +A +L  +D  AW          G ++++   + QA+ L  +  P  
Sbjct: 112 RNGNFGEAVSVLRKAARLAPTDWEAWNLLGAALDQLGRFDEARRAYRQALELAPN-EPSI 170

Query: 211 YNGRGISYLATKNYDSA 227
            N  G+S L   + + A
Sbjct: 171 ANNLGMSLLLRGDLEDA 187