RPSBLAST alignment for GI: 254780436 and conserved domain: KOG0547

>gnl|CDD|35767 KOG0547, KOG0547, KOG0547, Translocase of outer mitochondrial membrane complex, subunit TOM70/TOM72 [Intracellular trafficking, secretion, and vesicular transport]. Length = 606
 Score = 38.5 bits (89), Expect = 0.002
 Identities = 23/100 (23%), Positives = 44/100 (44%), Gaps = 9/100 (9%)

Query: 163 DRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATK 222
             A  LKT  G  ++          +Y+++I+ ++QAI L     P +Y+ R   Y +  
Sbjct: 113 KYAAALKT-KGNKFFRN-------KKYDEAIKYYTQAIEL-CPDEPIFYSNRAACYESLG 163

Query: 223 NYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAV 262
           +++  +ED   A+ L+P            +E  G +  A+
Sbjct: 164 DWEKVIEDCTKALELNPDYVKALLRRASAHEQLGKFDEAL 203