RPSBLAST alignment for GI: 254780436 and conserved domain: KOG0548

>gnl|CDD|35768 KOG0548, KOG0548, KOG0548, Molecular co-chaperone STI1 [Posttranslational modification, protein turnover, chaperones]. Length = 539
 Score = 42.7 bits (100), Expect = 1e-04
 Identities = 27/108 (25%), Positives = 48/108 (44%), Gaps = 1/108 (0%)

Query: 187 GEYEKSIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWF 246
           G++E +I  F++AI L S  +   Y+ R  +Y +  +Y+ AL+D      L+P  A  + 
Sbjct: 16  GDFETAIRLFTEAIML-SPTNHVLYSNRSAAYASLGSYEKALKDATKTRRLNPDWAKGYS 74

Query: 247 NGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLSSTVN 294
             G      G Y  A+  Y + L  D    + K G+ +   +  +   
Sbjct: 75  RKGAALFGLGDYEEAILAYSEGLEKDPSNKQLKTGLAQAYLEDYAADQ 122