RPSBLAST alignment for GI: 254780436 and conserved domain: KOG1126

>gnl|CDD|36341 KOG1126, KOG1126, KOG1126, DNA-binding cell division cycle control protein [Cell cycle control, cell division, chromosome partitioning]. Length = 638
 Score = 51.5 bits (123), Expect = 3e-07
 Identities = 41/211 (19%), Positives = 86/211 (40%), Gaps = 17/211 (8%)

Query: 86  EKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPMAIRDYGTALKINP----DYDVAYI 141
            +AL  F+     +     V +      +++ +   A R +    +I P      ++   
Sbjct: 336 REALNLFEKLPSHHYNTGWVLSQLGRAYFELIEYDQAERIFSLVRRIEPYRVKGMEIYST 395

Query: 142 GRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAIS 201
              ++  +   S L +   D D       +   +W      + ++ +++ +I+ F +AI 
Sbjct: 396 TLWHLQDEVALSYLAQDLIDTDP------NSPESWCALGNCFSLQKDHDTAIKCFKRAIQ 449

Query: 202 LYSSISPDY---YNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSY 258
           L     P +   Y   G   +AT+ +D A++ F+ A+ +DP+  + W+  G VY  Q   
Sbjct: 450 L----DPRFAYAYTLLGHESIATEEFDKAMKSFRKALGVDPRHYNAWYGLGTVYLKQEKL 505

Query: 259 ANAVKYYKKALSVDSRYYRAKNGILRISQDL 289
             A  +++KA+ ++         I RI   L
Sbjct: 506 EFAEFHFQKAVEINPSNSVILCHIGRIQHQL 536