RPSBLAST alignment for GI: 254780436 and conserved domain: KOG1127

>gnl|CDD|36342 KOG1127, KOG1127, KOG1127, TPR repeat-containing protein [RNA processing and modification]. Length = 1238
 Score = 63.5 bits (154), Expect = 7e-11
 Identities = 45/182 (24%), Positives = 78/182 (42%), Gaps = 13/182 (7%)

Query: 114 YKMGDVPMAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDG 173
               +  +A+     AL+++     A+   G IYRD    D+++A   FD+A +L  +D 
Sbjct: 469 CMRKNSALALHALIRALRLDVSLAPAFAFLGQIYRD--SDDMKRAKKCFDKAFELDATDA 526

Query: 174 RAWYGRALVYQMRGEYEKSIEDFSQAISLYSS-ISPDY-----YNGRGISYLATKNYDSA 227
            A    A  Y      E+S  + +  I L ++  +P +     +  RG  YL   N   A
Sbjct: 527 EAAAASADTYA-----EESTWEEAFEICLRAAQKAPAFACKENWVQRGPYYLEAHNLHGA 581

Query: 228 LEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQ 287
           + +F+ A+  DPK  + W   G  Y   G Y++A+K + KA  +       +     +  
Sbjct: 582 VCEFQSALRTDPKDYNLWLGLGEAYPESGRYSHALKVFTKASLLRPLSKYGRFKEAVMEC 641

Query: 288 DL 289
           D 
Sbjct: 642 DN 643