RPSBLAST alignment for GI: 254780436 and conserved domain: KOG1128

>gnl|CDD|36343 KOG1128, KOG1128, KOG1128, Uncharacterized conserved protein, contains TPR repeats [General function prediction only]. Length = 777
 Score = 51.9 bits (124), Expect = 2e-07
 Identities = 26/159 (16%), Positives = 61/159 (38%), Gaps = 11/159 (6%)

Query: 133 NPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQL-KTSDGRAWYGRALVYQMRGEYEK 191
                  Y   G++  D            +++A +L      RA    AL+     ++ +
Sbjct: 453 KDPDPRLYCLLGDVLHDPSL---------YEKAWELSNYISARAQRSLALLILSNKDFSE 503

Query: 192 SIEDFSQAISLYSSISPDYYNGRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMV 251
           + +   +++ +   +    + G G + L  +   +A++ F   + L+P  A  W N    
Sbjct: 504 ADKHLERSLEINP-LQLGTWFGLGCAALQLEKEQAAVKAFHRCVTLEPDNAEAWNNLSTA 562

Query: 252 YEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQDLS 290
           Y        A +  K+AL  + ++++     + +S D+ 
Sbjct: 563 YIRLKKKKRAFRKLKEALKCNYQHWQIWENYMLVSVDVG 601