RPSBLAST alignment for GI: 254780436 and conserved domain: KOG1128

>gnl|CDD|36343 KOG1128, KOG1128, KOG1128, Uncharacterized conserved protein, contains TPR repeats [General function prediction only]. Length = 777
 Score = 38.8 bits (90), Expect = 0.002
 Identities = 22/120 (18%), Positives = 43/120 (35%), Gaps = 7/120 (5%)

Query: 153 SDLQKAFADFDRAIQLKTSDGRAWYGRALVYQMRGEYEKSIEDFSQAISLYSSISPDYYN 212
                   + +R    K  D R +     V      YEK+ E     +S Y S       
Sbjct: 437 LGQHGKAEEINRQELEKDPDPRLYCLLGDVLHDPSLYEKAWE-----LSNYISARAQRSL 491

Query: 213 GRGISYLATKNYDSALEDFKFAINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVD 272
                 L+ K++  A +  + ++ ++P +   WF  G           AVK + + ++++
Sbjct: 492 AL--LILSNKDFSEADKHLERSLEINPLQLGTWFGLGCAALQLEKEQAAVKAFHRCVTLE 549