RPSBLAST alignment for GI: 254780436 and conserved domain: KOG2076

>gnl|CDD|37287 KOG2076, KOG2076, KOG2076, RNA polymerase III transcription factor TFIIIC [Transcription]. Length = 895
 Score = 44.6 bits (105), Expect = 3e-05
 Identities = 55/235 (23%), Positives = 96/235 (40%), Gaps = 13/235 (5%)

Query: 61  VIRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVP 120
           VI+  P +P  Y   G +Y   GD EKAL  +  A  LNP+ Y+++   A +  ++G++ 
Sbjct: 165 VIKQDPRNPIAYYTLGEIYEQRGDIEKALNFWLLAAHLNPKDYELWKRLADLSEQLGNIN 224

Query: 121 MAIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAW---- 176
            A   Y  A++ NP        R ++Y  ++  DL++A   F + +QL            
Sbjct: 225 QARYCYSRAIQANPSNWELIYERSSLY--QKTGDLKRAMETFLQLLQLDPPVDIERIEDL 282

Query: 177 -YGRALVYQMRGEYEKSIEDFSQAISLYSSIS--PDYYNGRGISYLATKNYDSALEDFKF 233
               A  +    E E++ +    A+S     +   D      + +L  K  D AL     
Sbjct: 283 IRRVAHYFITHNERERAAKALEGALSKEKDEASLEDLNILAEL-FLKNKQSDKALMKIVD 341

Query: 234 AINLDPKKASFWFNGGMVYEMQGSYANAVKYYKKALSVDSRYYRAKNGILRISQD 288
             N + +K    ++     E +    NA+    K LS D R  R    ++ + + 
Sbjct: 342 DRNRESEKDDSEWD---TDERRREEPNALCEVGKELSYDLRVIRLMICLVHLKER 393