RPSBLAST alignment for GI: 254780436 and conserved domain: KOG4626

>gnl|CDD|39826 KOG4626, KOG4626, KOG4626, O-linked N-acetylglucosamine transferase OGT [Carbohydrate transport and metabolism, Posttranslational modification, protein turnover, chaperones, Signal transduction mechanisms]. Length = 966
 Score = 66.2 bits (161), Expect = 1e-11
 Identities = 41/151 (27%), Positives = 71/151 (47%), Gaps = 6/151 (3%)

Query: 62  IRAHPSDPEGYNVRGVVYGMNGDFEKALLDFQSALDLNPRYYKVYANRALIRYKMGDVPM 121
           +R  P+  +  N  G +Y   G  E+A   +  AL++ P +   + N A I  + G++  
Sbjct: 347 LRLCPNHADAMNNLGNIYREQGKIEEATRLYLKALEVFPEFAAAHNNLASIYKQQGNLDD 406

Query: 122 AIRDYGTALKINPDYDVAYIGRGNIYRDERYSDLQKAFADFDRAIQLKTSDGRAWYGRAL 181
           AI  Y  AL+I P +  A    GN Y++    D+  A   + RAIQ+  +   A    A 
Sbjct: 407 AIMCYKEALRIKPTFADALSNMGNTYKEM--GDVSAAIQCYTRAIQINPTFAEAHSNLAS 464

Query: 182 VYQMRGEYEKSIEDFSQAISLYSSISPDYYN 212
           +Y+  G   ++I+ +  A+ L     PD+ +
Sbjct: 465 IYKDSGNIPEAIQSYRTALKL----KPDFPD 491