>gi|254780437|ref|YP_003064850.1| 30S ribosomal protein S21 [Candidatus Liberibacter asiaticus str. psy62]
MLVFNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQHR