HHsearch results for GI: 254780437 and protein with PDBid: 3bbn_U

>3bbn_U Ribosomal protein S21; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Cucumis sativus}
Probab=99.58  E-value=4.1e-18  Score=120.97  Aligned_cols=64  Identities=30%  Similarity=0.427  Sum_probs=59.2

Q ss_pred             CCEEEEEEECCC-HHHHHHHHHHHHHHCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             310688872795-8999999999996434499987435126955899999999988899999999
Q gi|254780437|r   17 ISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI   80 (95)
Q Consensus        17 ~~~i~V~V~~nn-vE~AlR~lKrkv~~eGi~~elR~R~~YEKPsekRrRkk~ea~kR~~K~~rK~   80 (95)
                      .+++.|.|++|+ +|.|||+|||+|+++||++|+|+|+||||||++|++++++|.+|+++....-
T Consensus        94 ~ynv~V~VkenEsiE~ALRRFKKkV~ksGIi~ElR~Rr~YEKPSekKRRKk~eA~rR~kKrr~~~  158 (190)
T 3bbn_U           94 AYNVQVVVDDNEPEERLLNRFRREVMRAGVIQECKRRRFFENTQDVRKRKTREAAKRNRRRRPQA  158 (190)
T ss_dssp             ---CCCCCCCCSSCCCCCCSSSTTTTTTHHHHSSSSCCCTTTTTTHHHHHHHHTTC---------
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHHHHHCCCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             70379985899999999999999999827599997540458858999999999999999986651