BLAST/PSIBLAST alignment of GI: 254780437 and GI: 121602285 at iteration 1
>gi|121602285|ref|YP_988624.1| 30S ribosomal protein S21 [Bartonella bacilliformis KC583] Length = 77
>gi|166224012|sp|A1URM1|RS21_BARBK RecName: Full=30S ribosomal protein S21 Length = 77
>gi|120614462|gb|ABM45063.1| ribosomal protein S21 [Bartonella bacilliformis KC583] Length = 77
 Score =  100 bits (249), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 57/64 (89%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
          VLVRDNNV+QALR LKKKMQ EG+ RE+KMRG+YEKPS+KR R K+EAIRR+RKL RK A
Sbjct: 3  VLVRDNNVDQALRALKKKMQREGIFREMKMRGYYEKPSEKRAREKAEAIRRTRKLARKRA 62

Query: 82 QREG 85
          QREG
Sbjct: 63 QREG 66