BLAST/PSIBLAST alignment of GI: 254780437 and GI: 315122114 at iteration 1
>gi|315122114|ref|YP_004062603.1| 30S ribosomal protein S21 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 77
>gi|313495516|gb|ADR52115.1| 30S ribosomal protein S21 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 77
 Score =  133 bits (335), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 67/73 (91%), Positives = 71/73 (97%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          +YVLVRDNNVEQALRVLKKKMQGEGVLRELKMR HYEKPSQKRVRLKSEAIRRSRKL+RK
Sbjct: 1  MYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRDHYEKPSQKRVRLKSEAIRRSRKLIRK 60

Query: 80 IAQREGAPVSRLR 92
          +AQREG+PVSR R
Sbjct: 61 LAQREGSPVSRFR 73