BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780437|ref|YP_003064850.1| 30S ribosomal protein S21
[Candidatus Liberibacter asiaticus str. psy62]
         (95 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|254780437|ref|YP_003064850.1| 30S ribosomal protein S21 [Candidatus Liberibacter asiaticus str.
          psy62]
 gi|254040114|gb|ACT56910.1| 30S ribosomal protein S21 [Candidatus Liberibacter asiaticus str.
          psy62]
          Length = 95

 Score = 88.0 bits (217), Expect = 4e-16,   Method: Composition-based stats.
 Identities = 95/95 (100%), Positives = 95/95 (100%)

Query: 1  MLVFNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
          MLVFNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ
Sbjct: 1  MLVFNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60

Query: 61 KRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQHR 95
          KRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQHR
Sbjct: 61 KRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQHR 95


>gi|218680070|ref|ZP_03527967.1| 30S ribosomal protein S21 [Rhizobium etli CIAT 894]
          Length = 124

 Score = 83.8 bits (206), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 52/77 (67%), Positives = 60/77 (77%)

Query: 14  GREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
            R +  V VLVRDNNV+QALR LKKKMQ EG+ RE+KMR +YEKPSQKR R K+EA+RR 
Sbjct: 48  RRNVILVQVLVRDNNVDQALRALKKKMQREGIFREMKMRDYYEKPSQKRAREKAEAVRRV 107

Query: 74  RKLMRKIAQREGAPVSR 90
           RKL RK AQREG   +R
Sbjct: 108 RKLARKRAQREGLVAAR 124


>gi|90418774|ref|ZP_01226685.1| possible ribosomal protein S21 [Aurantimonas manganoxydans
           SI85-9A1]
 gi|90336854|gb|EAS50559.1| possible ribosomal protein S21 [Aurantimonas manganoxydans
           SI85-9A1]
          Length = 118

 Score = 83.0 bits (204), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 49/87 (56%), Positives = 64/87 (73%)

Query: 3   VFNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKR 62
           +F++  G  +  +  + V V+VRDNNV+QALR LKKKMQ EG+ RE+KMRG +EKPS++R
Sbjct: 28  LFSSLYGPSTLQKRNTPVQVVVRDNNVDQALRALKKKMQREGIFREMKMRGAFEKPSERR 87

Query: 63  VRLKSEAIRRSRKLMRKIAQREGAPVS 89
            R K+EA+RR RKL RK AQREG    
Sbjct: 88  AREKAEAVRRGRKLARKQAQREGLLAG 114


>gi|170751904|ref|YP_001758164.1| ribosomal protein S21 [Methylobacterium radiotolerans JCM 2831]
 gi|170658426|gb|ACB27481.1| ribosomal protein S21 [Methylobacterium radiotolerans JCM 2831]
          Length = 111

 Score = 79.5 bits (195), Expect = 2e-13,   Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 56/76 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  YEKPS ++ R K+EA+RR+RK  RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGIFREMKQRKAYEKPSVRKAREKAEAVRRARKQARK 60

Query: 80 IAQREGAPVSRLRQHR 95
           A REG   +   + R
Sbjct: 61 TAIREGLIAAPKPKPR 76


>gi|114327145|ref|YP_744302.1| 30S ribosomal protein S21P [Granulibacter bethesdensis CGDNIH1]
 gi|114315319|gb|ABI61379.1| SSU ribosomal protein S21P [Granulibacter bethesdensis CGDNIH1]
          Length = 98

 Score = 75.3 bits (184), Expect = 2e-12,   Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 57/75 (76%)

Query: 11 FSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
            E  +   V VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+R H+EKPS+++ R  +EA+
Sbjct: 23 RPEKGDDYPVQVLVRDNNVDQALKALKKKMQREGIFREMKLRRHFEKPSERKAREAAEAV 82

Query: 71 RRSRKLMRKIAQREG 85
          RR+RKL RK  +REG
Sbjct: 83 RRARKLERKRLEREG 97


>gi|254473213|ref|ZP_05086611.1| ribosomal protein S21 [Pseudovibrio sp. JE062]
 gi|211957934|gb|EEA93136.1| ribosomal protein S21 [Pseudovibrio sp. JE062]
          Length = 106

 Score = 73.8 bits (180), Expect = 7e-12,   Method: Composition-based stats.
 Identities = 50/74 (67%), Positives = 62/74 (83%)

Query: 20  VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           V VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EAIRR+RKL RK
Sbjct: 33  VQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAIRRTRKLARK 92

Query: 80  IAQREGAPVSRLRQ 93
            AQREG  + + R+
Sbjct: 93  RAQREGLLLGKGRR 106


>gi|90107451|gb|ABD89488.1| SSU ribosomal protein S21P [Rhodopseudomonas palustris BisB18]
          Length = 121

 Score = 73.8 bits (180), Expect = 8e-12,   Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          V VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 22 VQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 81

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 82 KLQREGLLPMKPK 94


>gi|239832616|ref|ZP_04680945.1| ribosomal protein S21 [Ochrobactrum intermedium LMG 3301]
 gi|239824883|gb|EEQ96451.1| ribosomal protein S21 [Ochrobactrum intermedium LMG 3301]
          Length = 105

 Score = 73.4 bits (179), Expect = 9e-12,   Method: Composition-based stats.
 Identities = 52/72 (72%), Positives = 59/72 (81%)

Query: 20  VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           V VLVRDNNV+QALR LKKKMQ EG+ RE+KMRGHYEKPS+KR R K+EA+RR+RKL RK
Sbjct: 31  VQVLVRDNNVDQALRALKKKMQREGIFREMKMRGHYEKPSEKRAREKAEAVRRARKLARK 90

Query: 80  IAQREGAPVSRL 91
            AQREG    R 
Sbjct: 91  RAQREGLVGGRA 102


>gi|47219455|emb|CAG10819.1| unnamed protein product [Tetraodon nigroviridis]
          Length = 626

 Score = 72.6 bits (177), Expect = 2e-11,   Method: Composition-based stats.
 Identities = 19/68 (27%), Positives = 38/68 (55%), Gaps = 2/68 (2%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR- 74
             +  V+V+  NV+ A + L + +  +G++  +K + ++EKP ++R R   E  +R   
Sbjct: 6  RFISRTVMVQQKNVDAAYKTLNRLLTQDGIIETVKRKRYFEKPCKERQRRTYENCKRIYN 65

Query: 75 -KLMRKIA 81
           ++ RKIA
Sbjct: 66 TEMARKIA 73


>gi|295688061|ref|YP_003591754.1| 30S ribosomal protein S21 [Caulobacter segnis ATCC 21756]
 gi|295429964|gb|ADG09136.1| ribosomal protein S21 [Caulobacter segnis ATCC 21756]
          Length = 126

 Score = 71.8 bits (175), Expect = 3e-11,   Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 56/79 (70%)

Query: 14  GREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
             EI  V + VRDNNV+QAL+ LKKKMQ EG  RE+K   HYEKPS+KR R K+EA+RR+
Sbjct: 44  NGEIPLVQIFVRDNNVDQALKALKKKMQREGSFREMKRHVHYEKPSEKRARQKAEAVRRA 103

Query: 74  RKLMRKIAQREGAPVSRLR 92
           RKL RK AQREG      +
Sbjct: 104 RKLARKRAQREGLLPMPKK 122


>gi|315499542|ref|YP_004088345.1| ribosomal protein s21 [Asticcacaulis excentricus CB 48]
 gi|315417554|gb|ADU14194.1| ribosomal protein S21 [Asticcacaulis excentricus CB 48]
          Length = 124

 Score = 71.1 bits (173), Expect = 5e-11,   Method: Composition-based stats.
 Identities = 45/82 (54%), Positives = 57/82 (69%)

Query: 12  SEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
            +  EI  V + VRDNNV+QAL+ LKKKMQ EG  RE+K   HYEKPS+KR R ++EA+R
Sbjct: 43  RQNGEIPLVQIFVRDNNVDQALKALKKKMQREGSFREMKRHVHYEKPSEKRARQQAEAVR 102

Query: 72  RSRKLMRKIAQREGAPVSRLRQ 93
           R+RKL RK  QREG   +   +
Sbjct: 103 RARKLARKRLQREGGATTGRSK 124


>gi|146338300|ref|YP_001203348.1| 30S ribosomal protein S21 [Bradyrhizobium sp. ORS278]
 gi|146191106|emb|CAL75111.1| 30S ribosomal protein S21 [Bradyrhizobium sp. ORS278]
          Length = 100

 Score = 70.7 bits (172), Expect = 6e-11,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KLQREGLLPMKPK 73


>gi|260565014|ref|ZP_05835499.1| predicted protein [Brucella melitensis bv. 1 str. 16M]
 gi|260152657|gb|EEW87750.1| predicted protein [Brucella melitensis bv. 1 str. 16M]
          Length = 105

 Score = 70.7 bits (172), Expect = 7e-11,   Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 59/71 (83%)

Query: 20  VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           V VLVRDNNV+QALR LKKKMQ EG+ RE+KMRGHYEKPS+KR R K+EA+RR+RKL RK
Sbjct: 31  VQVLVRDNNVDQALRALKKKMQREGIFREMKMRGHYEKPSEKRAREKAEAVRRARKLARK 90

Query: 80  IAQREGAPVSR 90
            AQREG    R
Sbjct: 91  RAQREGLIGGR 101


>gi|261322808|ref|ZP_05962005.1| predicted protein [Brucella neotomae 5K33]
 gi|261298788|gb|EEY02285.1| predicted protein [Brucella neotomae 5K33]
          Length = 105

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 53/71 (74%), Positives = 60/71 (84%)

Query: 20  VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           V VLVRDNNV+QALR LKKKMQ EG+ RE+KMRGHYEKPS+KR R K+EA+RR+RKL RK
Sbjct: 31  VQVLVRDNNVDQALRTLKKKMQREGIFREMKMRGHYEKPSEKRAREKAEAVRRARKLARK 90

Query: 80  IAQREGAPVSR 90
            AQREG   SR
Sbjct: 91  RAQREGLIGSR 101


>gi|225629418|ref|ZP_03787451.1| ribosomal protein S21 [Brucella ceti str. Cudo]
 gi|237816771|ref|ZP_04595763.1| ribosomal protein S21 [Brucella abortus str. 2308 A]
 gi|260544448|ref|ZP_05820269.1| predicted protein [Brucella abortus NCTC 8038]
 gi|260567783|ref|ZP_05838252.1| predicted protein [Brucella suis bv. 4 str. 40]
 gi|261757157|ref|ZP_06000866.1| predicted protein [Brucella sp. F5/99]
 gi|297249259|ref|ZP_06932960.1| predicted protein [Brucella abortus bv. 5 str. B3196]
 gi|225615914|gb|EEH12963.1| ribosomal protein S21 [Brucella ceti str. Cudo]
 gi|237787584|gb|EEP61800.1| ribosomal protein S21 [Brucella abortus str. 2308 A]
 gi|260097719|gb|EEW81593.1| predicted protein [Brucella abortus NCTC 8038]
 gi|260154448|gb|EEW89529.1| predicted protein [Brucella suis bv. 4 str. 40]
 gi|261737141|gb|EEY25137.1| predicted protein [Brucella sp. F5/99]
 gi|297173128|gb|EFH32492.1| predicted protein [Brucella abortus bv. 5 str. B3196]
          Length = 105

 Score = 70.3 bits (171), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 59/71 (83%)

Query: 20  VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           V VLVRDNNV+QALR LKKKMQ EG+ RE+KMRGHYEKPS+KR R K+EA+RR+RKL RK
Sbjct: 31  VQVLVRDNNVDQALRALKKKMQREGIFREMKMRGHYEKPSEKRAREKAEAVRRARKLARK 90

Query: 80  IAQREGAPVSR 90
            AQREG    R
Sbjct: 91  RAQREGLIGGR 101


>gi|27348613|dbj|BAC45630.1| 30S ribosomal protein S21 [Bradyrhizobium japonicum USDA 110]
          Length = 106

 Score = 68.8 bits (167), Expect = 2e-10,   Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 62/83 (74%)

Query: 11 FSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           S+  E + + VLVRDNNV+QALRVLKKKMQ EGV RE+K R  YEKPS+++ R KSEAI
Sbjct: 6  ISQPDEETQLQVLVRDNNVDQALRVLKKKMQREGVFREMKQRRSYEKPSERKTREKSEAI 65

Query: 71 RRSRKLMRKIAQREGAPVSRLRQ 93
          RR+RKL RK A REG   +  ++
Sbjct: 66 RRARKLARKQAIREGLLPAPPKK 88


>gi|154245493|ref|YP_001416451.1| ribosomal protein S21 [Xanthobacter autotrophicus Py2]
 gi|154159578|gb|ABS66794.1| ribosomal protein S21 [Xanthobacter autotrophicus Py2]
          Length = 111

 Score = 68.4 bits (166), Expect = 3e-10,   Method: Composition-based stats.
 Identities = 47/84 (55%), Positives = 61/84 (72%)

Query: 9  GIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSE 68
          GI    +  + + VLVRDNN+EQAL+VLKK+MQ EG+ RE+K R  YEKPS++RVR  +E
Sbjct: 15 GIRGNPQIGTVLQVLVRDNNIEQALKVLKKRMQREGIFREMKQRKAYEKPSERRVREAAE 74

Query: 69 AIRRSRKLMRKIAQREGAPVSRLR 92
          A+RR+RK  RK AQREG   +  R
Sbjct: 75 AVRRTRKAARKKAQREGLIAAPKR 98


>gi|148258723|ref|YP_001243308.1| 30S ribosomal protein S21 [Bradyrhizobium sp. BTAi1]
 gi|146410896|gb|ABQ39402.1| SSU ribosomal protein S21P [Bradyrhizobium sp. BTAi1]
          Length = 99

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 42/74 (56%), Positives = 58/74 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDN+V++ALR+LK+KMQ EGV RE+K R  YEKPS+++ R KS+AIRR RK+ RK
Sbjct: 1  MQVLVRDNDVDKALRILKRKMQREGVFREMKRRRAYEKPSERKTREKSDAIRRQRKVARK 60

Query: 80 IAQREGAPVSRLRQ 93
           A REG   + +++
Sbjct: 61 QAIREGLLPAPVKK 74


>gi|110636318|ref|YP_676526.1| SSU ribosomal protein S21P [Mesorhizobium sp. BNC1]
 gi|119367221|sp|Q11B64|RS212_MESSB RecName: Full=30S ribosomal protein S21 2
 gi|110287302|gb|ABG65361.1| SSU ribosomal protein S21P [Chelativorans sp. BNC1]
          Length = 75

 Score = 66.5 bits (161), Expect = 1e-09,   Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 58/73 (79%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V+VRDNNV+QALRVLKKKMQ EG+ RE+K R  YEKPS++R R K+EA+RR+RKL RK
Sbjct: 1  MQVVVRDNNVDQALRVLKKKMQREGIFREMKARRSYEKPSERRAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
           AQREG    + R
Sbjct: 61 QAQREGLLPGKKR 73


>gi|254700165|ref|ZP_05161993.1| 30S ribosomal protein S21 [Brucella suis bv. 5 str. 513]
 gi|261750659|ref|ZP_05994368.1| SSU ribosomal protein S21P [Brucella suis bv. 5 str. 513]
 gi|261740412|gb|EEY28338.1| SSU ribosomal protein S21P [Brucella suis bv. 5 str. 513]
          Length = 75

 Score = 66.1 bits (160), Expect = 2e-09,   Method: Composition-based stats.
 Identities = 52/71 (73%), Positives = 58/71 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMRGHYEKPS+KR R K+EAIRR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGHYEKPSEKRAREKAEAIRRVRKLARK 60

Query: 80 IAQREGAPVSR 90
           AQREG    R
Sbjct: 61 RAQREGLIGGR 71


>gi|115258515|emb|CAK09619.1| putative 30S ribosomal protein S21 [Rhizobium leguminosarum bv.
          viciae 3841]
          Length = 74

 Score = 65.3 bits (158), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 51/74 (68%), Positives = 59/74 (79%)

Query: 17 ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
          +  V VLVRDNNV+QALR LKKKMQ EG+ RE+KMR +YEKPSQKR R K+EA+RR RKL
Sbjct: 1  MILVQVLVRDNNVDQALRALKKKMQREGIFREMKMRDYYEKPSQKRAREKAEAVRRVRKL 60

Query: 77 MRKIAQREGAPVSR 90
           RK AQREG   +R
Sbjct: 61 ARKRAQREGLVAAR 74


>gi|114705558|ref|ZP_01438461.1| 30S ribosomal protein S21 [Fulvimarina pelagi HTCC2506]
 gi|114538404|gb|EAU41525.1| 30S ribosomal protein S21 [Fulvimarina pelagi HTCC2506]
          Length = 85

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 49/82 (59%), Positives = 59/82 (71%)

Query: 11 FSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
          + E      + ++VRDNNVEQALR LKKK+Q EGV RE+K R  YEKPS+KRVR K+E +
Sbjct: 4  YKEKLAEPFLQIIVRDNNVEQALRALKKKLQREGVFREMKQRSFYEKPSEKRVREKAEGV 63

Query: 71 RRSRKLMRKIAQREGAPVSRLR 92
          RR+RKL RK AQREG    R R
Sbjct: 64 RRARKLARKQAQREGVLPGRSR 85


>gi|161501790|ref|YP_769705.2| 30S ribosomal protein S21 [Rhizobium leguminosarum bv. viciae
          3841]
 gi|119367224|sp|Q1MBR4|RS212_RHIL3 RecName: Full=30S ribosomal protein S21 2
          Length = 71

 Score = 64.9 bits (157), Expect = 3e-09,   Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 58/71 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMR +YEKPSQKR R K+EA+RR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRDYYEKPSQKRAREKAEAVRRVRKLARK 60

Query: 80 IAQREGAPVSR 90
           AQREG   +R
Sbjct: 61 RAQREGLVAAR 71


>gi|319898421|ref|YP_004158514.1| 30S ribosomal protein S21 [Bartonella clarridgeiae 73]
 gi|319402385|emb|CBI75924.1| 30S ribosomal protein S21 [Bartonella clarridgeiae 73]
          Length = 77

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 57/70 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMRG+YEKPS+KR R K+EAIRR+ KL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGYYEKPSEKRAREKAEAIRRTHKLARK 60

Query: 80 IAQREGAPVS 89
           AQREG    
Sbjct: 61 HAQREGLISG 70


>gi|222149768|ref|YP_002550725.1| 30S ribosomal protein S21 [Agrobacterium vitis S4]
 gi|221736751|gb|ACM37714.1| 30S ribosomal protein S21 [Agrobacterium vitis S4]
          Length = 79

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 57/73 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMR +YEKPSQKR R K+EA+RR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRDYYEKPSQKRAREKAEAVRRVRKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG   +  R
Sbjct: 61 KMQREGLIAAPPR 73


>gi|217978434|ref|YP_002362581.1| 30S ribosomal protein S21 [Methylocella silvestris BL2]
 gi|254813724|sp|B8EIA0|RS21_METSB RecName: Full=30S ribosomal protein S21
 gi|217503810|gb|ACK51219.1| ribosomal protein S21 [Methylocella silvestris BL2]
          Length = 79

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 48/73 (65%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+KR R K+EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKRAREKAEAIRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KMQREGLLPMKPK 73


>gi|150397951|ref|YP_001328418.1| 30S ribosomal protein S21 [Sinorhizobium medicae WSM419]
 gi|150029466|gb|ABR61583.1| ribosomal protein S21 [Sinorhizobium medicae WSM419]
          Length = 71

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 57/71 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMR  YEKPSQKR R K+EA+RR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRDFYEKPSQKRAREKAEAVRRVRKLARK 60

Query: 80 IAQREGAPVSR 90
           AQREG   +R
Sbjct: 61 RAQREGLVAAR 71


>gi|241206350|ref|YP_002977446.1| 30S ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|240860240|gb|ACS57907.1| ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 71

 Score = 64.9 bits (157), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 50/71 (70%), Positives = 58/71 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMR +YEKPSQKR R K+EA+RR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRDYYEKPSQKRAREKAEAVRRVRKLARK 60

Query: 80 IAQREGAPVSR 90
           AQREG   +R
Sbjct: 61 RAQREGVVAAR 71


>gi|316935689|ref|YP_004110671.1| 30S ribosomal protein S21 [Rhodopseudomonas palustris DX-1]
 gi|315603403|gb|ADU45938.1| ribosomal protein S21 [Rhodopseudomonas palustris DX-1]
          Length = 87

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 60/73 (82%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG   S+ +
Sbjct: 61 KLQREGLLPSKPK 73


>gi|209884244|ref|YP_002288101.1| 30S ribosomal protein S21 (RRP-S21) [Oligotropha carboxidovorans
          OM5]
 gi|226695030|sp|B6JC20|RS21_OLICO RecName: Full=30S ribosomal protein S21
 gi|209872440|gb|ACI92236.1| 30S ribosomal protein S21 (RRP-S21) [Oligotropha carboxidovorans
          OM5]
          Length = 96

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 60/73 (82%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG   S+ +
Sbjct: 61 KLQREGLLPSKPK 73


>gi|39937236|ref|NP_949512.1| 30S ribosomal protein S21 [Rhodopseudomonas palustris CGA009]
 gi|192293017|ref|YP_001993622.1| 30S ribosomal protein S21 [Rhodopseudomonas palustris TIE-1]
 gi|81698072|sp|Q6N274|RS21_RHOPA RecName: Full=30S ribosomal protein S21; AltName: Full=RRP-S21
 gi|39651094|emb|CAE29617.1| ribosomal protein S21 [Rhodopseudomonas palustris CGA009]
 gi|192286766|gb|ACF03147.1| ribosomal protein S21 [Rhodopseudomonas palustris TIE-1]
          Length = 87

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 60/73 (82%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG   S+ +
Sbjct: 61 KLQREGLLPSKPK 73


>gi|182677315|ref|YP_001831461.1| 30S ribosomal protein S21 [Beijerinckia indica subsp. indica ATCC
          9039]
 gi|226694977|sp|B2IDB5|RS21_BEII9 RecName: Full=30S ribosomal protein S21
 gi|182633198|gb|ACB93972.1| ribosomal protein S21 [Beijerinckia indica subsp. indica ATCC
          9039]
          Length = 79

 Score = 64.5 bits (156), Expect = 4e-09,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RG+YEKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGYYEKPSEKRAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KMQREGLLPMKPK 73


>gi|218463091|ref|ZP_03503182.1| 30S ribosomal protein S21 [Rhizobium etli Kim 5]
          Length = 73

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 50/73 (68%), Positives = 57/73 (78%)

Query: 17 ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
          +  V VLVRDNNV+QALR LKKKMQ EG+ RE+KMR +YEKPSQKR R K+EA+RR RKL
Sbjct: 1  MILVQVLVRDNNVDQALRALKKKMQREGIFREMKMRDYYEKPSQKRAREKAEAVRRVRKL 60

Query: 77 MRKIAQREGAPVS 89
           RK AQREG    
Sbjct: 61 ARKRAQREGLVAR 73


>gi|91975901|ref|YP_568560.1| 30S ribosomal protein S21 [Rhodopseudomonas palustris BisB5]
 gi|119367301|sp|Q13B80|RS21_RHOPS RecName: Full=30S ribosomal protein S21
 gi|91682357|gb|ABE38659.1| SSU ribosomal protein S21P [Rhodopseudomonas palustris BisB5]
          Length = 100

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KLQREGLLPMKPK 73


>gi|16127527|ref|NP_422091.1| 30S ribosomal protein S21 [Caulobacter crescentus CB15]
 gi|221236342|ref|YP_002518779.1| 30S ribosomal protein S21 [Caulobacter crescentus NA1000]
 gi|20978732|sp|Q9A3A7|RS21_CAUCR RecName: Full=30S ribosomal protein S21
 gi|13424991|gb|AAK25259.1| ribosomal protein S21 [Caulobacter crescentus CB15]
 gi|220965515|gb|ACL96871.1| SSU ribosomal protein S21P [Caulobacter crescentus NA1000]
          Length = 87

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 48/82 (58%), Positives = 57/82 (69%)

Query: 14 GREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
            EI  V + VRDNNV+QAL+ LKKKMQ EG  RE+K   HYEKPS+KR R K+EA+RR+
Sbjct: 6  NGEIPLVQIFVRDNNVDQALKALKKKMQREGSFREMKRHVHYEKPSEKRARQKAEAVRRA 65

Query: 74 RKLMRKIAQREGAPVSRLRQHR 95
          RKL RK AQREG      +  R
Sbjct: 66 RKLARKRAQREGLLPMPKKPGR 87


>gi|240849803|ref|YP_002971191.1| 30S ribosomal protein S21 [Bartonella grahamii as4aup]
 gi|240266926|gb|ACS50514.1| 30S ribosomal protein S21 [Bartonella grahamii as4aup]
          Length = 77

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 57/66 (86%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMR +YEKPS+KR R K+EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRSYYEKPSEKRAREKAEAIRRTRKLARK 60

Query: 80 IAQREG 85
           AQREG
Sbjct: 61 RAQREG 66


>gi|163758901|ref|ZP_02165988.1| 30S ribosomal protein S21 [Hoeflea phototrophica DFL-43]
 gi|162284191|gb|EDQ34475.1| 30S ribosomal protein S21 [Hoeflea phototrophica DFL-43]
          Length = 76

 Score = 64.5 bits (156), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 55/70 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMR  YEKPSQKR R K+EA+RR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRDFYEKPSQKRAREKAEAVRRVRKLARK 60

Query: 80 IAQREGAPVS 89
           AQREG    
Sbjct: 61 RAQREGLIGG 70


>gi|195970135|ref|NP_386962.3| 30S ribosomal protein S21 [Sinorhizobium meliloti 1021]
 gi|307300356|ref|ZP_07580136.1| ribosomal protein S21 [Sinorhizobium meliloti BL225C]
 gi|307319639|ref|ZP_07599065.1| ribosomal protein S21 [Sinorhizobium meliloti AK83]
 gi|15075881|emb|CAC47435.1| Probable 30S ribosomal protein [Sinorhizobium meliloti 1021]
 gi|306894761|gb|EFN25521.1| ribosomal protein S21 [Sinorhizobium meliloti AK83]
 gi|306904522|gb|EFN35106.1| ribosomal protein S21 [Sinorhizobium meliloti BL225C]
          Length = 84

 Score = 64.1 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 52/78 (66%), Positives = 58/78 (74%)

Query: 12 SEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          S+ R    V VLVRDNNV+QALR LKKKMQ EG+ RE+KMR  YEKPSQKR R K+EA+R
Sbjct: 7  SKQRNGIHVQVLVRDNNVDQALRALKKKMQREGIFREMKMRDFYEKPSQKRAREKAEAVR 66

Query: 72 RSRKLMRKIAQREGAPVS 89
          R RKL RK AQREG    
Sbjct: 67 RVRKLARKRAQREGIVAR 84


>gi|330003820|ref|ZP_08304770.1| ribosomal protein S21 [Klebsiella sp. MS 92-3]
 gi|328536804|gb|EGF63116.1| ribosomal protein S21 [Klebsiella sp. MS 92-3]
          Length = 136

 Score = 64.1 bits (155), Expect = 5e-09,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 15  REISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
            E     + VR+N   + ALR  K+  +  GVL E++ R  YEKP+ +R R K+ A++R 
Sbjct: 62  GERHMPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRH 121

Query: 74  RKLMRKIAQRE 84
            K + +   R 
Sbjct: 122 AKKLARENARR 132


>gi|86359197|ref|YP_471089.1| 30S ribosomal protein S21 [Rhizobium etli CFN 42]
 gi|190893449|ref|YP_001979991.1| 30S ribosomal protein S21 [Rhizobium etli CIAT 652]
 gi|209550938|ref|YP_002282855.1| 30S ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|218509624|ref|ZP_03507502.1| 30S ribosomal protein S21 [Rhizobium etli Brasil 5]
 gi|222087124|ref|YP_002545659.1| ribosomal protein S21 [Agrobacterium radiobacter K84]
 gi|119367223|sp|Q2K474|RS212_RHIEC RecName: Full=30S ribosomal protein S21 2
 gi|86283299|gb|ABC92362.1| 30S ribosomal protein S21 [Rhizobium etli CFN 42]
 gi|190698728|gb|ACE92813.1| 30S ribosomal protein S21 [Rhizobium etli CIAT 652]
 gi|209536694|gb|ACI56629.1| ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|221724572|gb|ACM27728.1| ribosomal protein S21 [Agrobacterium radiobacter K84]
          Length = 70

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 56/70 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMR +YEKPSQKR R K+EA+RR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRDYYEKPSQKRAREKAEAVRRVRKLARK 60

Query: 80 IAQREGAPVS 89
           AQREG    
Sbjct: 61 RAQREGLVAR 70


>gi|92116792|ref|YP_576521.1| 30S ribosomal protein S21 [Nitrobacter hamburgensis X14]
 gi|119367278|sp|Q1QNY6|RS21_NITHX RecName: Full=30S ribosomal protein S21
 gi|91799686|gb|ABE62061.1| SSU ribosomal protein S21P [Nitrobacter hamburgensis X14]
          Length = 95

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KMQREGLLPMKPK 73


>gi|75675192|ref|YP_317613.1| 30S ribosomal protein S21 [Nitrobacter winogradskyi Nb-255]
 gi|85716094|ref|ZP_01047070.1| Ribosomal protein S21 [Nitrobacter sp. Nb-311A]
 gi|119367281|sp|Q3STY0|RS21_NITWN RecName: Full=30S ribosomal protein S21
 gi|74420062|gb|ABA04261.1| SSU ribosomal protein S21P [Nitrobacter winogradskyi Nb-255]
 gi|85697093|gb|EAQ34975.1| Ribosomal protein S21 [Nitrobacter sp. Nb-311A]
          Length = 95

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KMQREGLLPMKPK 73


>gi|319408124|emb|CBI81777.1| 30S ribosomal protein S21 [Bartonella schoenbuchensis R1]
          Length = 77

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 50/68 (73%), Positives = 58/68 (85%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMRG+YEKPS+KR R K+EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGYYEKPSEKRAREKAEAIRRTRKLARK 60

Query: 80 IAQREGAP 87
           AQREG  
Sbjct: 61 RAQREGLI 68


>gi|323137816|ref|ZP_08072891.1| ribosomal protein S21 [Methylocystis sp. ATCC 49242]
 gi|322396819|gb|EFX99345.1| ribosomal protein S21 [Methylocystis sp. ATCC 49242]
          Length = 77

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKRAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KLQREGLLPVKAK 73


>gi|296448616|ref|ZP_06890485.1| ribosomal protein S21 [Methylosinus trichosporium OB3b]
 gi|296253866|gb|EFH01024.1| ribosomal protein S21 [Methylosinus trichosporium OB3b]
          Length = 79

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKRAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KLQREGLLPVKAK 73


>gi|298293971|ref|YP_003695910.1| ribosomal protein S21 [Starkeya novella DSM 506]
 gi|296930482|gb|ADH91291.1| ribosomal protein S21 [Starkeya novella DSM 506]
          Length = 79

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 61/73 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+KR R ++EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKRAREEAEAIRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
           AQREG   S+ +
Sbjct: 61 RAQREGLLPSKPK 73


>gi|227823430|ref|YP_002827403.1| 30S ribosomal protein S21 [Sinorhizobium fredii NGR234]
 gi|227342432|gb|ACP26650.1| 30S ribosomal protein S21 B [Sinorhizobium fredii NGR234]
          Length = 70

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 55/70 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMR  YEKPSQKR R K+EA+RR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRDFYEKPSQKRAREKAEAVRRVRKLARK 60

Query: 80 IAQREGAPVS 89
           AQREG    
Sbjct: 61 RAQREGLLAR 70


>gi|15890907|ref|NP_356579.1| 30S ribosomal protein S21 [Agrobacterium tumefaciens str. C58]
 gi|23822020|sp|Q8U8M6|RS21A_AGRT5 RecName: Full=30S ribosomal protein S21 A
 gi|15159212|gb|AAK89364.1| 30S ribosomal protein S21 [Agrobacterium tumefaciens str. C58]
          Length = 75

 Score = 64.1 bits (155), Expect = 6e-09,   Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 57/70 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMR +YEKPSQKR R K+EA+RR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRDYYEKPSQKRAREKAEAVRRVRKLARK 60

Query: 80 IAQREGAPVS 89
           AQREG   +
Sbjct: 61 RAQREGLIAA 70


>gi|49474950|ref|YP_032991.1| 30S ribosomal protein S21 [Bartonella henselae str. Houston-1]
 gi|61215924|sp|Q6G512|RS21_BARHE RecName: Full=30S ribosomal protein S21
 gi|49237755|emb|CAF26947.1| 30S ribosomal protein s21 [Bartonella henselae str. Houston-1]
          Length = 77

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 49/68 (72%), Positives = 58/68 (85%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMRG+YEKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGYYEKPSEKRAREKAEAVRRTRKLARK 60

Query: 80 IAQREGAP 87
           AQREG  
Sbjct: 61 RAQREGLI 68


>gi|49473802|ref|YP_031844.1| 30S ribosomal protein S21 [Bartonella quintana str. Toulouse]
 gi|61215922|sp|Q6G0U2|RS21_BARQU RecName: Full=30S ribosomal protein S21
 gi|49239305|emb|CAF25631.1| 30s ribosomal protein s21 [Bartonella quintana str. Toulouse]
          Length = 77

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 50/67 (74%), Positives = 58/67 (86%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMRG+YEKPS+KR R K+EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGYYEKPSEKRAREKAEAIRRTRKLARK 60

Query: 80 IAQREGA 86
           AQREG 
Sbjct: 61 RAQREGL 67


>gi|299132046|ref|ZP_07025241.1| ribosomal protein S21 [Afipia sp. 1NLS2]
 gi|298592183|gb|EFI52383.1| ribosomal protein S21 [Afipia sp. 1NLS2]
          Length = 99

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KLQREGLLPMKPK 73


>gi|163867431|ref|YP_001608628.1| 30S ribosomal protein S21 [Bartonella tribocorum CIP 105476]
 gi|189044891|sp|A9IM39|RS21_BART1 RecName: Full=30S ribosomal protein S21
 gi|161017075|emb|CAK00633.1| 30S ribosomal protein S21 [Bartonella tribocorum CIP 105476]
          Length = 77

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 48/66 (72%), Positives = 57/66 (86%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMR +YEKPS++R R K+EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRSYYEKPSERRAREKAEAIRRTRKLARK 60

Query: 80 IAQREG 85
           AQREG
Sbjct: 61 RAQREG 66


>gi|162136025|ref|YP_533807.2| 30S ribosomal protein S21 [Rhodopseudomonas palustris BisB18]
 gi|119367300|sp|Q20ZE8|RS21_RHOPB RecName: Full=30S ribosomal protein S21
          Length = 100

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KLQREGLLPMKPK 73


>gi|86748570|ref|YP_485066.1| 30S ribosomal protein S21 [Rhodopseudomonas palustris HaA2]
 gi|119367299|sp|Q2J055|RS21_RHOP2 RecName: Full=30S ribosomal protein S21
 gi|86571598|gb|ABD06155.1| SSU ribosomal protein S21P [Rhodopseudomonas palustris HaA2]
          Length = 101

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KLQREGLLPMKPK 73


>gi|27382228|ref|NP_773757.1| 30S ribosomal protein S21 [Bradyrhizobium japonicum USDA 110]
 gi|81734968|sp|Q89EG8|RS212_BRAJA RecName: Full=30S ribosomal protein S21 2
 gi|27355399|dbj|BAC52382.1| 30S ribosomal protein S21 [Bradyrhizobium japonicum USDA 110]
          Length = 98

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KLQREGLLPMKPK 73


>gi|148258058|ref|YP_001242643.1| 30S ribosomal protein S21 [Bradyrhizobium sp. BTAi1]
 gi|146410231|gb|ABQ38737.1| SSU ribosomal protein S21P [Bradyrhizobium sp. BTAi1]
          Length = 100

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KLQREGLLPMKPK 73


>gi|115526086|ref|YP_782997.1| 30S ribosomal protein S21 [Rhodopseudomonas palustris BisA53]
 gi|122295020|sp|Q07J67|RS21_RHOP5 RecName: Full=30S ribosomal protein S21
 gi|115520033|gb|ABJ08017.1| SSU ribosomal protein S21P [Rhodopseudomonas palustris BisA53]
          Length = 99

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    + +
Sbjct: 61 KLQREGLLPMKPK 73


>gi|188583245|ref|YP_001926690.1| 30S ribosomal protein S21 [Methylobacterium populi BJ001]
 gi|179346743|gb|ACB82155.1| ribosomal protein S21 [Methylobacterium populi BJ001]
          Length = 102

 Score = 64.1 bits (155), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 56/76 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  YEKPS ++ R K+EA+RR+RK  RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGIFREMKQRKAYEKPSVRKAREKAEAVRRARKQARK 60

Query: 80 IAQREGAPVSRLRQHR 95
           A REG   +   + R
Sbjct: 61 TAIREGLIAAPKPKPR 76


>gi|332716786|ref|YP_004444252.1| 30S ribosomal protein S21 [Agrobacterium sp. H13-3]
 gi|325063471|gb|ADY67161.1| 30S ribosomal protein S21 [Agrobacterium sp. H13-3]
          Length = 75

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 57/70 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMR +YEKPSQKR R K+EA+RR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRDYYEKPSQKRAREKAEAVRRVRKLARK 60

Query: 80 IAQREGAPVS 89
           AQREG   +
Sbjct: 61 RAQREGLVAA 70


>gi|90420491|ref|ZP_01228398.1| ribosomal protein S21 [Aurantimonas manganoxydans SI85-9A1]
 gi|90335219|gb|EAS48972.1| ribosomal protein S21 [Aurantimonas manganoxydans SI85-9A1]
          Length = 107

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 49/76 (64%), Positives = 56/76 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K R  YEKPS++R R K EAIRRSRKL RK
Sbjct: 1  MKVDVRDNNVDQALRALKKKLQREGVFREMKARRAYEKPSERRARQKQEAIRRSRKLARK 60

Query: 80 IAQREGAPVSRLRQHR 95
           AQREG      R+ R
Sbjct: 61 QAQREGLVPGPKRKIR 76


>gi|15965812|ref|NP_386165.1| 30S ribosomal protein S21 [Sinorhizobium meliloti 1021]
 gi|307311346|ref|ZP_07590989.1| ribosomal protein S21 [Sinorhizobium meliloti BL225C]
 gi|307318879|ref|ZP_07598311.1| ribosomal protein S21 [Sinorhizobium meliloti AK83]
 gi|7388182|sp|Q9Z3S4|RS21A_RHIME RecName: Full=30S ribosomal protein S21 A
 gi|3776225|gb|AAC64674.1| probable ribosomal protein [Sinorhizobium meliloti]
 gi|15075081|emb|CAC46638.1| 30S ribosomal protein S21 [Sinorhizobium meliloti 1021]
 gi|306895600|gb|EFN26354.1| ribosomal protein S21 [Sinorhizobium meliloti AK83]
 gi|306899647|gb|EFN30275.1| ribosomal protein S21 [Sinorhizobium meliloti BL225C]
          Length = 78

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 60/76 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNN++QALRVLKKKMQ EGV RE+KMR  YEKPS+KRVR K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNIDQALRVLKKKMQREGVFREMKMRSAYEKPSEKRVREKAEAVRRTRKLARK 60

Query: 80 IAQREGAPVSRLRQHR 95
            QREG   S  +  R
Sbjct: 61 KLQREGLLPSPKKVAR 76


>gi|227819990|ref|YP_002823961.1| 30S ribosomal protein S21 [Sinorhizobium fredii NGR234]
 gi|36958643|gb|AAQ87111.1| 30S ribosomal protein S21 A [Sinorhizobium fredii NGR234]
 gi|227338989|gb|ACP23208.1| RpsU, 30S ribosomal protein S21 A [Sinorhizobium fredii NGR234]
          Length = 78

 Score = 63.8 bits (154), Expect = 7e-09,   Method: Composition-based stats.
 Identities = 50/76 (65%), Positives = 59/76 (77%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EGV RE+KMR  YEKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGVFREMKMRSAYEKPSEKRAREKAEAVRRTRKLARK 60

Query: 80 IAQREGAPVSRLRQHR 95
            QREG   +  +  R
Sbjct: 61 KLQREGLLPAPKKVAR 76


>gi|121602285|ref|YP_988624.1| 30S ribosomal protein S21 [Bartonella bacilliformis KC583]
 gi|166224012|sp|A1URM1|RS21_BARBK RecName: Full=30S ribosomal protein S21
 gi|120614462|gb|ABM45063.1| ribosomal protein S21 [Bartonella bacilliformis KC583]
          Length = 77

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 50/66 (75%), Positives = 58/66 (87%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMRG+YEKPS+KR R K+EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGYYEKPSEKRAREKAEAIRRTRKLARK 60

Query: 80 IAQREG 85
           AQREG
Sbjct: 61 RAQREG 66


>gi|163853179|ref|YP_001641222.1| ribosomal protein S21 [Methylobacterium extorquens PA1]
 gi|218531983|ref|YP_002422799.1| 30S ribosomal protein S21 [Methylobacterium chloromethanicum CM4]
 gi|240140598|ref|YP_002965078.1| Ribosomal protein S21 [Methylobacterium extorquens AM1]
 gi|254563088|ref|YP_003070183.1| 30S ribosomal protein S21 [Methylobacterium extorquens DM4]
 gi|163664784|gb|ABY32151.1| ribosomal protein S21 [Methylobacterium extorquens PA1]
 gi|218524286|gb|ACK84871.1| ribosomal protein S21 [Methylobacterium chloromethanicum CM4]
 gi|240010575|gb|ACS41801.1| Ribosomal protein S21 [Methylobacterium extorquens AM1]
 gi|254270366|emb|CAX26362.1| Ribosomal protein S21 [Methylobacterium extorquens DM4]
          Length = 105

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 56/76 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  YEKPS ++ R K+EA+RR+RK  RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGIFREMKQRKAYEKPSVRKAREKAEAVRRARKQARK 60

Query: 80 IAQREGAPVSRLRQHR 95
           A REG   +   + R
Sbjct: 61 TAIREGLIAAPKPKPR 76


>gi|24212193|sp|Q92M03|RS21B_RHIME RecName: Full=30S ribosomal protein S21 B
          Length = 70

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 49/70 (70%), Positives = 55/70 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMR  YEKPSQKR R K+EA+RR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRDFYEKPSQKRAREKAEAVRRVRKLARK 60

Query: 80 IAQREGAPVS 89
           AQREG    
Sbjct: 61 RAQREGIVAR 70


>gi|319406727|emb|CBI80360.1| 30S ribosomal protein S21 [Bartonella sp. 1-1C]
          Length = 77

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 51/72 (70%), Positives = 58/72 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNVEQALR LKKKMQ EG+ RE+KMRG+YEKPS+KR R K+EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVEQALRALKKKMQREGIFREMKMRGYYEKPSEKRAREKAEAIRRTRKLARK 60

Query: 80 IAQREGAPVSRL 91
           AQREG      
Sbjct: 61 HAQREGLISGSR 72


>gi|319403719|emb|CBI77304.1| 30S ribosomal protein S21 [Bartonella rochalimae ATCC BAA-1498]
          Length = 77

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 51/72 (70%), Positives = 58/72 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNVEQALR LKKKMQ EG+ RE+KMRG+YEKPS+KR R K+EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVEQALRALKKKMQREGIFREMKMRGYYEKPSEKRAREKAEAIRRTRKLARK 60

Query: 80 IAQREGAPVSRL 91
           AQREG      
Sbjct: 61 HAQREGLISGSR 72


>gi|159185837|ref|NP_356975.2| 30S ribosomal protein S21 [Agrobacterium tumefaciens str. C58]
 gi|23822021|sp|Q8U9T8|RS21C_AGRT5 RecName: Full=30S ribosomal protein S21 3
 gi|159140971|gb|AAK89760.2| 30S ribosomal protein S21 [Agrobacterium tumefaciens str. C58]
          Length = 76

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 44/76 (57%), Positives = 58/76 (76%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR+LKKK+Q EGV RE+++R  +EKPS K+ R K+EAI R RKL RK
Sbjct: 1  MQVLVRDNNVDQALRILKKKLQREGVFREMRLREAFEKPSIKKAREKAEAIGRQRKLARK 60

Query: 80 IAQREGAPVSRLRQHR 95
            QREG   ++ R+ +
Sbjct: 61 QMQREGLLPTKPRKDK 76


>gi|315122114|ref|YP_004062603.1| 30S ribosomal protein S21 [Candidatus Liberibacter solanacearum
          CLso-ZC1]
 gi|313495516|gb|ADR52115.1| 30S ribosomal protein S21 [Candidatus Liberibacter solanacearum
          CLso-ZC1]
          Length = 77

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 67/73 (91%), Positives = 71/73 (97%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          +YVLVRDNNVEQALRVLKKKMQGEGVLRELKMR HYEKPSQKRVRLKSEAIRRSRKL+RK
Sbjct: 1  MYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRDHYEKPSQKRVRLKSEAIRRSRKLIRK 60

Query: 80 IAQREGAPVSRLR 92
          +AQREG+PVSR R
Sbjct: 61 LAQREGSPVSRFR 73


>gi|319405186|emb|CBI78791.1| 30S ribosomal protein S21 [Bartonella sp. AR 15-3]
          Length = 77

 Score = 63.8 bits (154), Expect = 8e-09,   Method: Composition-based stats.
 Identities = 50/72 (69%), Positives = 58/72 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMRG+YEKPS+KR R K+EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGYYEKPSEKRAREKAEAIRRTRKLARK 60

Query: 80 IAQREGAPVSRL 91
           AQREG      
Sbjct: 61 HAQREGLISGNR 72


>gi|239834347|ref|ZP_04682675.1| ribosomal protein S21 [Ochrobactrum intermedium LMG 3301]
 gi|239822410|gb|EEQ93979.1| ribosomal protein S21 [Ochrobactrum intermedium LMG 3301]
          Length = 108

 Score = 63.8 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 49/74 (66%), Positives = 58/74 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+LRELK R  YEKPS++RVR K EAIRR+RK  +K
Sbjct: 15 LQVLVRDNNVDQALRVLKKKMQREGILRELKERRAYEKPSERRVREKGEAIRRARKDAKK 74

Query: 80 IAQREGAPVSRLRQ 93
           AQREG      ++
Sbjct: 75 RAQREGLLPKPKKK 88


>gi|150397153|ref|YP_001327620.1| 30S ribosomal protein S21 [Sinorhizobium medicae WSM419]
 gi|150028668|gb|ABR60785.1| ribosomal protein S21 [Sinorhizobium medicae WSM419]
          Length = 78

 Score = 63.8 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 50/76 (65%), Positives = 60/76 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNN++QALRVLKKKMQ EGV RE+KMR  YEKPS+KRVR K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNIDQALRVLKKKMQREGVFREMKMRSAYEKPSEKRVREKAEAVRRTRKLARK 60

Query: 80 IAQREGAPVSRLRQHR 95
            QREG   +  +  R
Sbjct: 61 KLQREGLLPAPKKVAR 76


>gi|319781538|ref|YP_004141014.1| ribosomal protein S21 [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
 gi|317167426|gb|ADV10964.1| ribosomal protein S21 [Mesorhizobium ciceri biovar biserrulae
          WSM1271]
          Length = 92

 Score = 63.8 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 51/73 (69%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMRGHYEKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGHYEKPSEKRAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
           AQREG      R
Sbjct: 61 RAQREGLLPMTPR 73


>gi|46203481|ref|ZP_00051452.2| COG0828: Ribosomal protein S21 [Magnetospirillum magnetotacticum
          MS-1]
          Length = 101

 Score = 63.8 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 56/76 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  YEKPS ++ R K+EA+RR+RK  RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGIFREMKQRKAYEKPSVRKAREKAEAVRRARKQARK 60

Query: 80 IAQREGAPVSRLRQHR 95
           A REG   +   + R
Sbjct: 61 TAIREGLIAAPKPKPR 76


>gi|86360252|ref|YP_472141.1| 30S ribosomal protein S21 [Rhizobium etli CFN 42]
 gi|86284354|gb|ABC93414.1| 30S ribosomal protein S21 [Rhizobium etli CFN 42]
          Length = 77

 Score = 63.8 bits (154), Expect = 9e-09,   Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 55/73 (75%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+K R  YEKPS++RVR K++AI R RK  RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGLFREMKERRAYEKPSERRVREKAQAISRQRKAARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG  V R R
Sbjct: 61 KMQREGLLVGRKR 73


>gi|222150138|ref|YP_002551095.1| 30S ribosomal protein S21 [Agrobacterium vitis S4]
 gi|221737120|gb|ACM38083.1| 30S ribosomal protein S21 [Agrobacterium vitis S4]
          Length = 82

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 47/74 (63%), Positives = 58/74 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNVEQALRVLKKKMQ EG+ RE+K R  YEKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVEQALRVLKKKMQREGLFREMKARSAYEKPSEKKTREKAEAVRRTRKLARK 60

Query: 80 IAQREGAPVSRLRQ 93
            QREG   +  ++
Sbjct: 61 KLQREGLLPAPKKK 74


>gi|300024132|ref|YP_003756743.1| ribosomal protein S21 [Hyphomicrobium denitrificans ATCC 51888]
 gi|299525953|gb|ADJ24422.1| ribosomal protein S21 [Hyphomicrobium denitrificans ATCC 51888]
          Length = 130

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 47/72 (65%), Positives = 59/72 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKK+Q EGV RE+K+RGH+EKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKLQREGVFREMKLRGHFEKPSEKRAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRL 91
            QREG   S+ 
Sbjct: 61 KLQREGLLPSKP 72


>gi|218463535|ref|ZP_03503626.1| 30S ribosomal protein S21 [Rhizobium etli Kim 5]
          Length = 78

 Score = 63.4 bits (153), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 56/73 (76%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  +EKPS+KR R K+EAIRR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGLFREMKARSAFEKPSEKRAREKAEAIRRQRKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG   +  +
Sbjct: 61 KMQREGLLPAPKK 73


>gi|116254890|ref|YP_770726.1| 30S ribosomal protein S21 [Rhizobium leguminosarum bv. viciae
          3841]
 gi|115259538|emb|CAK10676.1| putative 30S ribosomal protein [Rhizobium leguminosarum bv.
          viciae 3841]
          Length = 78

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 54/73 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  YEKPS++RVR K++AI R RK  RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGLFREMKERRAYEKPSERRVREKAQAISRHRKAARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG      R
Sbjct: 61 QMQREGLLPGPKR 73


>gi|190890875|ref|YP_001977417.1| 30S ribosomal protein S21 [Rhizobium etli CIAT 652]
 gi|190696154|gb|ACE90239.1| 30S ribosomal protein S21 [Rhizobium etli CIAT 652]
          Length = 78

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 48/73 (65%), Positives = 54/73 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  YEKPS+KR R K EAIRR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGLFREMKARSAYEKPSEKRAREKGEAIRRQRKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG      +
Sbjct: 61 KLQREGLLPGPKK 73


>gi|159042802|ref|YP_001531596.1| 30S ribosomal protein S21 [Dinoroseobacter shibae DFL 12]
 gi|189044899|sp|A8LLI5|RS21_DINSH RecName: Full=30S ribosomal protein S21
 gi|157910562|gb|ABV91995.1| putative ribosomal protein S21 [Dinoroseobacter shibae DFL 12]
          Length = 68

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 46/68 (67%), Positives = 56/68 (82%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ HYEKPS+K+ R K+EAIRR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHYEKPSEKKAREKAEAIRRARKLARK 60

Query: 80 IAQREGAP 87
           AQREG  
Sbjct: 61 KAQREGGL 68


>gi|312115022|ref|YP_004012618.1| ribosomal protein S21 [Rhodomicrobium vannielii ATCC 17100]
 gi|311220151|gb|ADP71519.1| ribosomal protein S21 [Rhodomicrobium vannielii ATCC 17100]
          Length = 76

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 45/69 (65%), Positives = 56/69 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QAL+ LKKKMQ EG+ RE+K+R +YEKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVHVRDNNVDQALKALKKKMQREGIFREMKLRNYYEKPSEKRAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPV 88
           AQREG   
Sbjct: 61 KAQREGIVA 69


>gi|17936834|ref|NP_533623.1| 30S ribosomal protein S21 [Agrobacterium tumefaciens str. C58]
 gi|23822022|sp|Q8UB93|RS21B_AGRT5 RecName: Full=30S ribosomal protein S21 2
 gi|17741492|gb|AAL43939.1| 30S ribosomal protein S21 [Agrobacterium tumefaciens str. C58]
          Length = 78

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 46/76 (60%), Positives = 58/76 (76%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNVEQALRVLKK+MQ EG+ RE++ R  YEKPS+KRVR ++EA+RR RKL +K
Sbjct: 1  MQVLVRDNNVEQALRVLKKRMQREGIFREMRARESYEKPSEKRVREQAEAVRRHRKLEKK 60

Query: 80 IAQREGAPVSRLRQHR 95
            QREG   +  +  R
Sbjct: 61 KMQREGLLPAPKKAVR 76


>gi|209548414|ref|YP_002280331.1| 30S ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|218681654|ref|ZP_03529455.1| 30S ribosomal protein S21 [Rhizobium etli CIAT 894]
 gi|209534170|gb|ACI54105.1| ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|327190698|gb|EGE57780.1| 30S ribosomal protein S21 [Rhizobium etli CNPAF512]
          Length = 78

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 56/73 (76%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  +EKPS+KR R K+EAIRR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGLFREMKARSAFEKPSEKRAREKAEAIRRQRKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG   +  +
Sbjct: 61 KLQREGLLPAPKK 73


>gi|116251067|ref|YP_766905.1| 30S ribosomal protein S21 [Rhizobium leguminosarum bv. viciae
          3841]
 gi|241203663|ref|YP_002974759.1| 30S ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|119367212|sp|Q1MJR4|RS211_RHIL3 RecName: Full=30S ribosomal protein S21 1
 gi|115255715|emb|CAK06796.1| 30S ribosomal protein S21 A [Rhizobium leguminosarum bv. viciae
          3841]
 gi|240857553|gb|ACS55220.1| ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 79

 Score = 63.0 bits (152), Expect = 1e-08,   Method: Composition-based stats.
 Identities = 47/73 (64%), Positives = 56/73 (76%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  +EKPS+KR R K+EAIRR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGLFREMKARSAFEKPSEKRAREKAEAIRRQRKLARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG   +  +
Sbjct: 61 KLQREGLLPAPKK 73


>gi|149916407|ref|ZP_01904926.1| ribosomal protein S21 [Roseobacter sp. AzwK-3b]
 gi|149809677|gb|EDM69531.1| ribosomal protein S21 [Roseobacter sp. AzwK-3b]
          Length = 68

 Score = 63.0 bits (152), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 46/68 (67%), Positives = 56/68 (82%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K+R H+EKPS+K+ R K+EAIRR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLRQHFEKPSEKKAREKAEAIRRARKLARK 60

Query: 80 IAQREGAP 87
           AQREG  
Sbjct: 61 KAQREGLL 68


>gi|86356811|ref|YP_468703.1| 30S ribosomal protein S21 [Rhizobium etli CFN 42]
 gi|119367211|sp|Q2KB10|RS211_RHIEC RecName: Full=30S ribosomal protein S21 1
 gi|86280913|gb|ABC89976.1| 30S ribosomal protein S21 [Rhizobium etli CFN 42]
          Length = 78

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 48/76 (63%), Positives = 56/76 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  YEKPS+KR R K EA+RR RKL RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGLFREMKARSAYEKPSEKRAREKGEAVRRQRKLARK 60

Query: 80 IAQREGAPVSRLRQHR 95
            QREG   +  +  R
Sbjct: 61 KLQREGLLPAPKKAVR 76


>gi|192292894|ref|YP_001993499.1| 30S ribosomal protein S21 [Rhodopseudomonas palustris TIE-1]
 gi|192286643|gb|ACF03024.1| ribosomal protein S21 [Rhodopseudomonas palustris TIE-1]
          Length = 91

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 58/74 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V+VRDNNV+QALRVLKKKMQ EGV RE+K R  YEKPS+++ R KSEA+RR+RKL RK
Sbjct: 1  MQVIVRDNNVDQALRVLKKKMQREGVFREMKQRRSYEKPSERKTREKSEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLRQ 93
           A REG   +  ++
Sbjct: 61 KAIREGLLPAPPKK 74


>gi|161511110|ref|NP_767005.2| 30S ribosomal protein S21 [Bradyrhizobium japonicum USDA 110]
 gi|119367201|sp|Q89XE9|RS211_BRAJA RecName: Full=30S ribosomal protein S21 1
          Length = 92

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 48/74 (64%), Positives = 58/74 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EGV RE+K R  YEKPS+++ R KSEAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGVFREMKQRRSYEKPSERKTREKSEAIRRARKLARK 60

Query: 80 IAQREGAPVSRLRQ 93
           A REG   +  ++
Sbjct: 61 QAIREGLLPAPPKK 74


>gi|146337755|ref|YP_001202803.1| 30S ribosomal protein S21 [Bradyrhizobium sp. ORS278]
 gi|146190561|emb|CAL74563.1| ribosomal protein S21 [Bradyrhizobium sp. ORS278]
          Length = 107

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 42/74 (56%), Positives = 58/74 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDN+V++ALR+LK+KMQ EGV RE+K R  YEKPS+++ R KS+AIRR RK+ RK
Sbjct: 1  MQVLVRDNDVDKALRILKRKMQREGVFREMKRRRSYEKPSERKTREKSDAIRRQRKVARK 60

Query: 80 IAQREGAPVSRLRQ 93
           A REG   + +++
Sbjct: 61 AAIREGLLPAPVKK 74


>gi|167644866|ref|YP_001682529.1| 30S ribosomal protein S21 [Caulobacter sp. K31]
 gi|167347296|gb|ABZ70031.1| ribosomal protein S21 [Caulobacter sp. K31]
          Length = 89

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 46/81 (56%), Positives = 55/81 (67%)

Query: 12 SEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
              E   V + VRDNNV+QAL+ LKKKMQ EG  RE+K   HYEKPS+KR R K+EA+R
Sbjct: 4  PSNGERPLVQIFVRDNNVDQALKALKKKMQREGSFREMKRHVHYEKPSEKRARQKAEAVR 63

Query: 72 RSRKLMRKIAQREGAPVSRLR 92
          R+RKL RK AQREG      +
Sbjct: 64 RARKLARKRAQREGLIPMPKK 84


>gi|260427394|ref|ZP_05781373.1| ribosomal protein S21 [Citreicella sp. SE45]
 gi|260421886|gb|EEX15137.1| ribosomal protein S21 [Citreicella sp. SE45]
          Length = 68

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 45/68 (66%), Positives = 56/68 (82%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K+R H+EKPS+K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLRQHFEKPSEKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAP 87
           AQREG  
Sbjct: 61 KAQREGLL 68


>gi|89056382|ref|YP_511833.1| 30S ribosomal protein S21 [Jannaschia sp. CCS1]
 gi|119367265|sp|Q28KF4|RS21_JANSC RecName: Full=30S ribosomal protein S21
 gi|88865931|gb|ABD56808.1| SSU ribosomal protein S21P [Jannaschia sp. CCS1]
          Length = 68

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 46/66 (69%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ HYEKPS+KR R K+EAIRR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHYEKPSEKRAREKAEAIRRARKLARK 60

Query: 80 IAQREG 85
            QREG
Sbjct: 61 KLQREG 66


>gi|218670777|ref|ZP_03520448.1| 30S ribosomal protein S21 [Rhizobium etli GR56]
          Length = 77

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 45/73 (61%), Positives = 54/73 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+K R  YEKPS++RVR K++AI R RK  RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGLFREMKERRAYEKPSERRVREKAQAISRQRKAARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    R +
Sbjct: 61 KMQREGLLAGRKQ 73


>gi|327193847|gb|EGE60724.1| 30S ribosomal protein S21 [Rhizobium etli CNPAF512]
          Length = 77

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 45/73 (61%), Positives = 54/73 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+K R  YEKPS++RVR K++AI R RK  RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGLFREMKERRAYEKPSERRVREKAQAISRQRKAARK 60

Query: 80 IAQREGAPVSRLR 92
            QREG    R +
Sbjct: 61 KMQREGLLTGRKQ 73


>gi|84685523|ref|ZP_01013421.1| ribosomal protein S21 [Maritimibacter alkaliphilus HTCC2654]
 gi|84666680|gb|EAQ13152.1| ribosomal protein S21 [Rhodobacterales bacterium HTCC2654]
          Length = 68

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 46/66 (69%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K+R H+EKPS+K+ R K+EAIRR RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLRQHFEKPSEKKAREKAEAIRRQRKLARK 60

Query: 80 IAQREG 85
           AQREG
Sbjct: 61 KAQREG 66


>gi|298292871|ref|YP_003694810.1| ribosomal protein S21 [Starkeya novella DSM 506]
 gi|296929382|gb|ADH90191.1| ribosomal protein S21 [Starkeya novella DSM 506]
          Length = 92

 Score = 62.6 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 44/75 (58%), Positives = 56/75 (74%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EGV RE+K R  YEKPS++R R  +EAIRR++KL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGVFREMKARRAYEKPSERRKREDAEAIRRAKKLARK 60

Query: 80 IAQREGAPVSRLRQH 94
           A R+G   +  ++ 
Sbjct: 61 QAVRDGLIAAPKKKP 75


>gi|163792492|ref|ZP_02186469.1| Ribosomal protein S21 [alpha proteobacterium BAL199]
 gi|159182197|gb|EDP66706.1| Ribosomal protein S21 [alpha proteobacterium BAL199]
          Length = 67

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 44/66 (66%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKKMQ EGV RE+K+R +YEKPS+K+ R ++EA+RR RKLMRK
Sbjct: 1  MQVTVRDNNVDQALRALKKKMQREGVFREMKLRRNYEKPSEKKARERAEALRRHRKLMRK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 RMEREG 66


>gi|82946760|dbj|BAE51624.1| Ribosomal protein S21 [Magnetospirillum magneticum AMB-1]
          Length = 94

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 56/70 (80%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
              V VLVRDNNV+QAL+ LKKKMQ EGV RE+K+R +YEKPS++R R K+EA+RR+RK
Sbjct: 24 RWRNVQVLVRDNNVDQALKALKKKMQREGVFREMKLRRNYEKPSERRAREKAEAVRRARK 83

Query: 76 LMRKIAQREG 85
          L RK  +REG
Sbjct: 84 LERKRLEREG 93


>gi|332715881|ref|YP_004443347.1| 30S ribosomal protein S21 [Agrobacterium sp. H13-3]
 gi|325062566|gb|ADY66256.1| 30S ribosomal protein S21 [Agrobacterium sp. H13-3]
          Length = 78

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 44/76 (57%), Positives = 58/76 (76%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNVEQALRVLKK+MQ EG+ RE++ R  YEKPS+KR+R ++EA+RR RK+ +K
Sbjct: 1  MQVLVRDNNVEQALRVLKKRMQREGIFREMRARESYEKPSEKRIREEAEAVRRHRKMAKK 60

Query: 80 IAQREGAPVSRLRQHR 95
            QREG   +  +  R
Sbjct: 61 KLQREGLLPAPKKVAR 76


>gi|316933320|ref|YP_004108302.1| 30S ribosomal protein S21 [Rhodopseudomonas palustris DX-1]
 gi|315601034|gb|ADU43569.1| ribosomal protein S21 [Rhodopseudomonas palustris DX-1]
          Length = 91

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 58/74 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EGV RE+K R  YEKPS+++ R +SEA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGVFREMKQRRSYEKPSERKTRERSEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLRQ 93
           A REG   +  ++
Sbjct: 61 KAIREGLLPAPPKK 74


>gi|222082158|ref|YP_002541523.1| 30S ribosomal protein S21 [Agrobacterium radiobacter K84]
 gi|221726837|gb|ACM29926.1| ribosomal protein S21 [Agrobacterium radiobacter K84]
          Length = 79

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 46/74 (62%), Positives = 57/74 (77%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          +++LVRDNN+EQALRVLKKKMQ EG+ RE+K R  YEKPS++RVR K++AI R RK MRK
Sbjct: 1  MHILVRDNNIEQALRVLKKKMQREGLFREMKARQSYEKPSERRVREKAQAISRHRKAMRK 60

Query: 80 IAQREGAPVSRLRQ 93
            QREG      R+
Sbjct: 61 QMQREGLIPGPKRK 74


>gi|241554118|ref|YP_002979331.1| ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|240863424|gb|ACS61086.1| ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 78

 Score = 62.2 bits (150), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 54/73 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  YEKPS++RVR K++AI R RK  RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGLFREMKERRAYEKPSERRVREKAQAISRQRKATRK 60

Query: 80 IAQREGAPVSRLR 92
            QREG      R
Sbjct: 61 KMQREGLLPGPKR 73


>gi|83951268|ref|ZP_00960001.1| ribosomal protein S21 [Roseovarius nubinhibens ISM]
 gi|99082359|ref|YP_614513.1| 30S ribosomal protein S21 [Ruegeria sp. TM1040]
 gi|114764018|ref|ZP_01443259.1| 30S ribosomal protein S21 [Pelagibaca bermudensis HTCC2601]
 gi|126732362|ref|ZP_01748162.1| 30S ribosomal protein S21 [Sagittula stellata E-37]
 gi|163737254|ref|ZP_02144672.1| ribosomal protein S21 [Phaeobacter gallaeciensis BS107]
 gi|163740337|ref|ZP_02147731.1| 30S ribosomal protein S21 [Phaeobacter gallaeciensis 2.10]
 gi|254466157|ref|ZP_05079568.1| ribosomal protein S21 [Rhodobacterales bacterium Y4I]
 gi|254475264|ref|ZP_05088650.1| ribosomal protein S21 [Ruegeria sp. R11]
 gi|254509535|ref|ZP_05121602.1| ribosomal protein S21 [Rhodobacteraceae bacterium KLH11]
 gi|259417753|ref|ZP_05741672.1| ribosomal protein S21 [Silicibacter sp. TrichCH4B]
 gi|260431613|ref|ZP_05785584.1| ribosomal protein S21 [Silicibacter lacuscaerulensis ITI-1157]
 gi|119367313|sp|Q1GDL5|RS21_SILST RecName: Full=30S ribosomal protein S21
 gi|83839167|gb|EAP78463.1| ribosomal protein S21 [Roseovarius nubinhibens ISM]
 gi|99038639|gb|ABF65251.1| SSU ribosomal protein S21P [Ruegeria sp. TM1040]
 gi|114543610|gb|EAU46624.1| 30S ribosomal protein S21 [Roseovarius sp. HTCC2601]
 gi|126707231|gb|EBA06297.1| 30S ribosomal protein S21 [Sagittula stellata E-37]
 gi|161386195|gb|EDQ10570.1| 30S ribosomal protein S21 [Phaeobacter gallaeciensis 2.10]
 gi|161389858|gb|EDQ14209.1| ribosomal protein S21 [Phaeobacter gallaeciensis BS107]
 gi|206687065|gb|EDZ47547.1| ribosomal protein S21 [Rhodobacterales bacterium Y4I]
 gi|214029507|gb|EEB70342.1| ribosomal protein S21 [Ruegeria sp. R11]
 gi|221533246|gb|EEE36234.1| ribosomal protein S21 [Rhodobacteraceae bacterium KLH11]
 gi|259346659|gb|EEW58473.1| ribosomal protein S21 [Silicibacter sp. TrichCH4B]
 gi|260415441|gb|EEX08700.1| ribosomal protein S21 [Silicibacter lacuscaerulensis ITI-1157]
          Length = 68

 Score = 62.2 bits (150), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 45/68 (66%), Positives = 56/68 (82%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ H+EKPS+K+ R K+EAIRR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSEKKAREKAEAIRRARKLARK 60

Query: 80 IAQREGAP 87
           AQREG  
Sbjct: 61 KAQREGLL 68


>gi|168023960|ref|XP_001764505.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162684369|gb|EDQ70772.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 285

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 17/62 (27%), Positives = 39/62 (62%)

Query: 15  REISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           ++   V V V ++++E+A+R +K++++ +  ++ L+ R +Y KPS+ +V  + E  +R  
Sbjct: 166 QQTRTVMVEVTNDDLERAIRKMKRRLKDDNGIKLLREREYYRKPSELKVLARKERDKRIA 225

Query: 75  KL 76
           K 
Sbjct: 226 KK 227


>gi|89071083|ref|ZP_01158289.1| 30S ribosomal protein S21 [Oceanicola granulosus HTCC2516]
 gi|89043374|gb|EAR49594.1| 30S ribosomal protein S21 [Oceanicola granulosus HTCC2516]
          Length = 68

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 45/68 (66%), Positives = 55/68 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ H+EKPS+K+ R K+EAIRR RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSEKKAREKAEAIRRQRKLARK 60

Query: 80 IAQREGAP 87
           AQREG  
Sbjct: 61 KAQREGLL 68


>gi|307944494|ref|ZP_07659834.1| ribosomal protein S21 [Roseibium sp. TrichSKD4]
 gi|307772243|gb|EFO31464.1| ribosomal protein S21 [Roseibium sp. TrichSKD4]
          Length = 75

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 45/74 (60%), Positives = 59/74 (79%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + + VRDNNV+QALRVLKKK+Q EGVLRELK+R  +EKPS+K+ R K EA+RR+RK+ RK
Sbjct: 1  MQIQVRDNNVDQALRVLKKKLQREGVLRELKLRNRFEKPSEKKAREKQEAVRRARKMARK 60

Query: 80 IAQREGAPVSRLRQ 93
          +AQREG    +  +
Sbjct: 61 LAQREGLLPGKAAR 74


>gi|163732689|ref|ZP_02140134.1| ribosomal protein S21 [Roseobacter litoralis Och 149]
 gi|163744816|ref|ZP_02152176.1| 30S ribosomal protein S21 [Oceanibulbus indolifex HEL-45]
 gi|161381634|gb|EDQ06043.1| 30S ribosomal protein S21 [Oceanibulbus indolifex HEL-45]
 gi|161394049|gb|EDQ18373.1| ribosomal protein S21 [Roseobacter litoralis Och 149]
          Length = 68

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 56/66 (84%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ H+EKPS+K+ R K+EAIRR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSEKKAREKAEAIRRARKLARK 60

Query: 80 IAQREG 85
           AQREG
Sbjct: 61 KAQREG 66


>gi|144897989|emb|CAM74853.1| 30S ribosomal protein S21 [Magnetospirillum gryphiswaldense
          MSR-1]
          Length = 67

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 56/66 (84%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EGV RE+K+R +YEKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGVFREMKLRRNYEKPSEKRAREKAEAVRRARKLERK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 RLEREG 66


>gi|56695151|ref|YP_165498.1| 30S ribosomal protein S21 [Ruegeria pomeroyi DSS-3]
 gi|85706116|ref|ZP_01037211.1| ribosomal protein S21 [Roseovarius sp. 217]
 gi|86140183|ref|ZP_01058745.1| 30S ribosomal protein S21 [Roseobacter sp. MED193]
 gi|126739571|ref|ZP_01755263.1| 30S ribosomal protein S21 [Roseobacter sp. SK209-2-6]
 gi|149201308|ref|ZP_01878283.1| 30S ribosomal protein S21 [Roseovarius sp. TM1035]
 gi|81676463|sp|Q5LX29|RS21_SILPO RecName: Full=30S ribosomal protein S21
 gi|56676888|gb|AAV93554.1| ribosomal protein S21 [Ruegeria pomeroyi DSS-3]
 gi|85669280|gb|EAQ24146.1| ribosomal protein S21 [Roseovarius sp. 217]
 gi|85823120|gb|EAQ43333.1| 30S ribosomal protein S21 [Roseobacter sp. MED193]
 gi|126719217|gb|EBA15927.1| 30S ribosomal protein S21 [Roseobacter sp. SK209-2-6]
 gi|149145641|gb|EDM33667.1| 30S ribosomal protein S21 [Roseovarius sp. TM1035]
          Length = 68

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 56/66 (84%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ H+EKPS+K+ R K+EAIRR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSEKKAREKAEAIRRARKLARK 60

Query: 80 IAQREG 85
           AQREG
Sbjct: 61 KAQREG 66


>gi|126725108|ref|ZP_01740951.1| ribosomal protein S21 [Rhodobacterales bacterium HTCC2150]
 gi|126706272|gb|EBA05362.1| ribosomal protein S21 [Rhodobacterales bacterium HTCC2150]
          Length = 68

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 46/66 (69%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K+R HYEKPS+K+ R  +EAIRR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLRQHYEKPSEKKAREGAEAIRRARKLARK 60

Query: 80 IAQREG 85
           AQREG
Sbjct: 61 KAQREG 66


>gi|255263747|ref|ZP_05343089.1| ribosomal protein S21 [Thalassiobium sp. R2A62]
 gi|255106082|gb|EET48756.1| ribosomal protein S21 [Thalassiobium sp. R2A62]
          Length = 68

 Score = 61.8 bits (149), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ H+EKPS+K+ R K+EAIRR RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSEKKAREKAEAIRRQRKLARK 60

Query: 80 IAQREG 85
           AQREG
Sbjct: 61 KAQREG 66


>gi|162148855|ref|YP_001603316.1| 30S ribosomal protein S21 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|209545396|ref|YP_002277625.1| 30S ribosomal protein S21 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|189044903|sp|A9HS49|RS21_GLUDA RecName: Full=30S ribosomal protein S21
 gi|161787432|emb|CAP57027.1| 30S ribosomal protein S21 [Gluconacetobacter diazotrophicus PAl
          5]
 gi|209533073|gb|ACI53010.1| ribosomal protein S21 [Gluconacetobacter diazotrophicus PAl 5]
          Length = 67

 Score = 61.4 bits (148), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+R HYEKPS+++ R  +EA+RR+RK+ RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRRHYEKPSERKAREAAEAVRRARKMERK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 RLEREG 66


>gi|58038610|ref|YP_190574.1| 30S ribosomal protein S21 [Gluconobacter oxydans 621H]
 gi|81672756|sp|Q5FUM8|RS21_GLUOX RecName: Full=30S ribosomal protein S21
 gi|58001024|gb|AAW59918.1| SSU ribosomal protein S21P [Gluconobacter oxydans 621H]
          Length = 67

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EGV RE+K+R H+EKPS+KR R  +EA+RR+RK+ RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGVFREMKLRRHFEKPSEKRAREAAEAVRRARKMERK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 RLEREG 66


>gi|83592379|ref|YP_426131.1| 30S ribosomal protein S21 [Rhodospirillum rubrum ATCC 11170]
 gi|119367302|sp|Q2RVK1|RS21_RHORT RecName: Full=30S ribosomal protein S21
 gi|83575293|gb|ABC21844.1| SSU ribosomal protein S21P [Rhodospirillum rubrum ATCC 11170]
          Length = 80

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 47/79 (59%), Positives = 59/79 (74%)

Query: 7  FRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLK 66
            G      E + V VLVRDNNV+QAL+ LKKKMQ EGV RE+K+R ++EKPS+KR R K
Sbjct: 1  MGGGSQVEGERALVQVLVRDNNVDQALKALKKKMQREGVFREMKLRRNFEKPSEKRAREK 60

Query: 67 SEAIRRSRKLMRKIAQREG 85
          +EA+RR+RKL RK  +REG
Sbjct: 61 AEAVRRARKLERKRLEREG 79


>gi|158425252|ref|YP_001526544.1| ribosomal protein S21 [Azorhizobium caulinodans ORS 571]
 gi|158332141|dbj|BAF89626.1| ribosomal protein S21 [Azorhizobium caulinodans ORS 571]
          Length = 77

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 61/73 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+KR R ++EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKRAREEAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
           AQREG   S+ R
Sbjct: 61 RAQREGLLPSKPR 73


>gi|85707670|ref|ZP_01038736.1| 30S ribosomal protein S21 [Erythrobacter sp. NAP1]
 gi|149187022|ref|ZP_01865329.1| 30S ribosomal protein S21 [Erythrobacter sp. SD-21]
 gi|85689204|gb|EAQ29207.1| 30S ribosomal protein S21 [Erythrobacter sp. NAP1]
 gi|148829311|gb|EDL47755.1| 30S ribosomal protein S21 [Erythrobacter sp. SD-21]
          Length = 68

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 42/66 (63%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + ++VRDNNV+QALR LKKK+Q EGV RE+K+R HYEKPS+KR R K+ A+RR+RKL RK
Sbjct: 1  MQIMVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRAREKAAAVRRARKLERK 60

Query: 80 IAQREG 85
            +R+G
Sbjct: 61 RMERDG 66


>gi|46201577|ref|ZP_00054750.2| COG0828: Ribosomal protein S21 [Magnetospirillum magnetotacticum
          MS-1]
 gi|162319787|ref|YP_422183.2| 30S ribosomal protein S21 [Magnetospirillum magneticum AMB-1]
 gi|119367269|sp|Q2W3F1|RS21_MAGMM RecName: Full=30S ribosomal protein S21
          Length = 67

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 44/66 (66%), Positives = 56/66 (84%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EGV RE+K+R +YEKPS++R R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGVFREMKLRRNYEKPSERRAREKAEAVRRARKLERK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 RLEREG 66


>gi|84500397|ref|ZP_00998646.1| 30S ribosomal protein S21 (RpsU) [Oceanicola batsensis HTCC2597]
 gi|84391350|gb|EAQ03682.1| 30S ribosomal protein S21 (RpsU) [Oceanicola batsensis HTCC2597]
          Length = 68

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 45/68 (66%), Positives = 55/68 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ H+EKPS K+ R K+EAIRR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSVKKAREKAEAIRRARKLARK 60

Query: 80 IAQREGAP 87
           AQREG  
Sbjct: 61 KAQREGLL 68


>gi|254462154|ref|ZP_05075570.1| ribosomal protein S21 [Rhodobacterales bacterium HTCC2083]
 gi|206678743|gb|EDZ43230.1| ribosomal protein S21 [Rhodobacteraceae bacterium HTCC2083]
          Length = 68

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ H+EKPS+K+ R K+EAIRRSRKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSEKKAREKAEAIRRSRKLARK 60

Query: 80 IAQREG 85
            QREG
Sbjct: 61 KLQREG 66


>gi|83944302|ref|ZP_00956757.1| 30S ribosomal protein S21 [Sulfitobacter sp. EE-36]
 gi|83953343|ref|ZP_00962065.1| 30S ribosomal protein S21 [Sulfitobacter sp. NAS-14.1]
 gi|83842311|gb|EAP81479.1| 30S ribosomal protein S21 [Sulfitobacter sp. NAS-14.1]
 gi|83844846|gb|EAP82728.1| 30S ribosomal protein S21 [Sulfitobacter sp. EE-36]
          Length = 68

 Score = 61.4 bits (148), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ H+EKPS+K+ R K+EAIRRSRKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSEKKAREKAEAIRRSRKLARK 60

Query: 80 IAQREG 85
            QREG
Sbjct: 61 KLQREG 66


>gi|83859927|ref|ZP_00953447.1| 30S ribosomal protein S21 [Oceanicaulis alexandrii HTCC2633]
 gi|83852286|gb|EAP90140.1| 30S ribosomal protein S21 [Oceanicaulis alexandrii HTCC2633]
          Length = 101

 Score = 61.1 bits (147), Expect = 4e-08,   Method: Composition-based stats.
 Identities = 50/76 (65%), Positives = 59/76 (77%)

Query: 15 REISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           EI+ V ++VRDNNVEQAL+ LKKKMQ EG  RE+K R HYEKPS+K+ R K+EAIRR+R
Sbjct: 21 GEITIVQIVVRDNNVEQALKALKKKMQREGTFREMKRRNHYEKPSEKKARQKAEAIRRAR 80

Query: 75 KLMRKIAQREGAPVSR 90
          KL RK AQREG    R
Sbjct: 81 KLARKRAQREGLLPKR 96


>gi|85373098|ref|YP_457160.1| 30S ribosomal protein S21 [Erythrobacter litoralis HTCC2594]
 gi|122545280|sp|Q2ND78|RS21_ERYLH RecName: Full=30S ribosomal protein S21
 gi|84786181|gb|ABC62363.1| ribosomal protein S21 [Erythrobacter litoralis HTCC2594]
          Length = 68

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + ++VRDNNV+QALR LKKK+Q EGV RE+K+R HYEKPS+KR R K+ A+RR+RK+ RK
Sbjct: 1  MQIMVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRAREKAAAVRRARKMERK 60

Query: 80 IAQREG 85
            +R+G
Sbjct: 61 RMERDG 66


>gi|220921484|ref|YP_002496785.1| 30S ribosomal protein S21 [Methylobacterium nodulans ORS 2060]
 gi|254813723|sp|B8INF6|RS21_METNO RecName: Full=30S ribosomal protein S21
 gi|219946090|gb|ACL56482.1| ribosomal protein S21 [Methylobacterium nodulans ORS 2060]
          Length = 96

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 56/76 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  YEKPS ++ R K+EA+RR+RK  RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGIFREMKQRKAYEKPSVRKAREKAEAVRRARKQARK 60

Query: 80 IAQREGAPVSRLRQHR 95
           A REG   +   + R
Sbjct: 61 TAIREGLIAAPKPKAR 76


>gi|326388342|ref|ZP_08209938.1| 30S ribosomal protein S21 [Novosphingobium nitrogenifigens DSM
          19370]
 gi|326207074|gb|EGD57895.1| 30S ribosomal protein S21 [Novosphingobium nitrogenifigens DSM
          19370]
          Length = 68

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 57/67 (85%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + +LVRDNNV+QALR LKKK+Q EGV RE+K+R HYEKPS+KR R K+ A+RR+RKL RK
Sbjct: 1  MQILVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRAREKAAAVRRARKLERK 60

Query: 80 IAQREGA 86
           A+R+GA
Sbjct: 61 RAERDGA 67


>gi|119384999|ref|YP_916055.1| 30S ribosomal protein S21 [Paracoccus denitrificans PD1222]
 gi|294676037|ref|YP_003576652.1| 30S ribosomal protein S21 [Rhodobacter capsulatus SB 1003]
 gi|166224047|sp|A1B4B5|RS21_PARDP RecName: Full=30S ribosomal protein S21
 gi|119374766|gb|ABL70359.1| SSU ribosomal protein S21P [Paracoccus denitrificans PD1222]
 gi|294474857|gb|ADE84245.1| 30S ribosomal protein S21 [Rhodobacter capsulatus SB 1003]
          Length = 68

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 46/68 (67%), Positives = 56/68 (82%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNVEQALR LKKK+Q EGV RE+K++ H+EKPS K+ R K+EA+RR+RKL RK
Sbjct: 1  MQVSVRDNNVEQALRALKKKLQREGVFREMKLKQHFEKPSVKKAREKAEAVRRARKLARK 60

Query: 80 IAQREGAP 87
           AQREGA 
Sbjct: 61 KAQREGAL 68


>gi|119367260|sp|Q0BUX3|RS21_GRABC RecName: Full=30S ribosomal protein S21
          Length = 67

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 41/66 (62%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+R H+EKPS+++ R  +EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRRHFEKPSERKAREAAEAVRRARKLERK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 RLEREG 66


>gi|154245201|ref|YP_001416159.1| ribosomal protein S21 [Xanthobacter autotrophicus Py2]
 gi|154159286|gb|ABS66502.1| ribosomal protein S21 [Xanthobacter autotrophicus Py2]
          Length = 76

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 51/76 (67%), Positives = 62/76 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+KR R ++EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKRAREEAEAIRRARKLARK 60

Query: 80 IAQREGAPVSRLRQHR 95
           AQREG   S+ R  R
Sbjct: 61 RAQREGLIPSKPRPTR 76


>gi|296284582|ref|ZP_06862580.1| ribosomal protein S21 [Citromicrobium bathyomarinum JL354]
          Length = 67

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 56/66 (84%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + ++VRDNNV+QALR LKKK+Q EGV RE+K+R HYEKPS+KR R K+ A+RR+RKL RK
Sbjct: 1  MQIIVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRAREKAAAVRRARKLERK 60

Query: 80 IAQREG 85
           A+R+G
Sbjct: 61 RAERDG 66


>gi|294010648|ref|YP_003544108.1| ribosomal protein S21 [Sphingobium japonicum UT26S]
 gi|307293613|ref|ZP_07573457.1| ribosomal protein S21 [Sphingobium chlorophenolicum L-1]
 gi|292673978|dbj|BAI95496.1| ribosomal protein S21 [Sphingobium japonicum UT26S]
 gi|306879764|gb|EFN10981.1| ribosomal protein S21 [Sphingobium chlorophenolicum L-1]
          Length = 68

 Score = 61.1 bits (147), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 56/66 (84%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + ++VRDNNV+QALR LKKK+Q EGV RE+K+R HYEKPS+KR R K+ A+RR+RKL RK
Sbjct: 1  MQIIVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRAREKAAAVRRARKLERK 60

Query: 80 IAQREG 85
           A+R+G
Sbjct: 61 RAERDG 66


>gi|77464291|ref|YP_353795.1| 30S ribosomal protein S21 [Rhodobacter sphaeroides 2.4.1]
 gi|126463133|ref|YP_001044247.1| 30S ribosomal protein S21 [Rhodobacter sphaeroides ATCC 17029]
 gi|146278471|ref|YP_001168630.1| 30S ribosomal protein S21 [Rhodobacter sphaeroides ATCC 17025]
 gi|221640175|ref|YP_002526437.1| 30S ribosomal protein S21 [Rhodobacter sphaeroides KD131]
 gi|332559180|ref|ZP_08413502.1| 30S ribosomal protein S21 [Rhodobacter sphaeroides WS8N]
 gi|119367303|sp|Q3IZZ0|RS21_RHOS4 RecName: Full=30S ribosomal protein S21
 gi|166224061|sp|A3PMA9|RS21_RHOS1 RecName: Full=30S ribosomal protein S21
 gi|166224062|sp|A4WVB1|RS21_RHOS5 RecName: Full=30S ribosomal protein S21
 gi|254813728|sp|B9KLR1|RS21_RHOSK RecName: Full=30S ribosomal protein S21
 gi|77388709|gb|ABA79894.1| SSU ribosomal protein S21P [Rhodobacter sphaeroides 2.4.1]
 gi|126104797|gb|ABN77475.1| SSU ribosomal protein S21P [Rhodobacter sphaeroides ATCC 17029]
 gi|145556712|gb|ABP71325.1| SSU ribosomal protein S21P [Rhodobacter sphaeroides ATCC 17025]
 gi|221160956|gb|ACM01936.1| 30S ribosomal protein S21 [Rhodobacter sphaeroides KD131]
 gi|332276892|gb|EGJ22207.1| 30S ribosomal protein S21 [Rhodobacter sphaeroides WS8N]
          Length = 68

 Score = 61.1 bits (147), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 46/68 (67%), Positives = 56/68 (82%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNVEQALR LKKK+Q EGV RE+K++ H+EKPS KR R ++EA+RR+RKL RK
Sbjct: 1  MQVSVRDNNVEQALRALKKKLQREGVFREMKLKQHFEKPSVKRAREQAEAVRRARKLARK 60

Query: 80 IAQREGAP 87
           AQREGA 
Sbjct: 61 KAQREGAL 68


>gi|258542785|ref|YP_003188218.1| 30S ribosomal protein S21 [Acetobacter pasteurianus IFO 3283-01]
 gi|329114616|ref|ZP_08243375.1| 30S ribosomal protein S21 [Acetobacter pomorum DM001]
 gi|256633863|dbj|BAH99838.1| SSU ribosomal protein S21P [Acetobacter pasteurianus IFO 3283-01]
 gi|256636922|dbj|BAI02891.1| SSU ribosomal protein S21P [Acetobacter pasteurianus IFO 3283-03]
 gi|256639975|dbj|BAI05937.1| SSU ribosomal protein S21P [Acetobacter pasteurianus IFO 3283-07]
 gi|256643031|dbj|BAI08986.1| SSU ribosomal protein S21P [Acetobacter pasteurianus IFO 3283-22]
 gi|256646086|dbj|BAI12034.1| SSU ribosomal protein S21P [Acetobacter pasteurianus IFO 3283-26]
 gi|256649139|dbj|BAI15080.1| SSU ribosomal protein S21P [Acetobacter pasteurianus IFO 3283-32]
 gi|256652126|dbj|BAI18060.1| SSU ribosomal protein S21P [Acetobacter pasteurianus IFO
          3283-01-42C]
 gi|256655183|dbj|BAI21110.1| SSU ribosomal protein S21P [Acetobacter pasteurianus IFO 3283-12]
 gi|326696096|gb|EGE47778.1| 30S ribosomal protein S21 [Acetobacter pomorum DM001]
          Length = 67

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 40/66 (60%), Positives = 56/66 (84%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          ++VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+R H+EKPS+++ R  +EA+RR+RK+ RK
Sbjct: 1  MHVLVRDNNVDQALKALKKKMQREGIFREMKLRRHFEKPSERKAREAAEAVRRARKMERK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 RLEREG 66


>gi|218458495|ref|ZP_03498586.1| 30S ribosomal protein S21 [Rhizobium etli Kim 5]
          Length = 70

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 43/70 (61%), Positives = 52/70 (74%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNN++QALR LKKKMQ EG+ RE+K R  YEKPS++RVR K++AI R RK  RK
Sbjct: 1  MQVLVRDNNIDQALRALKKKMQREGLFREMKERRAYEKPSERRVREKAQAISRQRKAARK 60

Query: 80 IAQREGAPVS 89
            QREG    
Sbjct: 61 KMQREGLLAG 70


>gi|13472729|ref|NP_104296.1| 30S ribosomal protein S21 [Mesorhizobium loti MAFF303099]
 gi|260460556|ref|ZP_05808807.1| ribosomal protein S21 [Mesorhizobium opportunistum WSM2075]
 gi|20978724|sp|Q98GY4|RS21_RHILO RecName: Full=30S ribosomal protein S21
 gi|14023476|dbj|BAB50082.1| ribosomal protein S21 [Mesorhizobium loti MAFF303099]
 gi|259033661|gb|EEW34921.1| ribosomal protein S21 [Mesorhizobium opportunistum WSM2075]
          Length = 88

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 51/73 (69%), Positives = 59/73 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMRGHYEKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGHYEKPSEKRAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
           AQREG      R
Sbjct: 61 RAQREGLLPMTPR 73


>gi|94496071|ref|ZP_01302650.1| 30S ribosomal protein S21 [Sphingomonas sp. SKA58]
 gi|94424763|gb|EAT09785.1| 30S ribosomal protein S21 [Sphingomonas sp. SKA58]
          Length = 68

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 42/66 (63%), Positives = 56/66 (84%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + ++VRDNNV+QALR LKKK+Q EGV RE+K+R HYEKPS+KR R K+ A+RR+RK+ RK
Sbjct: 1  MQIIVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRAREKAAAVRRTRKMERK 60

Query: 80 IAQREG 85
           A+R+G
Sbjct: 61 RAERDG 66


>gi|329850346|ref|ZP_08265191.1| ribosomal protein S21 [Asticcacaulis biprosthecum C19]
 gi|328840661|gb|EGF90232.1| ribosomal protein S21 [Asticcacaulis biprosthecum C19]
          Length = 83

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 44/76 (57%), Positives = 54/76 (71%)

Query: 14 GREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
            E   V + VRDNNV+QAL+ LKKKMQ EG  RE+K   HYEKPS+KR R ++EA+RR+
Sbjct: 2  NGERPLVQIFVRDNNVDQALKALKKKMQREGSFREMKRHVHYEKPSEKRARQQAEAVRRA 61

Query: 74 RKLMRKIAQREGAPVS 89
          RKL RK  QREG   +
Sbjct: 62 RKLARKRIQREGGITA 77


>gi|209546656|ref|YP_002278574.1| 30S ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
 gi|209537900|gb|ACI57834.1| ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM2304]
          Length = 77

 Score = 60.7 bits (146), Expect = 6e-08,   Method: Composition-based stats.
 Identities = 45/70 (64%), Positives = 54/70 (77%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  YEKPS++RVR K++AI R RK +RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGLFREMKERRAYEKPSERRVREKAQAISRQRKAVRK 60

Query: 80 IAQREGAPVS 89
            QREG    
Sbjct: 61 KLQREGLISG 70


>gi|254459663|ref|ZP_05073079.1| ribosomal protein S21 [Rhodobacterales bacterium HTCC2083]
 gi|206676252|gb|EDZ40739.1| ribosomal protein S21 [Rhodobacteraceae bacterium HTCC2083]
          Length = 66

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALRVLKKK+Q EGV +E+K++ H+EKPS+K+ R K EAIRR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRVLKKKLQREGVFQEMKLKQHFEKPSEKKAREKGEAIRRARKLARK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 KLEREG 66


>gi|254486989|ref|ZP_05100194.1| ribosomal protein S21 [Roseobacter sp. GAI101]
 gi|214043858|gb|EEB84496.1| ribosomal protein S21 [Roseobacter sp. GAI101]
          Length = 68

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 46/66 (69%), Positives = 56/66 (84%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ H+EKPS+KRVR ++EAIRRSRKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSEKRVRQQAEAIRRSRKLARK 60

Query: 80 IAQREG 85
            QREG
Sbjct: 61 KLQREG 66


>gi|153008722|ref|YP_001369937.1| 30S ribosomal protein S21 [Ochrobactrum anthropi ATCC 49188]
 gi|166224044|sp|A6WYQ4|RS21_OCHA4 RecName: Full=30S ribosomal protein S21
 gi|151560610|gb|ABS14108.1| ribosomal protein S21 [Ochrobactrum anthropi ATCC 49188]
          Length = 75

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 51/72 (70%), Positives = 59/72 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMRGHYEKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGHYEKPSEKRAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRL 91
           AQREG    R 
Sbjct: 61 RAQREGLIGGRP 72


>gi|62858627|ref|NP_001016340.1| mitochondrial ribosomal protein S21 [Xenopus (Silurana)
          tropicalis]
 gi|89266977|emb|CAJ82180.1| mitochondrial ribosomal protein S21 [Xenopus (Silurana)
          tropicalis]
 gi|163916426|gb|AAI57197.1| mitochondrial ribosomal protein S21 [Xenopus (Silurana)
          tropicalis]
          Length = 87

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 32/59 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          +  A  V+V   NV+ A ++L + +  +G++ E + R +YEKP  KR R   E  RR  
Sbjct: 6  KFIARTVMVPSGNVDMAYKMLNRILTVDGIVDEARRRRYYEKPCNKRRRENYENCRRIY 64


>gi|260574195|ref|ZP_05842200.1| ribosomal protein S21 [Rhodobacter sp. SW2]
 gi|259023661|gb|EEW26952.1| ribosomal protein S21 [Rhodobacter sp. SW2]
          Length = 68

 Score = 60.7 bits (146), Expect = 7e-08,   Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 54/68 (79%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNVEQALR LKKK+Q EGV RE+K++ H+EKPS K+ R ++EA+RR+RKL RK
Sbjct: 1  MQVSVRDNNVEQALRALKKKLQREGVFREMKLKQHFEKPSVKKAREQAEAVRRARKLARK 60

Query: 80 IAQREGAP 87
            QREG  
Sbjct: 61 KLQREGGL 68


>gi|126733760|ref|ZP_01749507.1| 30S ribosomal protein S21 [Roseobacter sp. CCS2]
 gi|126716626|gb|EBA13490.1| 30S ribosomal protein S21 [Roseobacter sp. CCS2]
          Length = 68

 Score = 60.7 bits (146), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 53/68 (77%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ H+EKPS ++ R K+EAIRR RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSVRKAREKAEAIRRQRKLARK 60

Query: 80 IAQREGAP 87
            QREG  
Sbjct: 61 KLQREGLL 68


>gi|294084905|ref|YP_003551665.1| 30S ribosomal protein S21 [Candidatus Puniceispirillum marinum
          IMCC1322]
 gi|292664480|gb|ADE39581.1| Ribosomal protein S21 [Candidatus Puniceispirillum marinum
          IMCC1322]
          Length = 67

 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 44/66 (66%), Positives = 53/66 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          ++V VRDNNV+QALRVLKKKMQ EGV RE+K R  YEKPS++R R  +E+ RR RKLMRK
Sbjct: 1  MFVTVRDNNVDQALRVLKKKMQREGVFREMKNRRSYEKPSERRAREAAESTRRVRKLMRK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 RLEREG 66


>gi|86139754|ref|ZP_01058321.1| 30S ribosomal protein S21 [Roseobacter sp. MED193]
 gi|85823645|gb|EAQ43853.1| 30S ribosomal protein S21 [Roseobacter sp. MED193]
          Length = 66

 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 44/66 (66%), Positives = 56/66 (84%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNN++QALRVLKKK+Q EGV RE+K++ H+EKPS+KR+R K EAIRR+RKL RK
Sbjct: 1  MQVSVRDNNIDQALRVLKKKLQREGVFREMKLKEHFEKPSEKRLREKGEAIRRARKLARK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 KLEREG 66


>gi|170739023|ref|YP_001767678.1| 30S ribosomal protein S21 [Methylobacterium sp. 4-46]
 gi|226695027|sp|B0U7F9|RS21_METS4 RecName: Full=30S ribosomal protein S21
 gi|168193297|gb|ACA15244.1| ribosomal protein S21 [Methylobacterium sp. 4-46]
          Length = 97

 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 44/70 (62%), Positives = 54/70 (77%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EG+ RE+K R  YEKPS ++ R K+EA+RR+RK  RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGIFREMKQRKAYEKPSVRKAREKAEAVRRARKQARK 60

Query: 80 IAQREGAPVS 89
           A REG   +
Sbjct: 61 TAIREGLIAA 70


>gi|310814734|ref|YP_003962698.1| 30S ribosomal protein S21 [Ketogulonicigenium vulgare Y25]
 gi|308753469|gb|ADO41398.1| 30S ribosomal protein S21 [Ketogulonicigenium vulgare Y25]
          Length = 68

 Score = 60.3 bits (145), Expect = 8e-08,   Method: Composition-based stats.
 Identities = 43/68 (63%), Positives = 53/68 (77%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ H+EKPS K+ R ++EAIRR RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSVKKAREQAEAIRRQRKLARK 60

Query: 80 IAQREGAP 87
            QREG  
Sbjct: 61 KLQREGLI 68


>gi|118588377|ref|ZP_01545786.1| 30S ribosomal protein S21 [Stappia aggregata IAM 12614]
 gi|118439083|gb|EAV45715.1| 30S ribosomal protein S21 [Stappia aggregata IAM 12614]
          Length = 93

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 48/74 (64%), Positives = 60/74 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          V VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGH+EKPS+K+ R K+EAIRR+RKL RK
Sbjct: 19 VQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHFEKPSEKKAREKAEAIRRARKLARK 78

Query: 80 IAQREGAPVSRLRQ 93
           AQREG    +  +
Sbjct: 79 RAQREGLLPGKSAR 92


>gi|255536923|ref|XP_002509528.1| structural constituent of ribosome, putative [Ricinus communis]
 gi|223549427|gb|EEF50915.1| structural constituent of ribosome, putative [Ricinus communis]
          Length = 175

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 33/64 (51%), Gaps = 1/64 (1%)

Query: 15  REISAVYVLVRDNNVE-QALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
           R    V V+V DN  E + L   ++++   GV++E K R  +E    ++ R   EA +R+
Sbjct: 77  RSAYNVQVIVDDNEPEERLLNRFRREVMRAGVIQECKRRRFFENKQDEKKRKTREAAKRN 136

Query: 74  RKLM 77
           +K  
Sbjct: 137 KKRR 140


>gi|254437494|ref|ZP_05050988.1| ribosomal protein S21 [Octadecabacter antarcticus 307]
 gi|198252940|gb|EDY77254.1| ribosomal protein S21 [Octadecabacter antarcticus 307]
          Length = 68

 Score = 60.3 bits (145), Expect = 9e-08,   Method: Composition-based stats.
 Identities = 42/68 (61%), Positives = 53/68 (77%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++  +EKPS+K+ R K+EAIRR RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQAFEKPSEKKAREKAEAIRRQRKLARK 60

Query: 80 IAQREGAP 87
            +REG  
Sbjct: 61 KLEREGMV 68


>gi|87200848|ref|YP_498105.1| 30S ribosomal protein S21 [Novosphingobium aromaticivorans DSM
          12444]
 gi|119367282|sp|Q2G4F2|RS21_NOVAD RecName: Full=30S ribosomal protein S21
 gi|87136529|gb|ABD27271.1| SSU ribosomal protein S21P [Novosphingobium aromaticivorans DSM
          12444]
          Length = 68

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 56/67 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + +LVRDNNV+QALR LKKK+Q EGV RE+K+R H+EKPS+KR R K+ A+RR+RKL RK
Sbjct: 1  MQILVRDNNVDQALRALKKKLQREGVYREMKLRRHFEKPSEKRAREKAAAVRRARKLERK 60

Query: 80 IAQREGA 86
            +R+GA
Sbjct: 61 RQERDGA 67


>gi|254439992|ref|ZP_05053486.1| ribosomal protein S21 [Octadecabacter antarcticus 307]
 gi|198255438|gb|EDY79752.1| ribosomal protein S21 [Octadecabacter antarcticus 307]
          Length = 66

 Score = 59.9 bits (144), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALRVLKKK+Q EGV +E+K++ H+EKPS+K+ R K EAIRR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRVLKKKLQSEGVFQEMKLKQHFEKPSEKKAREKGEAIRRARKLARK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 KLEREG 66


>gi|307193001|gb|EFN75989.1| 28S ribosomal protein S21, mitochondrial [Harpegnathos saltator]
          Length = 129

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 33/56 (58%)

Query: 16  EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
           +  +  + V++N+V++A R+L + +  E +  + +   +YEKP+Q R R+  E  +
Sbjct: 47  QFISRTIFVQNNDVDKACRILNRILSKEDIFGQYRRTRYYEKPTQVRRRVNFEKCK 102


>gi|255075013|ref|XP_002501181.1| predicted protein [Micromonas sp. RCC299]
 gi|226516444|gb|ACO62439.1| predicted protein [Micromonas sp. RCC299]
          Length = 151

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 30/94 (31%), Positives = 53/94 (56%), Gaps = 3/94 (3%)

Query: 1   MLVFNAFRGIFSEGREISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPS 59
            L ++        G++   + V V DNN V++ALR L++ M GEG+++E+K R ++ K S
Sbjct: 58  FLAWHPALACAVRGKKTGGMTVYVGDNNDVDRALRKLRRMMIGEGLVQEMKDRRYFRKGS 117

Query: 60  QKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQ 93
            KRV  +S    ++RK  + + +R G  + R  +
Sbjct: 118 DKRVEARSMREYKTRK--QTLRRRLGWIMHRKER 149


>gi|84515148|ref|ZP_01002511.1| 30S ribosomal protein S21 [Loktanella vestfoldensis SKA53]
 gi|84511307|gb|EAQ07761.1| 30S ribosomal protein S21 [Loktanella vestfoldensis SKA53]
          Length = 68

 Score = 59.5 bits (143), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 53/66 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ H+EKPS ++ R K+EAIRR RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSIRKAREKAEAIRRQRKLARK 60

Query: 80 IAQREG 85
            QREG
Sbjct: 61 KLQREG 66


>gi|17988677|ref|NP_541310.1| 30S ribosomal protein S21 [Brucella melitensis bv. 1 str. 16M]
 gi|23500692|ref|NP_700132.1| 30S ribosomal protein S21 [Brucella suis 1330]
 gi|62317209|ref|YP_223062.1| 30S ribosomal protein S21 [Brucella abortus bv. 1 str. 9-941]
 gi|83269191|ref|YP_418482.1| 30S ribosomal protein S21 [Brucella melitensis biovar Abortus
          2308]
 gi|148558375|ref|YP_001257883.1| 30S ribosomal protein S21 [Brucella ovis ATCC 25840]
 gi|161621018|ref|YP_001594904.1| 30S ribosomal protein S21 [Brucella canis ATCC 23365]
 gi|163845079|ref|YP_001622734.1| 30S ribosomal protein S21 [Brucella suis ATCC 23445]
 gi|189022473|ref|YP_001932214.1| 30S ribosomal protein S21 [Brucella abortus S19]
 gi|225686726|ref|YP_002734698.1| 30S ribosomal protein S21 [Brucella melitensis ATCC 23457]
 gi|254690716|ref|ZP_05153970.1| 30S ribosomal protein S21 [Brucella abortus bv. 6 str. 870]
 gi|254695979|ref|ZP_05157807.1| 30S ribosomal protein S21 [Brucella abortus bv. 3 str. Tulya]
 gi|254698493|ref|ZP_05160321.1| 30S ribosomal protein S21 [Brucella abortus bv. 2 str. 86/8/59]
 gi|254703283|ref|ZP_05165111.1| 30S ribosomal protein S21 [Brucella suis bv. 3 str. 686]
 gi|254705570|ref|ZP_05167398.1| 30S ribosomal protein S21 [Brucella pinnipedialis M163/99/10]
 gi|254710804|ref|ZP_05172615.1| 30S ribosomal protein S21 [Brucella pinnipedialis B2/94]
 gi|254712722|ref|ZP_05174533.1| 30S ribosomal protein S21 [Brucella ceti M644/93/1]
 gi|254715792|ref|ZP_05177603.1| 30S ribosomal protein S21 [Brucella ceti M13/05/1]
 gi|254720175|ref|ZP_05181986.1| 30S ribosomal protein S21 [Brucella sp. 83/13]
 gi|254731941|ref|ZP_05190519.1| 30S ribosomal protein S21 [Brucella abortus bv. 4 str. 292]
 gi|256015727|ref|YP_003105736.1| 30S ribosomal protein S21 [Brucella microti CCM 4915]
 gi|256029186|ref|ZP_05442800.1| 30S ribosomal protein S21 [Brucella pinnipedialis M292/94/1]
 gi|256043835|ref|ZP_05446756.1| 30S ribosomal protein S21 [Brucella melitensis bv. 1 str. Rev.1]
 gi|256111113|ref|ZP_05452160.1| 30S ribosomal protein S21 [Brucella melitensis bv. 3 str. Ether]
 gi|256157379|ref|ZP_05455297.1| 30S ribosomal protein S21 [Brucella ceti M490/95/1]
 gi|256253642|ref|ZP_05459178.1| 30S ribosomal protein S21 [Brucella ceti B1/94]
 gi|256255897|ref|ZP_05461433.1| 30S ribosomal protein S21 [Brucella abortus bv. 9 str. C68]
 gi|256262141|ref|ZP_05464673.1| 30S ribosomal protein S21 [Brucella melitensis bv. 2 str. 63/9]
 gi|260167721|ref|ZP_05754532.1| 30S ribosomal protein S21 [Brucella sp. F5/99]
 gi|260756288|ref|ZP_05868636.1| SSU ribosomal protein S21P [Brucella abortus bv. 6 str. 870]
 gi|260759715|ref|ZP_05872063.1| SSU ribosomal protein S21P [Brucella abortus bv. 4 str. 292]
 gi|260762955|ref|ZP_05875287.1| SSU ribosomal protein S21P [Brucella abortus bv. 2 str. 86/8/59]
 gi|260882111|ref|ZP_05893725.1| SSU ribosomal protein S21P [Brucella abortus bv. 9 str. C68]
 gi|261216410|ref|ZP_05930691.1| SSU ribosomal protein S21P [Brucella abortus bv. 3 str. Tulya]
 gi|261217556|ref|ZP_05931837.1| SSU ribosomal protein S21P [Brucella ceti M13/05/1]
 gi|261220777|ref|ZP_05935058.1| SSU ribosomal protein S21P [Brucella ceti B1/94]
 gi|261312976|ref|ZP_05952173.1| SSU ribosomal protein S21P [Brucella pinnipedialis M163/99/10]
 gi|261318372|ref|ZP_05957569.1| SSU ribosomal protein S21P [Brucella pinnipedialis B2/94]
 gi|261320431|ref|ZP_05959628.1| SSU ribosomal protein S21P [Brucella ceti M644/93/1]
 gi|261753915|ref|ZP_05997624.1| SSU ribosomal protein S21P [Brucella suis bv. 3 str. 686]
 gi|265985183|ref|ZP_06097918.1| SSU ribosomal protein S21P [Brucella sp. 83/13]
 gi|265986172|ref|ZP_06098729.1| SSU ribosomal protein S21P [Brucella pinnipedialis M292/94/1]
 gi|265990259|ref|ZP_06102816.1| 30S ribosomal protein S21 [Brucella melitensis bv. 1 str. Rev.1]
 gi|265992635|ref|ZP_06105192.1| 30S ribosomal protein S21 [Brucella melitensis bv. 3 str. Ether]
 gi|265995867|ref|ZP_06108424.1| SSU ribosomal protein S21P [Brucella ceti M490/95/1]
 gi|294853921|ref|ZP_06794593.1| 30S ribosomal protein S21 [Brucella sp. NVSL 07-0026]
 gi|306838685|ref|ZP_07471521.1| ribosomal protein S21 [Brucella sp. NF 2653]
 gi|306841306|ref|ZP_07474015.1| ribosomal protein S21 [Brucella sp. BO2]
 gi|306846175|ref|ZP_07478737.1| ribosomal protein S21 [Brucella sp. BO1]
 gi|54039476|sp|P66515|RS21_BRUSU RecName: Full=30S ribosomal protein S21
 gi|54042167|sp|P66514|RS21_BRUME RecName: Full=30S ribosomal protein S21
 gi|75505146|sp|Q579I3|RS21_BRUAB RecName: Full=30S ribosomal protein S21
 gi|119367240|sp|Q2YIW0|RS21_BRUA2 RecName: Full=30S ribosomal protein S21
 gi|166224013|sp|A5VVM8|RS21_BRUO2 RecName: Full=30S ribosomal protein S21
 gi|189044892|sp|A9MCP6|RS21_BRUC2 RecName: Full=30S ribosomal protein S21
 gi|189044893|sp|A9WVX6|RS21_BRUSI RecName: Full=30S ribosomal protein S21
 gi|226694982|sp|B2SD64|RS21_BRUA1 RecName: Full=30S ribosomal protein S21
 gi|254813084|sp|C0RMB1|RS21_BRUMB RecName: Full=30S ribosomal protein S21
 gi|17984485|gb|AAL53574.1| ssu ribosomal protein s21p [Brucella melitensis bv. 1 str. 16M]
 gi|23464341|gb|AAN34137.1| ribosomal protein S21 [Brucella suis 1330]
 gi|62197402|gb|AAX75701.1| ribosomal protein S21 [Brucella abortus bv. 1 str. 9-941]
 gi|82939465|emb|CAJ12435.1| Ribosomal protein S21 [Brucella melitensis biovar Abortus 2308]
 gi|148369660|gb|ABQ62532.1| ribosomal protein S21 [Brucella ovis ATCC 25840]
 gi|161337829|gb|ABX64133.1| ribosomal protein S21 [Brucella canis ATCC 23365]
 gi|163675802|gb|ABY39912.1| ribosomal protein S21 [Brucella suis ATCC 23445]
 gi|189021047|gb|ACD73768.1| Ribosomal protein S21 [Brucella abortus S19]
 gi|225642831|gb|ACO02744.1| ribosomal protein S21 [Brucella melitensis ATCC 23457]
 gi|255998387|gb|ACU50074.1| 30S ribosomal protein S21 [Brucella microti CCM 4915]
 gi|260670033|gb|EEX56973.1| SSU ribosomal protein S21P [Brucella abortus bv. 4 str. 292]
 gi|260673376|gb|EEX60197.1| SSU ribosomal protein S21P [Brucella abortus bv. 2 str. 86/8/59]
 gi|260676396|gb|EEX63217.1| SSU ribosomal protein S21P [Brucella abortus bv. 6 str. 870]
 gi|260871639|gb|EEX78708.1| SSU ribosomal protein S21P [Brucella abortus bv. 9 str. C68]
 gi|260918017|gb|EEX84878.1| SSU ribosomal protein S21P [Brucella abortus bv. 3 str. Tulya]
 gi|260919361|gb|EEX86014.1| SSU ribosomal protein S21P [Brucella ceti B1/94]
 gi|260922645|gb|EEX89213.1| SSU ribosomal protein S21P [Brucella ceti M13/05/1]
 gi|261293121|gb|EEX96617.1| SSU ribosomal protein S21P [Brucella ceti M644/93/1]
 gi|261297595|gb|EEY01092.1| SSU ribosomal protein S21P [Brucella pinnipedialis B2/94]
 gi|261302002|gb|EEY05499.1| SSU ribosomal protein S21P [Brucella pinnipedialis M163/99/10]
 gi|261743668|gb|EEY31594.1| SSU ribosomal protein S21P [Brucella suis bv. 3 str. 686]
 gi|262550164|gb|EEZ06325.1| SSU ribosomal protein S21P [Brucella ceti M490/95/1]
 gi|262763505|gb|EEZ09537.1| 30S ribosomal protein S21 [Brucella melitensis bv. 3 str. Ether]
 gi|263000928|gb|EEZ13618.1| 30S ribosomal protein S21 [Brucella melitensis bv. 1 str. Rev.1]
 gi|263091842|gb|EEZ16164.1| 30S ribosomal protein S21 [Brucella melitensis bv. 2 str. 63/9]
 gi|264658369|gb|EEZ28630.1| SSU ribosomal protein S21P [Brucella pinnipedialis M292/94/1]
 gi|264663775|gb|EEZ34036.1| SSU ribosomal protein S21P [Brucella sp. 83/13]
 gi|294819576|gb|EFG36576.1| 30S ribosomal protein S21 [Brucella sp. NVSL 07-0026]
 gi|306273426|gb|EFM55287.1| ribosomal protein S21 [Brucella sp. BO1]
 gi|306288609|gb|EFM59945.1| ribosomal protein S21 [Brucella sp. BO2]
 gi|306406328|gb|EFM62571.1| ribosomal protein S21 [Brucella sp. NF 2653]
 gi|326554416|gb|ADZ89055.1| 30S ribosomal protein S21 [Brucella melitensis M5-90]
          Length = 75

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 51/71 (71%), Positives = 59/71 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMRGHYEKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGHYEKPSEKRAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSR 90
           AQREG    R
Sbjct: 61 RAQREGLIGGR 71


>gi|110635133|ref|YP_675341.1| 30S ribosomal protein S21 [Mesorhizobium sp. BNC1]
 gi|119367209|sp|Q11EJ9|RS211_MESSB RecName: Full=30S ribosomal protein S21 1
 gi|110286117|gb|ABG64176.1| SSU ribosomal protein S21P [Chelativorans sp. BNC1]
          Length = 76

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 52/76 (68%), Positives = 60/76 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+KMRGHYEKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKMRGHYEKPSEKRAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLRQHR 95
           AQREG    R    R
Sbjct: 61 RAQREGLVSGRPAAAR 76


>gi|254418978|ref|ZP_05032702.1| ribosomal protein S21, putative [Brevundimonas sp. BAL3]
 gi|196185155|gb|EDX80131.1| ribosomal protein S21, putative [Brevundimonas sp. BAL3]
          Length = 104

 Score = 59.5 bits (143), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 55/73 (75%)

Query: 15 REISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           E + V + VRDNNV+QAL+ LKKKMQ EG  RE+K   HYEKPS+KR R K+EA+RR+R
Sbjct: 15 GEFNLVQIFVRDNNVDQALKALKKKMQREGSFREMKRHVHYEKPSEKRARQKAEAVRRAR 74

Query: 75 KLMRKIAQREGAP 87
          KL RK AQREG  
Sbjct: 75 KLARKRAQREGLL 87


>gi|254436839|ref|ZP_05050333.1| ribosomal protein S21 [Octadecabacter antarcticus 307]
 gi|198252285|gb|EDY76599.1| ribosomal protein S21 [Octadecabacter antarcticus 307]
          Length = 66

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 42/66 (63%), Positives = 54/66 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++  +EKPS+K+ R K+EAIRR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQAFEKPSEKKARNKAEAIRRARKLARK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 KLEREG 66


>gi|241258641|ref|YP_002978525.1| ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
 gi|240863111|gb|ACS60774.1| ribosomal protein S21 [Rhizobium leguminosarum bv. trifolii
          WSM1325]
          Length = 79

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 43/73 (58%), Positives = 53/73 (72%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNVEQALR LKKK+Q EGV RE ++R  +EKPS+KR R K+E IRR RKL RK
Sbjct: 1  MQVLVRDNNVEQALRFLKKKLQREGVFREARLRERFEKPSEKRAREKAEGIRRVRKLARK 60

Query: 80 IAQREGAPVSRLR 92
            +RE    +  +
Sbjct: 61 KLERESGISAPKK 73


>gi|226951414|ref|ZP_03821878.1| 30S ribosomal protein S21 [Acinetobacter sp. ATCC 27244]
 gi|294650932|ref|ZP_06728276.1| 30S ribosomal protein S21 [Acinetobacter haemolyticus ATCC 19194]
 gi|226837836|gb|EEH70219.1| 30S ribosomal protein S21 [Acinetobacter sp. ATCC 27244]
 gi|292823181|gb|EFF82040.1| 30S ribosomal protein S21 [Acinetobacter haemolyticus ATCC 19194]
          Length = 97

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 10 IFSEGREISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSE 68
          +    R      V +++   V+ A+R  K+  +  GVL +++ R  YEKP+Q+R R K+ 
Sbjct: 18 LIHNLRGFYMPQVKLKEGEPVDVAIRRFKRSCEKAGVLADVRKREFYEKPTQERKRKKAA 77

Query: 69 AIRRSRKLMRKIAQR 83
          A++R +K + + + R
Sbjct: 78 AVKRYQKKLSRESVR 92


>gi|188036222|pdb|3BBN|U Chain U, Homology Model For The Spinach Chloroplast 30s Subunit
           Fitted To 9.4a Cryo-Em Map Of The 70s Chlororibosome.
 gi|17154781|gb|AAL35983.1|AF104396_1 ribosome-like protein [Cucumis sativus]
          Length = 190

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 15  REISAVYVLVRDNNVE-QALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
           R    V V+V DN  E + L   ++++   GV++E K R  +E     R R   EA +
Sbjct: 92  RSAYNVQVVVDDNEPEERLLNRFRREVMRAGVIQECKRRRFFENTQDVRKRKTREAAK 149


>gi|254485639|ref|ZP_05098844.1| ribosomal protein S21 [Roseobacter sp. GAI101]
 gi|214042508|gb|EEB83146.1| ribosomal protein S21 [Roseobacter sp. GAI101]
          Length = 66

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 41/65 (63%), Positives = 53/65 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++  +EKPS+K+ R K+EAIRR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKEQFEKPSEKKAREKAEAIRRARKLARK 60

Query: 80 IAQRE 84
            +RE
Sbjct: 61 KLERE 65


>gi|293977891|ref|YP_003543321.1| 30S ribosomal protein S21/signal peptidase I [Candidatus Sulcia
           muelleri DMIN]
 gi|292667822|gb|ADE35457.1| ribosomal protein S21/signal peptidase I, bacterial type
           [Candidatus Sulcia muelleri DMIN]
          Length = 542

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 11  FSEGREISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
           F   ++I  + + V++   +++ L+  K+K     ++R+L+ R  Y KPS+++ ++ ++A
Sbjct: 472 FFLKKKIMKLIIYVKEGESIDRVLKKWKQKFDKARIIRKLRERQQYIKPSERKRKILTKA 531

Query: 70  IRR 72
             R
Sbjct: 532 KYR 534


>gi|58416484|emb|CAI27597.1| Probable 30S ribosomal protein S21 [Ehrlichia ruminantium str.
          Gardel]
          Length = 112

 Score = 59.1 bits (142), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 50/78 (64%), Gaps = 3/78 (3%)

Query: 1  MLVFNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
          ++V +A   I+  G   S V V+V   ++EQ +R LKKK+Q EG  R++K+  H+EKPS+
Sbjct: 2  LIVISAALFIYIGG--FSLVEVIVYHGDIEQGIRTLKKKLQREGKPRQMKI-THHEKPSE 58

Query: 61 KRVRLKSEAIRRSRKLMR 78
          KR R K +  RR +KL +
Sbjct: 59 KRARKKDDCERRRKKLHK 76


>gi|327288847|ref|XP_003229136.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like [Anolis
          carolinensis]
          Length = 87

 Score = 58.7 bits (141), Expect = 2e-07,   Method: Composition-based stats.
 Identities = 22/56 (39%), Positives = 34/56 (60%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  V+V + NVE A RVL + +  +G++ + K R +YEKP ++R R   EA R
Sbjct: 6  KFVARTVMVPNGNVEAAYRVLNRILTMDGIIDDAKRRRYYEKPCRRRQRETYEACR 61


>gi|318087606|ref|NP_001187779.1| mitochondrial 28S ribosomal protein s21 [Ictalurus punctatus]
 gi|308323951|gb|ADO29111.1| mitochondrial 28S ribosomal protein s21 [Ictalurus punctatus]
          Length = 87

 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             A  V+V+D NV+ A + L + +  +G++  +K R +YEKP ++R R   E  +R  
Sbjct: 6  RFVARTVMVQDGNVDAAYKALNRVLSLDGIIETVKRRRYYEKPCRQRQRENYENCKRIY 64


>gi|157827386|ref|YP_001496450.1| 30S ribosomal protein S21 [Rickettsia bellii OSU 85-389]
 gi|157802690|gb|ABV79413.1| 30S ribosomal protein S21 [Rickettsia bellii OSU 85-389]
          Length = 98

 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 32/62 (51%)

Query: 7  FRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLK 66
          ++ IF   R I  + V V   N +   +  KKK+Q E   R++K + +YE  S KRVR  
Sbjct: 21 YQYIFILRRVILVILVNVHAGNCDNTFKNFKKKLQRELYFRKMKEQRYYEPKSVKRVRKA 80

Query: 67 SE 68
           E
Sbjct: 81 QE 82


>gi|254453810|ref|ZP_05067247.1| ribosomal protein S21 [Octadecabacter antarcticus 238]
 gi|198268216|gb|EDY92486.1| ribosomal protein S21 [Octadecabacter antarcticus 238]
          Length = 68

 Score = 58.7 bits (141), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 40/66 (60%), Positives = 53/66 (80%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VR+NNV+QALR LKKK+Q EGV RE+K++  +EKPS+K+ R ++EAIRR RKL RK
Sbjct: 1  MQVSVRENNVDQALRALKKKLQREGVFREMKLKQAFEKPSEKKARQQAEAIRRQRKLARK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 KLEREG 66


>gi|225451423|ref|XP_002268728.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 188

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 15  REISAVYVLVRDNNVE-QALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
           +    V V+V DN  E + L   ++++   GV++E K R  +E    ++ R   EA +
Sbjct: 89  KSAYNVQVIVEDNEPEEKLLNRFRREVMRAGVIQECKRRRFFENKQDEKKRKTREAAK 146


>gi|224060243|ref|XP_002300102.1| predicted protein [Populus trichocarpa]
 gi|118487561|gb|ABK95607.1| unknown [Populus trichocarpa]
 gi|222847360|gb|EEE84907.1| predicted protein [Populus trichocarpa]
          Length = 176

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 15  REISAVYVLVRDNNVE-QALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
           +    V V+V DN  E + L   ++++   GV++E K R  +E   +++ R   EA +
Sbjct: 78  KSAYNVQVVVEDNEPEERLLNRFRREVMRAGVIQECKRRRFHENKQEEKKRKVREAHK 135


>gi|114771321|ref|ZP_01448741.1| 30S ribosomal protein S21 [alpha proteobacterium HTCC2255]
 gi|114548246|gb|EAU51133.1| 30S ribosomal protein S21 [alpha proteobacterium HTCC2255]
 gi|297183978|gb|ADI20098.1| hypothetical protein [uncultured alpha proteobacterium
          EB080_L06A09]
 gi|297184201|gb|ADI20319.1| hypothetical protein [uncultured alpha proteobacterium
          EB080_L27A02]
          Length = 68

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 42/66 (63%), Positives = 54/66 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE+K++ H+EKPS ++ R K+E+IRR+RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQREGVFREMKLKQHFEKPSIRKAREKTESIRRARKLARK 60

Query: 80 IAQREG 85
            QREG
Sbjct: 61 KLQREG 66


>gi|302794674|ref|XP_002979101.1| hypothetical protein SELMODRAFT_444102 [Selaginella moellendorffii]
 gi|300153419|gb|EFJ20058.1| hypothetical protein SELMODRAFT_444102 [Selaginella moellendorffii]
          Length = 180

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 34/59 (57%), Gaps = 2/59 (3%)

Query: 22  VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           ++V +N   +  +R  ++++   G++ E + R ++E P +KR R +    RR RK+ R+
Sbjct: 70  IIVNENEGPDSIVRRFRREVMSAGIIAECRRRRYHETPQEKRKRKQQALARR-RKMSRR 127


>gi|168005884|ref|XP_001755640.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162693347|gb|EDQ79700.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 179

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 17/87 (19%), Positives = 37/87 (42%), Gaps = 1/87 (1%)

Query: 7   FRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLK 66
              ++ +G   + ++V   D + +  +R  ++ +   GV+ E + R  +E P     R +
Sbjct: 75  VNVMYFKGSYNAQIFVG-EDESADSVVRRFRRAVSAAGVIPECRRRRFHETPQDIVKRKQ 133

Query: 67  SEAIRRSRKLMRKIAQREGAPVSRLRQ 93
            EA RR++   R    R        ++
Sbjct: 134 KEAHRRNKSNRRFSGPRPEGGYGEKKE 160


>gi|126313678|ref|XP_001365598.1| PREDICTED: hypothetical protein [Monodelphis domestica]
          Length = 87

 Score = 58.4 bits (140), Expect = 3e-07,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 36/66 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  A  V+V++ NVE A R L + +  +G++ ++K R +YEKP ++R R   E  RR   
Sbjct: 6  KFIARTVMVQEGNVEGAYRTLNRILTMDGLIDDIKRRRYYEKPCRRRQRESYETCRRIYN 65

Query: 76 LMRKIA 81
          +     
Sbjct: 66 MEMARK 71


>gi|304415463|ref|ZP_07396111.1| 30S ribosomal subunit protein S21 [Candidatus Regiella
          insecticola LSR1]
 gi|304282692|gb|EFL91207.1| 30S ribosomal subunit protein S21 [Candidatus Regiella
          insecticola LSR1]
          Length = 79

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+    + ALR  K+  +  G+L E++    YEKP+ +R R K+ A++R  K  
Sbjct: 1  MPVIKVREGEPFDVALRRFKRSCEKAGILAEVRRSEFYEKPTTERKRAKASAVKRHAKNW 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|308322505|gb|ADO28390.1| mitochondrial 28S ribosomal protein s21 [Ictalurus furcatus]
          Length = 87

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             A  V+V+D NV+ A + L + +  +G++  +K R +YEKP ++R R   E  +R  
Sbjct: 6  RFVARTVMVQDGNVDAAYKALNRVLSLDGIIETVKRRRYYEKPCRRRQRENYENCKRIY 64


>gi|222081640|ref|YP_002541005.1| ribosomal protein S21 [Agrobacterium radiobacter K84]
 gi|221726319|gb|ACM29408.1| ribosomal protein S21 [Agrobacterium radiobacter K84]
          Length = 81

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 42/73 (57%), Positives = 54/73 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKK+Q EGV RE+++R  YEKPS+KR R K+E IRR+RKL +K
Sbjct: 1  MQVLVRDNNVDQALRFLKKKLQQEGVFREMRLRESYEKPSEKRAREKAEGIRRTRKLAQK 60

Query: 80 IAQREGAPVSRLR 92
             RE    +  +
Sbjct: 61 KLNRELGISTAKK 73


>gi|291398051|ref|XP_002715645.1| PREDICTED: mitochondrial ribosomal protein S21 [Oryctolagus
          cuniculus]
          Length = 87

 Score = 58.0 bits (139), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 36/66 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  A  V+V+D NVE A R L + +  +G++ ++K R +YEKP ++R R   E  RR   
Sbjct: 6  KFIARTVMVQDGNVEGAYRTLNRILTMDGLIEDIKRRRYYEKPCRRRQRESYETCRRIYN 65

Query: 76 LMRKIA 81
          +     
Sbjct: 66 MEMTRK 71


>gi|225703698|gb|ACO07695.1| Mitochondrial 28S ribosomal protein S21 [Oncorhynchus mykiss]
          Length = 87

 Score = 58.0 bits (139), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 33/59 (55%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             A  V+V++ NV+ A + L + +  +G++  +K + +YEKP ++R R   E  +R  
Sbjct: 6  RFVARTVMVQEGNVDAAYKALNRVLSVDGIIETVKRKRYYEKPCRRRQRENYENCKRIY 64


>gi|254454028|ref|ZP_05067465.1| ribosomal protein S21 [Octadecabacter antarcticus 238]
 gi|198268434|gb|EDY92704.1| ribosomal protein S21 [Octadecabacter antarcticus 238]
          Length = 66

 Score = 57.6 bits (138), Expect = 5e-07,   Method: Composition-based stats.
 Identities = 40/65 (61%), Positives = 53/65 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VR+NNV+QALR LKKK+Q EGV RE+K++  +EKPS+K+ R K+EAIRR+RKL RK
Sbjct: 1  MQVSVRENNVDQALRALKKKLQREGVFREMKLKQAFEKPSEKKARNKAEAIRRARKLARK 60

Query: 80 IAQRE 84
            +RE
Sbjct: 61 KLERE 65


>gi|302809314|ref|XP_002986350.1| hypothetical protein SELMODRAFT_446607 [Selaginella moellendorffii]
 gi|300145886|gb|EFJ12559.1| hypothetical protein SELMODRAFT_446607 [Selaginella moellendorffii]
          Length = 180

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 33/59 (55%), Gaps = 2/59 (3%)

Query: 22  VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           ++V  N   +  +R  ++++   G++ E + R ++E P +KR R +    RR RK+ R+
Sbjct: 70  IIVNANEGPDSIVRRFRREVMSAGIIAECRRRRYHETPQEKRKRKQQALARR-RKMSRR 127


>gi|57160963|emb|CAH57869.1| putative 30S ribosomal protein S21 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|58417439|emb|CAI26643.1| Probable 30S ribosomal protein S21 [Ehrlichia ruminantium str.
          Welgevonden]
          Length = 112

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 33/78 (42%), Positives = 49/78 (62%), Gaps = 3/78 (3%)

Query: 1  MLVFNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
          ++V  A   I+  G   S V V+V   ++EQ +R LKKK+Q EG  R++K+  H+EKPS+
Sbjct: 2  LIVIIAALFIYIGG--FSLVEVIVYHGDIEQGIRTLKKKLQREGKPRQMKI-THHEKPSE 58

Query: 61 KRVRLKSEAIRRSRKLMR 78
          KR R K +  RR +KL +
Sbjct: 59 KRARKKDDCERRRKKLHK 76


>gi|326933468|ref|XP_003212825.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like
          [Meleagris gallopavo]
          Length = 87

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 31/59 (52%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
                V+V++ NV+ A     + +  +G+   +K R +YEKP +KR RL  EA RR  
Sbjct: 6  RFIGRTVMVQNGNVDAAYGRCHRILSQDGITESVKQRRYYEKPCRKRQRLAYEACRRVY 64


>gi|168011502|ref|XP_001758442.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162690477|gb|EDQ76844.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 179

 Score = 57.6 bits (138), Expect = 6e-07,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 32/79 (40%), Gaps = 2/79 (2%)

Query: 15  REISAVYVLVRDNNV-EQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
           +      V V ++   +  +R  +K +   GV+ E + R ++E P     R + ++ RR 
Sbjct: 77  KGTYNTQVFVGEDEPADSVVRRFRKAVMATGVIPECRRRRYHETPQDIVKRKQKDSHRRK 136

Query: 74  RKLMRKIAQR-EGAPVSRL 91
               R    R EG    R 
Sbjct: 137 ASSRRFNGPRPEGGFGDRK 155


>gi|304393271|ref|ZP_07375199.1| ribosomal protein S21 [Ahrensia sp. R2A130]
 gi|303294278|gb|EFL88650.1| ribosomal protein S21 [Ahrensia sp. R2A130]
          Length = 74

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 45/74 (60%), Positives = 57/74 (77%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V+VRDNNV+QALR LKKK+Q EGV RE+K+R  +EKPS+KR R K+EA+RR+RKL RK
Sbjct: 1  MQVVVRDNNVDQALRALKKKLQREGVFREMKLRNFHEKPSEKRAREKAEAVRRARKLARK 60

Query: 80 IAQREGAPVSRLRQ 93
           AQREG       +
Sbjct: 61 RAQREGLIPGAKPR 74


>gi|328542501|ref|YP_004302610.1| 30S ribosomal protein S21 [polymorphum gilvum SL003B-26A1]
 gi|326412248|gb|ADZ69311.1| 30S ribosomal protein S21 [Polymorphum gilvum SL003B-26A1]
          Length = 75

 Score = 57.2 bits (137), Expect = 7e-07,   Method: Composition-based stats.
 Identities = 48/74 (64%), Positives = 60/74 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGHYEKPS+K+ R K+EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHYEKPSEKKAREKAEAIRRARKLARK 60

Query: 80 IAQREGAPVSRLRQ 93
           AQREG    +  +
Sbjct: 61 RAQREGLVPGKATR 74


>gi|254437706|ref|ZP_05051200.1| ribosomal protein S21 [Octadecabacter antarcticus 307]
 gi|198253152|gb|EDY77466.1| ribosomal protein S21 [Octadecabacter antarcticus 307]
          Length = 66

 Score = 57.2 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 38/66 (57%), Positives = 51/66 (77%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V VRDNNV+QALR LKKK+Q EGV RE++++ H+EKPS ++ R + EA+ R RKL RK
Sbjct: 1  MQVSVRDNNVDQALRALKKKLQSEGVFREMRLKEHFEKPSVRKAREQKEAVSRQRKLARK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 KTEREG 66


>gi|225023816|ref|ZP_03713008.1| hypothetical protein EIKCOROL_00681 [Eikenella corrodens ATCC
           23834]
 gi|224943415|gb|EEG24624.1| hypothetical protein EIKCOROL_00681 [Eikenella corrodens ATCC
           23834]
          Length = 117

 Score = 57.2 bits (137), Expect = 8e-07,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 40/65 (61%), Gaps = 1/65 (1%)

Query: 15  REISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
           ++     + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R 
Sbjct: 44  KDDKMPSIRVKENEPFEVAMRRFKRSIEKTGLLTELRAREAYEKPTTERKRKKAAAVKRL 103

Query: 74  RKLMR 78
           +K +R
Sbjct: 104 QKRLR 108


>gi|147845835|emb|CAN82190.1| hypothetical protein VITISV_031115 [Vitis vinifera]
          Length = 188

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 16/58 (27%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 15  REISAVYVLVRDNNVE-QALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
           +    V V+V DN  E + L   ++++   GV++E K R  +E    ++ R   EA +
Sbjct: 89  KSAYNVQVIVEDNEPEEKLLNRFRREVMRAGVIQECKRRRFFENKQDEKKRKTREAAK 146


>gi|118102211|ref|XP_424290.2| PREDICTED: similar to mitochondrial ribosomal protein S21 [Gallus
          gallus]
          Length = 87

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 32/59 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
                V+V++ NV+ A   L +    +G++  +K R +Y+KP +KR RL  EA RR  
Sbjct: 6  RFIGRTVMVQNGNVDAAYGALSRIGSQDGIIESVKQRRYYKKPCRKRQRLAYEACRRVY 64


>gi|168052213|ref|XP_001778545.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162669999|gb|EDQ56575.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 177

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 18/79 (22%), Positives = 32/79 (40%), Gaps = 2/79 (2%)

Query: 15  REISAVYVLVRDNNV-EQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
           +      V V ++   +  +R  +K +   GV+ E + R ++E P     R + E+ RR 
Sbjct: 76  KGTYNTQVFVGEDEPADSVVRRFRKAVMAAGVIPECRRRRYHETPQDIVKRKQKESHRRK 135

Query: 74  RKLMRKIAQR-EGAPVSRL 91
               R    R EG    + 
Sbjct: 136 ASGRRFNGPRPEGGYGEKK 154


>gi|311261396|ref|XP_003128723.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like isoform
          1 [Sus scrofa]
 gi|311261398|ref|XP_003128724.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like isoform
          2 [Sus scrofa]
          Length = 87

 Score = 56.8 bits (136), Expect = 9e-07,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 35/59 (59%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          +  A  V+V++ N+E A + L + +  +G++ ++K R +YEKP ++R R   E  RR  
Sbjct: 6  KFIARSVMVQEGNMEGAYKTLNRILTMDGLIEDIKQRRYYEKPCRQRQRESYETCRRIY 64


>gi|328545838|ref|YP_004305947.1| ribosomal protein S21 [polymorphum gilvum SL003B-26A1]
 gi|326415578|gb|ADZ72641.1| Ribosomal protein S21 [Polymorphum gilvum SL003B-26A1]
          Length = 88

 Score = 56.8 bits (136), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 48/74 (64%), Positives = 57/74 (77%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNN+EQALRVLKKK+Q EGV RE+K R  YEKPS+KR R K EA+RR+RK  RK
Sbjct: 7  LQVLVRDNNIEQALRVLKKKLQREGVFREMKARRAYEKPSEKRAREKGEAVRRARKAARK 66

Query: 80 IAQREGAPVSRLRQ 93
          +AQREG      R+
Sbjct: 67 LAQREGLIPGPKRK 80


>gi|186910247|ref|NP_001119566.1| 28S ribosomal protein S21, mitochondrial [Rattus norvegicus]
 gi|149030639|gb|EDL85676.1| mitochondrial ribosomal protein S21 (predicted), isoform CRA_a
          [Rattus norvegicus]
 gi|149030640|gb|EDL85677.1| mitochondrial ribosomal protein S21 (predicted), isoform CRA_a
          [Rattus norvegicus]
 gi|149030641|gb|EDL85678.1| mitochondrial ribosomal protein S21 (predicted), isoform CRA_a
          [Rattus norvegicus]
 gi|149030642|gb|EDL85679.1| mitochondrial ribosomal protein S21 (predicted), isoform CRA_a
          [Rattus norvegicus]
 gi|187469497|gb|AAI66891.1| Mrps21 protein [Rattus norvegicus]
          Length = 87

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 35/66 (53%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  A  V+V++ NVE A R L + +  +G++  +K R +YEKP ++R R   E  RR   
Sbjct: 6  KFIARTVMVQEGNVEGAYRTLNRILTTDGLIDVIKRRRYYEKPCRRRQRESYETCRRIYN 65

Query: 76 LMRKIA 81
          +     
Sbjct: 66 MEMARK 71


>gi|254500308|ref|ZP_05112459.1| ribosomal protein S21 [Labrenzia alexandrii DFL-11]
 gi|222436379|gb|EEE43058.1| ribosomal protein S21 [Labrenzia alexandrii DFL-11]
          Length = 75

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 47/74 (63%), Positives = 60/74 (81%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKKMQ EG+ RE+K+RGH+EKPS+K+ R K+EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKMQREGIFREMKLRGHFEKPSEKKAREKAEAIRRARKLARK 60

Query: 80 IAQREGAPVSRLRQ 93
           AQREG    +  +
Sbjct: 61 RAQREGLLPGKSAR 74


>gi|73981293|ref|XP_849970.1| PREDICTED: similar to Mitochondrial 28S ribosomal protein S21
          (S21mt) (MRP-S21) isoform 1 [Canis familiaris]
 gi|73981295|ref|XP_860341.1| PREDICTED: similar to Mitochondrial 28S ribosomal protein S21
          (S21mt) (MRP-S21) isoform 2 [Canis familiaris]
          Length = 87

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 36/66 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  A  V+V++ NVE A R L + +  +G++ ++K R +YEKP ++R R   E  RR   
Sbjct: 6  KFVARTVMVQEGNVEGAYRTLNRILTMDGLIEDIKRRRYYEKPCRRRQRESYETCRRIYN 65

Query: 76 LMRKIA 81
          +     
Sbjct: 66 MEMARK 71


>gi|311307321|ref|NP_001153310.2| 28S ribosomal protein S21, mitochondrial [Danio rerio]
          Length = 87

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 33/59 (55%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             +  V+V++ NV+ A   L + +  +G++  +K R ++EKP +K++R   E  +R  
Sbjct: 6  RFVSRTVMVQNGNVDLAYGFLNRVLSTDGIIESVKRRRYFEKPCRKQIRKNYENCKRIY 64


>gi|146186763|gb|AAI39897.1| Zgc:163126 protein [Danio rerio]
          Length = 87

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 33/59 (55%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             A  V+V++ NV+ A   L + +  +G++  +K R ++EKP +K++R   E  +R  
Sbjct: 6  RFVARTVMVQNGNVDLAYGFLNRVLSTDGIIESVKRRRYFEKPCRKQIRKNYENCKRIY 64


>gi|164519002|ref|NP_001106778.1| 28S ribosomal protein S21, mitochondrial [Bos taurus]
 gi|149751433|ref|XP_001489423.1| PREDICTED: similar to Mitochondrial 28S ribosomal protein S21
          (S21mt) (MRP-S21) [Equus caballus]
 gi|108935899|sp|P82920|RT21_BOVIN RecName: Full=28S ribosomal protein S21, mitochondrial;
          Short=MRP-S21; Short=S21mt
 gi|87578356|gb|AAI13331.1| Mitochondrial ribosomal protein S21 [Bos taurus]
 gi|296489575|gb|DAA31688.1| 28S ribosomal protein S21, mitochondrial [Bos taurus]
          Length = 87

 Score = 56.4 bits (135), Expect = 1e-06,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 36/66 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  A  V+V++ NVE A R L + +  +G++ ++K R +YEKP ++R R   E  RR   
Sbjct: 6  KFIARTVMVQEGNVEGAYRTLNRILTMDGLIEDIKRRRYYEKPCRRRQRESYETCRRIYN 65

Query: 76 LMRKIA 81
          +     
Sbjct: 66 MEMARK 71


>gi|224121886|ref|XP_002318697.1| predicted protein [Populus trichocarpa]
 gi|222859370|gb|EEE96917.1| predicted protein [Populus trichocarpa]
          Length = 191

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 20  VYVLVRDNNVEQA-LRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
           V + V++N  E++ L   KK +    VL+E + R  +E    K+ R   +A RR+
Sbjct: 106 VQINVKENEPEESILFRFKKAVIRARVLQECRRRRFFESTQDKKKRKTRDAARRN 160


>gi|83652664|gb|ABC36727.1| ribosomal protein S21-related protein [Burkholderia thailandensis
           E264]
          Length = 142

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 3/82 (3%)

Query: 8   RGIFSEGREIS--AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVR 64
           R +F   ++I      +L+++N   E A+R  ++ ++  G++ EL+ R  YEKP+  R R
Sbjct: 60  RYVFDRIKQIRNDMTTILLKENEPFEVAIRRFRRAIEKNGLIAELRERQAYEKPTAVRKR 119

Query: 65  LKSEAIRRSRKLMRKIAQREGA 86
            K+ A++R  K +R     +  
Sbjct: 120 KKAAAVKRLHKRLRSQMLPKKL 141


>gi|301767967|ref|XP_002919357.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like
          [Ailuropoda melanoleuca]
 gi|281352897|gb|EFB28481.1| hypothetical protein PANDA_008022 [Ailuropoda melanoleuca]
          Length = 87

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 36/66 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  A  V+V++ N+E A R L + +  +G++ ++K R +YEKP ++R R   E  RR   
Sbjct: 6  KFIARTVMVQEGNMEGAYRTLNRILTMDGLIEDIKRRRYYEKPCRRRQRESYETCRRIYN 65

Query: 76 LMRKIA 81
          +     
Sbjct: 66 MEMARK 71


>gi|291406892|ref|XP_002719766.1| PREDICTED: mitochondrial ribosomal protein S21 [Oryctolagus
          cuniculus]
          Length = 87

 Score = 56.1 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          +  A  V+V+D NVE A R L + +  +G+  ++K R +YEKP ++R R      RR  
Sbjct: 6  KFIARTVMVQDGNVEGAYRTLNRILTMDGLTEDIKRRRYYEKPCRRRQRESYGTCRRIY 64


>gi|109140741|ref|XP_001083064.1| PREDICTED: 28S ribosomal protein S21, mitochondrial [Macaca
          mulatta]
          Length = 87

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 35/59 (59%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          +  A  V+V++ NVE A R+L + +  +G++ ++K   +YEKP ++R R   E  +R  
Sbjct: 6  KFIARTVMVQEGNVEGAYRILNRILTMDGLIEDIKRLRYYEKPCRRRQRESYERCQRIY 64


>gi|302383351|ref|YP_003819174.1| ribosomal protein S21 [Brevundimonas subvibrioides ATCC 15264]
 gi|302193979|gb|ADL01551.1| ribosomal protein S21 [Brevundimonas subvibrioides ATCC 15264]
          Length = 96

 Score = 55.7 bits (133), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 46/82 (56%), Positives = 57/82 (69%)

Query: 6  AFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
           +R   +   E + V + VRDNNV+QAL+ LKKKMQ EG  RE+K   HYEKPS+KR R 
Sbjct: 5  LYRTRRAAKGEFNLVQIFVRDNNVDQALKALKKKMQREGSFREMKRHVHYEKPSEKRARQ 64

Query: 66 KSEAIRRSRKLMRKIAQREGAP 87
          K+EA+RR+RKL RK  QREG  
Sbjct: 65 KAEAVRRARKLARKRMQREGLL 86


>gi|225703822|gb|ACO07757.1| Mitochondrial 28S ribosomal protein S21 [Oncorhynchus mykiss]
 gi|225705616|gb|ACO08654.1| Mitochondrial 28S ribosomal protein S21 [Oncorhynchus mykiss]
 gi|225705734|gb|ACO08713.1| Mitochondrial 28S ribosomal protein S21 [Oncorhynchus mykiss]
          Length = 87

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 33/59 (55%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             A  V+V++ NV+ A + L + +  +G++  +K + +YEKP ++R R   E  +R  
Sbjct: 6  RFVARTVMVQEGNVDAAYKALNRVLSVDGIIETVKRKRYYEKPCRRRQRENYENCKRIY 64


>gi|114571106|ref|YP_757786.1| 30S ribosomal protein S21P [Maricaulis maris MCS10]
 gi|119367270|sp|Q0ALJ5|RS21_MARMM RecName: Full=30S ribosomal protein S21
 gi|114341568|gb|ABI66848.1| SSU ribosomal protein S21P [Maricaulis maris MCS10]
          Length = 92

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 50/77 (64%), Positives = 58/77 (75%)

Query: 14 GREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
            E + V ++VRDNNVEQALR LKKKMQ EG  RE+K R HYEKPS+K+ R K+EAIRR+
Sbjct: 10 NGERAIVQIVVRDNNVEQALRALKKKMQREGTFREMKRRNHYEKPSEKKARQKAEAIRRA 69

Query: 74 RKLMRKIAQREGAPVSR 90
          RKL RK AQREG    R
Sbjct: 70 RKLARKRAQREGLIAKR 86


>gi|13994257|ref|NP_114107.1| 28S ribosomal protein S21, mitochondrial [Homo sapiens]
 gi|16950593|ref|NP_061870.1| 28S ribosomal protein S21, mitochondrial [Homo sapiens]
 gi|114559261|ref|XP_001168512.1| PREDICTED: mitochondrial ribosomal protein S21 isoform 1 [Pan
          troglodytes]
 gi|114559263|ref|XP_001168530.1| PREDICTED: mitochondrial ribosomal protein S21 isoform 2 [Pan
          troglodytes]
 gi|114559265|ref|XP_001168560.1| PREDICTED: mitochondrial ribosomal protein S21 isoform 3 [Pan
          troglodytes]
 gi|114559267|ref|XP_001168584.1| PREDICTED: 28S ribosomal protein S21, mitochondrial isoform 4
          [Pan troglodytes]
 gi|332810175|ref|XP_003308407.1| PREDICTED: 28S ribosomal protein S21, mitochondrial [Pan
          troglodytes]
 gi|13959554|sp|P82921|RT21_HUMAN RecName: Full=28S ribosomal protein S21, mitochondrial;
          Short=MRP-S21; Short=S21mt
 gi|13620911|dbj|BAB41008.1| mitochondrial ribosomal protein S21 [Homo sapiens]
 gi|16306868|gb|AAH06554.1| MRPS21 protein [Homo sapiens]
 gi|33991236|gb|AAH04566.2| Mitochondrial ribosomal protein S21 [Homo sapiens]
 gi|56204878|emb|CAI22820.1| mitochondrial ribosomal protein S21 [Homo sapiens]
 gi|119573943|gb|EAW53558.1| mitochondrial ribosomal protein S21, isoform CRA_b [Homo sapiens]
 gi|119573944|gb|EAW53559.1| mitochondrial ribosomal protein S21, isoform CRA_b [Homo sapiens]
 gi|158259957|dbj|BAF82156.1| unnamed protein product [Homo sapiens]
          Length = 87

 Score = 55.3 bits (132), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 36/66 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  A  V+V++ NVE A R L + +  +G++ ++K R +YEKP ++R R   E  RR   
Sbjct: 6  KFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYN 65

Query: 76 LMRKIA 81
          +     
Sbjct: 66 MEMARK 71


>gi|209731874|gb|ACI66806.1| Mitochondrial 28S ribosomal protein S21 [Salmo salar]
          Length = 87

 Score = 54.9 bits (131), Expect = 3e-06,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 33/59 (55%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             A  V+V++ N++ A + L + +  +G++  +K + +YEKP ++R R   E  +R  
Sbjct: 6  RFVARTVMVQEGNIDAAYKALNRVLSVDGIIETVKRKRYYEKPCRRRQRENYENCKRIY 64


>gi|119573243|gb|EAW52858.1| hCG1795719 [Homo sapiens]
          Length = 196

 Score = 54.9 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 31/55 (56%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
          + +A   +V++ NVE A R L + +  +G+L ++K   + EKP ++R R   +  
Sbjct: 6  KFTARTEMVQEGNVEGAYRTLNRILTVDGLLEDIKCPWYNEKPCRQRQRKSYKRC 60


>gi|260424682|ref|ZP_05732936.2| ribosomal protein S21 [Dialister invisus DSM 15470]
 gi|260402820|gb|EEW96367.1| ribosomal protein S21 [Dialister invisus DSM 15470]
          Length = 81

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 24/75 (32%), Positives = 39/75 (52%)

Query: 1  MLVFNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
          ++  N+   ++ EG    +   + +  +++ ALR  K+  Q  GVL E++ R HYEKPS 
Sbjct: 7  LIACNSTPSVYLEGGIWMSEIKVQKGESLDSALRRFKRSCQKAGVLSEVRKREHYEKPSV 66

Query: 61 KRVRLKSEAIRRSRK 75
          KR      A +R  K
Sbjct: 67 KRKLKSEAARKRKFK 81


>gi|77919849|ref|YP_357664.1| 30S ribosomal protein S21 [Pelobacter carbinolicus DSM 2380]
 gi|119367284|sp|Q3A2B3|RS21_PELCD RecName: Full=30S ribosomal protein S21
 gi|77545932|gb|ABA89494.1| SSU ribosomal protein S21P [Pelobacter carbinolicus DSM 2380]
          Length = 64

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 35/63 (55%), Positives = 46/63 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + + V DNNVE+A+RVLK+K+Q EG+ RE+K R  YEKPS KR R + EA RR RK MR 
Sbjct: 1  MEIQVVDNNVEKAIRVLKRKLQQEGLFREMKQRKFYEKPSVKRKRKEKEAQRRLRKKMRM 60

Query: 80 IAQ 82
          + +
Sbjct: 61 MKK 63


>gi|332220141|ref|XP_003259216.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like isoform
          1 [Nomascus leucogenys]
 gi|332220143|ref|XP_003259217.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like isoform
          2 [Nomascus leucogenys]
          Length = 87

 Score = 54.5 bits (130), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 36/66 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  A  V+V++ NVE A R L + +  +G++ ++K R +YEKP ++R R   E  RR   
Sbjct: 6  KFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKRRRYYEKPCRRRQRESYERCRRIYN 65

Query: 76 LMRKIA 81
          +     
Sbjct: 66 MEMARK 71


>gi|209737208|gb|ACI69473.1| Mitochondrial 28S ribosomal protein S21 [Salmo salar]
          Length = 87

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 32/59 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             A  V+V++ N++ A + L   +  +G++  +K + +YEKP ++R R   E  +R  
Sbjct: 6  RFVARTVMVQEGNIDAAYKALNGVLSVDGIIETVKRKRYYEKPCRRRQRENYENCKRIY 64


>gi|109016050|ref|XP_001100642.1| PREDICTED: 28S ribosomal protein S21, mitochondrial isoform 1
          [Macaca mulatta]
          Length = 87

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 37/66 (56%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  A  V+V++ NVE A R+L + +  +G++ ++K R +YEKP ++R R   E  +R   
Sbjct: 6  KFIARTVMVQEGNVEGAYRILNRILTMDGLIEDIKRRRYYEKPCRRRQRESYERCQRIYN 65

Query: 76 LMRKIA 81
          +     
Sbjct: 66 MEMARK 71


>gi|296222524|ref|XP_002757214.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like
          [Callithrix jacchus]
          Length = 87

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 29/59 (49%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          +  A  V++++ NVE A R L + +   G + ++K +  YEK    + R   E  RR  
Sbjct: 6  KFIARTVMIQEGNVESAYRTLNRILTMNGFIEDIKCQRFYEKQCLLQQRESYERCRRIY 64


>gi|225705236|gb|ACO08464.1| Mitochondrial 28S ribosomal protein S21 [Oncorhynchus mykiss]
          Length = 87

 Score = 54.5 bits (130), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 33/59 (55%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             A  V+V++ +V+ A + L + +  +G++  +K + +YEKP ++R R   E  +R  
Sbjct: 6  RFVARTVMVQEGDVDAACKALNRVLSVDGIIETVKRKRYYEKPCRRRQRENYENCKRIY 64


>gi|288958777|ref|YP_003449118.1| small subunit ribosomal protein S21 [Azospirillum sp. B510]
 gi|288911085|dbj|BAI72574.1| small subunit ribosomal protein S21 [Azospirillum sp. B510]
          Length = 67

 Score = 54.1 bits (129), Expect = 5e-06,   Method: Composition-based stats.
 Identities = 45/66 (68%), Positives = 57/66 (86%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+K+R +YEKPS+KR R K+EA+RR+RKL+RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKLRRNYEKPSEKRAREKAEAVRRTRKLLRK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 RMEREG 66


>gi|296228679|ref|XP_002759913.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like
          [Callithrix jacchus]
          Length = 87

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 36/66 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  A  V+V++ NVE A R L + +  +G++ ++K R +YEKP ++R R   E  RR   
Sbjct: 6  KFIARTVMVQEGNVESAYRTLNRILTMDGLIEDIKRRRYYEKPCRRRQRESYERCRRIYN 65

Query: 76 LMRKIA 81
          +     
Sbjct: 66 MEMARK 71


>gi|225704652|gb|ACO08172.1| Mitochondrial 28S ribosomal protein S21 [Oncorhynchus mykiss]
          Length = 87

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 32/59 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             A  V+V++ NV+ A + L + +  +G++  +K + +YEKP ++  R   E  +R  
Sbjct: 6  RFVARTVMVQEGNVDAAYKALNRVLSVDGIIETVKRKRYYEKPCRRGQRENYENCKRIY 64


>gi|302801604|ref|XP_002982558.1| hypothetical protein SELMODRAFT_445244 [Selaginella moellendorffii]
 gi|300149657|gb|EFJ16311.1| hypothetical protein SELMODRAFT_445244 [Selaginella moellendorffii]
          Length = 431

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 20/91 (21%), Positives = 47/91 (51%)

Query: 5   NAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVR 64
           +A   +    +++  VY+  +  N EQA+    +KM+ +  L +L  + +Y KPS++R +
Sbjct: 19  SALIWMDRAQQQVRGVYIDCKGLNFEQAMARYGRKMRQDKTLNDLLKKEYYVKPSEQRRQ 78

Query: 65  LKSEAIRRSRKLMRKIAQREGAPVSRLRQHR 95
            + E ++R++K + +   +    +   +  R
Sbjct: 79  AEKERVKRTKKRLFREKLKFVLMLRARKSRR 109


>gi|17505220|ref|NP_510964.1| 28S ribosomal protein S21, mitochondrial [Mus musculus]
 gi|13959545|sp|P58059|RT21_MOUSE RecName: Full=28S ribosomal protein S21, mitochondrial;
          Short=MRP-S21; Short=S21mt
 gi|13620913|dbj|BAB41009.1| mitochondrial ribosomal protein S21 [Mus musculus]
 gi|20381481|gb|AAH27546.1| Mitochondrial ribosomal protein S21 [Mus musculus]
 gi|26324304|dbj|BAC25044.1| unnamed protein product [Mus musculus]
 gi|26356866|dbj|BAC24999.1| unnamed protein product [Mus musculus]
 gi|26357681|dbj|BAC25181.1| unnamed protein product [Mus musculus]
 gi|26358258|dbj|BAC25189.1| unnamed protein product [Mus musculus]
 gi|26359872|dbj|BAC25210.1| unnamed protein product [Mus musculus]
 gi|26360001|dbj|BAC25213.1| unnamed protein product [Mus musculus]
 gi|26363244|dbj|BAC25237.1| unnamed protein product [Mus musculus]
 gi|26365847|dbj|BAC25267.1| unnamed protein product [Mus musculus]
 gi|26385360|dbj|BAC25036.1| unnamed protein product [Mus musculus]
 gi|116138616|gb|AAI25659.1| Mitochondrial ribosomal protein S21 [Mus musculus]
 gi|116138793|gb|AAI25661.1| Mitochondrial ribosomal protein S21 [Mus musculus]
 gi|148706895|gb|EDL38842.1| mCG16762, isoform CRA_a [Mus musculus]
 gi|148706896|gb|EDL38843.1| mCG16762, isoform CRA_a [Mus musculus]
 gi|148706897|gb|EDL38844.1| mCG16762, isoform CRA_a [Mus musculus]
          Length = 87

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 33/66 (50%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  A  V+V++ NVE A R L + +  +G+   +  R +YEKP ++R R   E  RR   
Sbjct: 6  KFIARTVMVQEGNVEGAYRTLNRILTTDGLTEVISRRRYYEKPCRRRQRESYETCRRIYN 65

Query: 76 LMRKIA 81
          +     
Sbjct: 66 MEMARK 71


>gi|209965358|ref|YP_002298273.1| ribosomal protein S21 [Rhodospirillum centenum SW]
 gi|226695041|sp|B6ITS4|RS21_RHOCS RecName: Full=30S ribosomal protein S21
 gi|209958824|gb|ACI99460.1| ribosomal protein S21 [Rhodospirillum centenum SW]
          Length = 67

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 46/66 (69%), Positives = 57/66 (86%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALR LKKKMQ EG+ RE+K+R +YEKPS+KR R K+EAIRR+RKL+RK
Sbjct: 1  MQVLVRDNNVDQALRALKKKMQREGIFREMKLRRNYEKPSEKRAREKAEAIRRARKLLRK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 RLEREG 66


>gi|325265737|ref|ZP_08132426.1| 30S ribosomal protein S21 [Kingella denitrificans ATCC 33394]
 gi|324982868|gb|EGC18491.1| 30S ribosomal protein S21 [Kingella denitrificans ATCC 33394]
          Length = 86

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 23/64 (35%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 16 EISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          E +   + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R +
Sbjct: 14 ETTMPSIRVKENEPFEVAMRRFKRAIEKTGLLTELRAREAYEKPTTERKRKKAAAVKRLQ 73

Query: 75 KLMR 78
          K +R
Sbjct: 74 KRLR 77


>gi|95931205|ref|ZP_01313926.1| ribosomal protein S21 [Desulfuromonas acetoxidans DSM 684]
 gi|95132724|gb|EAT14402.1| ribosomal protein S21 [Desulfuromonas acetoxidans DSM 684]
          Length = 64

 Score = 54.1 bits (129), Expect = 6e-06,   Method: Composition-based stats.
 Identities = 35/61 (57%), Positives = 45/61 (73%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + + V DNNVE+A+RVLK+K+Q EG+ RE+K R  YEKPS KR R + EA RR RK MR 
Sbjct: 1  MEIQVLDNNVEKAIRVLKRKLQQEGLFREMKQRKFYEKPSVKRKRKEKEAQRRLRKKMRM 60

Query: 80 I 80
          +
Sbjct: 61 M 61


>gi|224110854|ref|XP_002315659.1| predicted protein [Populus trichocarpa]
 gi|222864699|gb|EEF01830.1| predicted protein [Populus trichocarpa]
          Length = 113

 Score = 54.1 bits (129), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 23/71 (32%), Positives = 44/71 (61%), Gaps = 1/71 (1%)

Query: 5  NAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELK-MRGHYEKPSQKRV 63
          N+  G   + ++   + V V + N+EQAL+ +++KMQ  G+ R++K ++ H+ K S+KRV
Sbjct: 24 NSVSGGEHQIQQCRGIRVRVHNGNLEQALKFMQRKMQSSGIERQIKNLQTHHVKNSEKRV 83

Query: 64 RLKSEAIRRSR 74
            + +  RR +
Sbjct: 84 LARKKLQRRIQ 94


>gi|291459263|ref|ZP_06598653.1| conserved domain protein [Oribacterium sp. oral taxon 078 str.
           F0262]
 gi|291418517|gb|EFE92236.1| conserved domain protein [Oribacterium sp. oral taxon 078 str.
           F0262]
          Length = 111

 Score = 53.7 bits (128), Expect = 7e-06,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19  AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
              V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R
Sbjct: 54  MSSVIVKENESLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKR 108


>gi|328702964|ref|XP_003242055.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like
          [Acyrthosiphon pisum]
          Length = 87

 Score = 53.7 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 34/66 (51%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  +  VLVR+ NV++A RVL + M  EG L + +    YEKP+Q R R+  E  +    
Sbjct: 5  KFISRTVLVRNENVDEACRVLNRIMGSEGFLDQYRRTMFYEKPTQMRRRINYEKCKAIYD 64

Query: 76 LMRKIA 81
             K  
Sbjct: 65 EDMKRK 70


>gi|82906055|ref|XP_890261.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like [Mus
          musculus]
 gi|82906123|ref|XP_909763.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like [Mus
          musculus]
          Length = 87

 Score = 53.7 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 34/66 (51%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          + +A  V+V++ NVE A + L + +  +G+   +K R +YEKP ++  R   E  RR   
Sbjct: 6  KFTARTVMVQEGNVEGAYQTLNRILTTDGLTEVIKRRRYYEKPCRRLQRESYETCRRIYN 65

Query: 76 LMRKIA 81
          +     
Sbjct: 66 MEMARK 71


>gi|114633262|ref|XP_001136853.1| PREDICTED: similar to mitochondrial ribosomal protein S21 isoform
          1 [Pan troglodytes]
 gi|114633264|ref|XP_001136926.1| PREDICTED: similar to mitochondrial ribosomal protein S21 isoform
          2 [Pan troglodytes]
          Length = 76

 Score = 53.7 bits (128), Expect = 8e-06,   Method: Composition-based stats.
 Identities = 16/66 (24%), Positives = 33/66 (50%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  A  V+ ++ N+E A R L + +  +G++ +++ R + EKP  +R R   E  +R   
Sbjct: 6  KFIARTVMAQEGNMESAHRTLNRILTMDGLIEDIRCRWYCEKPCHRRQRESYERCQRIYS 65

Query: 76 LMRKIA 81
          +     
Sbjct: 66 MEMARK 71


>gi|154252514|ref|YP_001413338.1| 30S ribosomal protein S21 [Parvibaculum lavamentivorans DS-1]
 gi|171769601|sp|A7HUU8|RS21_PARL1 RecName: Full=30S ribosomal protein S21
 gi|154156464|gb|ABS63681.1| ribosomal protein S21 [Parvibaculum lavamentivorans DS-1]
          Length = 73

 Score = 53.7 bits (128), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 46/73 (63%), Positives = 58/73 (79%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QA++ LKKK+Q EGV RE+K+R  YEKPS+KR R K+EAIRR+RKL RK
Sbjct: 1  MQVLVRDNNVDQAMKALKKKLQREGVFREMKLRNFYEKPSEKRAREKAEAIRRARKLARK 60

Query: 80 IAQREGAPVSRLR 92
           AQRE   V+  +
Sbjct: 61 RAQREAGIVTAKK 73


>gi|242022269|ref|XP_002431563.1| mitochondrial 28S ribosomal protein S21, putative [Pediculus
          humanus corporis]
 gi|212516866|gb|EEB18825.1| mitochondrial 28S ribosomal protein S21, putative [Pediculus
          humanus corporis]
          Length = 87

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 34/60 (56%)

Query: 12 SEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          S  R+     VLV+DN VE ALRVL   +  EG++ + +    YEKP Q R R+  E ++
Sbjct: 2  SGIRKFMMRTVLVKDNEVESALRVLNSILGKEGIIDDHRRIQRYEKPWQTRRRINYEKMK 61


>gi|158424301|ref|YP_001525593.1| ribosomal protein S21 [Azorhizobium caulinodans ORS 571]
 gi|158331190|dbj|BAF88675.1| ribosomal protein S21 [Azorhizobium caulinodans ORS 571]
          Length = 96

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 57/76 (75%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNN++QALRVLKKKMQ EG+ RE+K R  YEKPS++R R  +EA+RR+RK  RK
Sbjct: 1  MQVLVRDNNIDQALRVLKKKMQREGIFREMKQRKAYEKPSERRTREMAEAVRRARKAARK 60

Query: 80 IAQREGAPVSRLRQHR 95
           AQREG    R  + +
Sbjct: 61 TAQREGLAPKRRGKPK 76


>gi|114053327|ref|NP_001040342.1| mitochondrial ribosomal protein S21 [Bombyx mori]
 gi|95102566|gb|ABF51221.1| mitochondrial ribosomal protein S21 [Bombyx mori]
          Length = 96

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 37/66 (56%)

Query: 6  AFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
          + R + +      A  V V++N+++ A R++ + M  EG+L + ++  +YEKP Q R R+
Sbjct: 4  SLRLLSNRHPSFIARTVFVQNNDIDNACRLINRIMGKEGLLAQYRLTRYYEKPFQTRRRV 63

Query: 66 KSEAIR 71
            E  +
Sbjct: 64 NHEKCK 69


>gi|307942816|ref|ZP_07658161.1| ribosomal protein S21 [Roseibium sp. TrichSKD4]
 gi|307773612|gb|EFO32828.1| ribosomal protein S21 [Roseibium sp. TrichSKD4]
          Length = 73

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 49/73 (67%), Positives = 60/73 (82%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNVEQA+RVLKKK+Q EGVLRE+K R +YEKPS+KR R K+EA+RR+RK  RK
Sbjct: 1  MQVLVRDNNVEQAIRVLKKKLQREGVLREMKSRRNYEKPSEKRAREKAEAVRRARKAARK 60

Query: 80 IAQREGAPVSRLR 92
          +AQREG    + R
Sbjct: 61 LAQREGLIAGKKR 73


>gi|114560429|ref|XP_001168879.1| PREDICTED: hypothetical protein [Pan troglodytes]
 gi|332810801|ref|XP_003308571.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like [Pan
          troglodytes]
          Length = 87

 Score = 53.4 bits (127), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 30/55 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
          + +A   +V++ NVE A R L + +  +G+L ++K   + EKP  +R R   +  
Sbjct: 6  KFTARTEMVQEGNVEGAYRTLNRILTVDGLLEDIKRPWYNEKPCCQRQRKSYKRC 60


>gi|119569630|gb|EAW49245.1| hCG1642062 [Homo sapiens]
          Length = 76

 Score = 53.0 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 30/56 (53%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          E  A  V+ ++ NVE A R L + +  +G++ +++ R + EKP  +  R   E  R
Sbjct: 6  EFIARTVMAQEGNVESAHRTLNRILTMDGLIEDIRRRRYCEKPCHRLQRESYERCR 61


>gi|76579108|gb|ABA48583.1| 30S ribosomal protein S21.-related protein [Burkholderia
           pseudomallei 1710b]
          Length = 123

 Score = 52.6 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 23/82 (28%), Positives = 44/82 (53%), Gaps = 3/82 (3%)

Query: 8   RGIFSEGREIS--AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVR 64
           R +F   ++I      +L+++N   E A+R  ++ ++  G++ EL+ R  YEKP+  R R
Sbjct: 41  RYVFDRIKQIRNDMTTILLKENEPFEVAIRRFRRAIEKNGLIAELRERQAYEKPTAVRKR 100

Query: 65  LKSEAIRRSRKLMRKIAQREGA 86
            K+ A++R  K +R     +  
Sbjct: 101 KKAAAVKRLHKRLRSQMLPKKL 122


>gi|168063805|ref|XP_001783859.1| predicted protein [Physcomitrella patens subsp. patens]
 gi|162664637|gb|EDQ51349.1| predicted protein [Physcomitrella patens subsp. patens]
          Length = 182

 Score = 52.6 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 15/73 (20%), Positives = 31/73 (42%), Gaps = 2/73 (2%)

Query: 21  YVLVRDNNV-EQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
            V V ++   +  +R  ++ +   GV+ E + R  +E       R + ++ RR +   R 
Sbjct: 90  QVFVGEDEPADSVVRRFRRAVMAAGVIPECRRRRFHETSQDIVKRKQKDSHRRKQSSRRF 149

Query: 80  IAQR-EGAPVSRL 91
              R EG   ++ 
Sbjct: 150 NGPRPEGGFSTKK 162


>gi|114799687|ref|YP_761837.1| 30S ribosomal protein S21 [Hyphomonas neptunium ATCC 15444]
 gi|119367264|sp|Q0BXF6|RS21_HYPNA RecName: Full=30S ribosomal protein S21
 gi|114739861|gb|ABI77986.1| ribosomal protein S21 [Hyphomonas neptunium ATCC 15444]
          Length = 69

 Score = 52.6 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 45/67 (67%), Positives = 56/67 (83%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           V ++VRDNNVEQALR LKKKMQ EG+ RE+K R H+EKPS+K+ R ++EA+RR+RKL R
Sbjct: 1  MVQIVVRDNNVEQALRALKKKMQREGLFREMKARQHFEKPSEKKARQRAEAVRRARKLAR 60

Query: 79 KIAQREG 85
          K AQREG
Sbjct: 61 KRAQREG 67


>gi|227514590|ref|ZP_03944639.1| ribosomal protein S21 [Lactobacillus fermentum ATCC 14931]
 gi|227087001|gb|EEI22313.1| ribosomal protein S21 [Lactobacillus fermentum ATCC 14931]
          Length = 88

 Score = 52.6 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 1/61 (1%)

Query: 10 IFSEGREISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSE 68
          + SEG   +    +VR N  ++ ALR  K+ +   G L+E + R  YEKPS K       
Sbjct: 18 LSSEGGNFTMSKTIVRKNESLDDALRRFKRTVSRNGTLQEYRKREFYEKPSVKHKLKSEA 77

Query: 69 A 69
          A
Sbjct: 78 A 78


>gi|186532697|ref|NP_001119483.1| structural constituent of ribosome [Arabidopsis thaliana]
 gi|10177311|dbj|BAB10572.1| unnamed protein product [Arabidopsis thaliana]
 gi|124301094|gb|ABN04799.1| At5g63300 [Arabidopsis thaliana]
 gi|332010347|gb|AED97730.1| ribosomal protein S21 family protein [Arabidopsis thaliana]
          Length = 217

 Score = 52.6 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 1/62 (1%)

Query: 16  EISAVYVLVRDNNVEQAL-RVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
               V V+ +D   E+ L    K+     GVL+E + R  +E   +K+ R   EA ++ R
Sbjct: 78  SYYNVEVVPKDGESEEQLVNDFKRSCFRAGVLQESRRRRFFESSLEKKTRKTKEAAKKYR 137

Query: 75  KL 76
           K 
Sbjct: 138 KR 139


>gi|323449628|gb|EGB05514.1| hypothetical protein AURANDRAFT_66244 [Aureococcus
          anophagefferens]
          Length = 330

 Score = 52.6 bits (125), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 14/59 (23%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 17 ISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          ++++ + VR    V+  +  L++++   G LR L+ + ++E   +K+ R  +EA R+ +
Sbjct: 36 LNSIKITVRSGESVDSVIMRLRREVNKSGHLRTLRNKRYHEDAREKKKRKLAEARRKMK 94


>gi|329890375|ref|ZP_08268718.1| ribosomal protein S21 [Brevundimonas diminuta ATCC 11568]
 gi|328845676|gb|EGF95240.1| ribosomal protein S21 [Brevundimonas diminuta ATCC 11568]
          Length = 90

 Score = 52.2 bits (124), Expect = 2e-05,   Method: Composition-based stats.
 Identities = 46/81 (56%), Positives = 57/81 (70%)

Query: 15 REISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           E   V + VRDNNV+QAL+ LKKKMQ EG  RE+K   H+EKPS+KR R K+EA+RR+R
Sbjct: 10 GERPLVQIFVRDNNVDQALKALKKKMQREGSFREMKRHVHFEKPSEKRARQKAEAVRRAR 69

Query: 75 KLMRKIAQREGAPVSRLRQHR 95
          KL RK AQREG   +   + R
Sbjct: 70 KLARKRAQREGLLPAPKGRGR 90


>gi|229366568|gb|ACQ58264.1| Mitochondrial 28S ribosomal protein S21 [Anoplopoma fimbria]
          Length = 87

 Score = 52.2 bits (124), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 32/59 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             A  V+VR+ NV+ A + L + +  EGV+  +K + + EKP ++R R   E  RR  
Sbjct: 6  RFIARTVMVREGNVDAAYKTLNRLLTQEGVIEAVKRKRYCEKPCRERQRKNFENCRRIY 64


>gi|332020441|gb|EGI60861.1| 28S ribosomal protein S21, mitochondrial [Acromyrmex echinatior]
          Length = 97

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 33/56 (58%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  +  + V++N+V++A R+L + +  E +  + +   +YEKP+Q R R+  E  +
Sbjct: 15 QFISRTIFVQNNDVDKACRLLNRILSKEDIFSQYRRTRYYEKPTQVRRRINYERCK 70


>gi|225705780|gb|ACO08736.1| Mitochondrial 28S ribosomal protein S21 [Oncorhynchus mykiss]
          Length = 87

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 32/59 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             A  V+V++ NV+ A + L + +  + ++  +K + +YEKP ++R R   E  +R  
Sbjct: 6  RFVARTVMVQEGNVDAAYKALNRVLSVDVIIETVKRKRYYEKPCRRRQRENYENCKRIY 64


>gi|262193419|ref|YP_003264628.1| ribosomal protein S21 [Haliangium ochraceum DSM 14365]
 gi|262076766|gb|ACY12735.1| ribosomal protein S21 [Haliangium ochraceum DSM 14365]
          Length = 73

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 31/61 (50%), Positives = 43/61 (70%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          V V VRD  +E+A+++LK+KM  EG+L+ELK R  YEKPS KR R   EA +R R+ M++
Sbjct: 9  VEVEVRDGALEKAMKILKQKMSKEGILQELKRRRFYEKPSVKRKRKAREARKRLRREMKR 68

Query: 80 I 80
           
Sbjct: 69 R 69


>gi|304321019|ref|YP_003854662.1| 30S ribosomal protein S21 [Parvularcula bermudensis HTCC2503]
 gi|303299921|gb|ADM09520.1| 30S ribosomal protein S21 [Parvularcula bermudensis HTCC2503]
          Length = 55

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 34/55 (61%), Positives = 41/55 (74%)

Query: 33 LRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAP 87
          +R LKKKMQ EG  RE+K R  YEKPS++R R K+EA+RR+RKL RK  QREG  
Sbjct: 1  MRALKKKMQREGTFREMKRRKFYEKPSERRARQKAEAVRRARKLQRKKMQREGLI 55


>gi|298290654|ref|YP_003692593.1| ribosomal protein S21 [Starkeya novella DSM 506]
 gi|296927165|gb|ADH87974.1| ribosomal protein S21 [Starkeya novella DSM 506]
          Length = 91

 Score = 51.8 bits (123), Expect = 3e-05,   Method: Composition-based stats.
 Identities = 45/74 (60%), Positives = 57/74 (77%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QALRVLKKKMQ EGV RE+K R  YEKPS+++ R K+EA+RR+RK  RK
Sbjct: 1  MQVLVRDNNVDQALRVLKKKMQREGVFREMKARRAYEKPSERKTREKAEAVRRARKAARK 60

Query: 80 IAQREGAPVSRLRQ 93
           A REG   +  ++
Sbjct: 61 QAVREGLIAAPKKR 74


>gi|241392417|ref|XP_002409447.1| ribosomal protein S21, putative [Ixodes scapularis]
 gi|67083953|gb|AAY66911.1| mitochondrial ribosomal protein S21 [Ixodes scapularis]
 gi|215497490|gb|EEC06984.1| ribosomal protein S21, putative [Ixodes scapularis]
          Length = 87

 Score = 51.8 bits (123), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 35/57 (61%)

Query: 15 REISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +   A  VLV++N VE+ALRVL + +  EG+    ++  +YEKP++ R R+  E  +
Sbjct: 4  KLFIARTVLVQNNQVEEALRVLNRILGMEGIFDRYRLTRYYEKPTKTRRRVNYEICK 60


>gi|148556770|ref|YP_001264352.1| 30S ribosomal protein S21P [Sphingomonas wittichii RW1]
 gi|148501960|gb|ABQ70214.1| SSU ribosomal protein S21P [Sphingomonas wittichii RW1]
          Length = 81

 Score = 51.4 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 42/66 (63%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + ++VRDNNV+QALR LKKK+Q EGV RE+K+R HYEKPS+KR R ++ AIRR+RKL RK
Sbjct: 14 MQIIVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRARERAAAIRRARKLERK 73

Query: 80 IAQREG 85
            +R+G
Sbjct: 74 RMERDG 79


>gi|10197634|gb|AAG14953.1|AF182417_1 MDS016 [Homo sapiens]
          Length = 75

 Score = 51.4 bits (122), Expect = 4e-05,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 23 LVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
          +V++ NVE A R L + +  +G++ ++K R +YEKP ++R R   E  RR   +     
Sbjct: 1  MVQEGNVESAYRTLNRILTMDGLIEDIKHRRYYEKPCRRRQRESYERCRRIYNMEMARK 59


>gi|297793921|ref|XP_002864845.1| hypothetical protein ARALYDRAFT_496513 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297310680|gb|EFH41104.1| hypothetical protein ARALYDRAFT_496513 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 183

 Score = 51.0 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 30/62 (48%), Gaps = 1/62 (1%)

Query: 17  ISAVYVLVRDNNVE-QALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
              V V+ +D   E Q L   K+     GVL+E + R  +E   +KR+R   EA ++ RK
Sbjct: 78  YYNVEVVPKDGESEEQLLNDFKRSCFRAGVLQESRRRRFFESSQEKRIRKTKEAAKKYRK 137

Query: 76  LM 77
             
Sbjct: 138 RR 139


>gi|324530792|gb|ADY49112.1| 28S ribosomal protein S21 [Ascaris suum]
          Length = 111

 Score = 51.0 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 36/66 (54%)

Query: 6  AFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
           F GI+          VLV+DN+V+ A  +L + M  EG+L+ ++   +Y+KP  +R  L
Sbjct: 17 LFPGIWHAHPRFMNRTVLVKDNDVDSAFHLLNRLMDMEGMLKIIRQTQYYQKPFMQRKAL 76

Query: 66 KSEAIR 71
            EA +
Sbjct: 77 SVEASK 82


>gi|95928492|ref|ZP_01311239.1| ribosomal protein S21 [Desulfuromonas acetoxidans DSM 684]
 gi|95135282|gb|EAT16934.1| ribosomal protein S21 [Desulfuromonas acetoxidans DSM 684]
          Length = 82

 Score = 51.0 bits (121), Expect = 5e-05,   Method: Composition-based stats.
 Identities = 29/64 (45%), Positives = 46/64 (71%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           V + V D N+ +A+R++K+K+Q EG+ RE+K R +YEKPS KR R + E+++R RK  R
Sbjct: 17 TVELKVVDGNLAKAMRLMKRKLQQEGLFREMKKRRYYEKPSAKRKRKQKESLQRERKRQR 76

Query: 79 KIAQ 82
          K+ +
Sbjct: 77 KLDR 80


>gi|297818170|ref|XP_002876968.1| hypothetical protein ARALYDRAFT_484399 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297322806|gb|EFH53227.1| hypothetical protein ARALYDRAFT_484399 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 181

 Score = 50.7 bits (120), Expect = 6e-05,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 44/87 (50%), Gaps = 3/87 (3%)

Query: 12  SEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELK-MRGHYEKPSQKRVRLKSEAI 70
            + ++   + V V  N++++AL +L+KKMQ  G+ R +K  + H+ K S+K+V  +    
Sbjct: 16  HQLQQERGIRVKVFSNDLDKALTILQKKMQSSGMERLIKGTQTHHIKNSEKKVLARKNLE 75

Query: 71  RRSRK--LMRKIAQREGAPVSRLRQHR 95
           RR +     RK+       V R  +  
Sbjct: 76  RRIKSIDFARKLQSILIKKVRRFMRDE 102


>gi|297814952|ref|XP_002875359.1| hypothetical protein ARALYDRAFT_484499 [Arabidopsis lyrata subsp.
           lyrata]
 gi|297321197|gb|EFH51618.1| hypothetical protein ARALYDRAFT_484499 [Arabidopsis lyrata subsp.
           lyrata]
          Length = 184

 Score = 50.7 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 18  SAVYVLVRDNNVEQAL-RVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
             V V V DN  E+ L    ++++   GV++E K R ++E    ++ R   +A +R++K 
Sbjct: 85  YNVQVFVEDNESEERLVNRFRREVMRTGVIQECKRRRYFENKQDEKKRRTRDAAKRNKKR 144

Query: 77  M 77
            
Sbjct: 145 R 145


>gi|91088983|ref|XP_966918.1| PREDICTED: similar to mitochondrial ribosomal protein S21
          CG32854-PA [Tribolium castaneum]
 gi|270012379|gb|EFA08827.1| hypothetical protein TcasGA2_TC006524 [Tribolium castaneum]
          Length = 87

 Score = 50.7 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 31/56 (55%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
             A  V V++N+VE A RVL + +  EG+L + +    +EKP Q R R+  E  +
Sbjct: 5  SFIARTVFVQNNDVEAACRVLNRILGREGILEQYRRTRFFEKPFQFRRRINFEKCK 60


>gi|303290656|ref|XP_003064615.1| predicted protein [Micromonas pusilla CCMP1545]
 gi|226454213|gb|EEH51520.1| predicted protein [Micromonas pusilla CCMP1545]
          Length = 202

 Score = 50.7 bits (120), Expect = 7e-05,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 40/64 (62%), Gaps = 1/64 (1%)

Query: 19  AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR-SRKLM 77
            ++VLVR+++VEQA+R L +  + EG+ RE K R +Y KPS +R   K E   R  ++ M
Sbjct: 128 GMHVLVRNDDVEQAIRKLSRAERDEGIAREFKKREYYLKPSAQRRLDKKEREHRQWKREM 187

Query: 78  RKIA 81
           RK  
Sbjct: 188 RKKL 191


>gi|195394906|ref|XP_002056080.1| GJ10744 [Drosophila virilis]
 gi|194142789|gb|EDW59192.1| GJ10744 [Drosophila virilis]
          Length = 87

 Score = 50.7 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 18/56 (32%), Positives = 30/56 (53%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  V V +NNV++A R+L + +  E +  + +    YEKP Q R R+  E  +
Sbjct: 5  QFLARTVFVHNNNVDEACRLLNRILGKEEIFDQFRRTRFYEKPYQVRRRVNFEKCK 60


>gi|332186335|ref|ZP_08388080.1| ribosomal protein S21 [Sphingomonas sp. S17]
 gi|332013703|gb|EGI55763.1| ribosomal protein S21 [Sphingomonas sp. S17]
          Length = 68

 Score = 50.7 bits (120), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 43/67 (64%), Positives = 57/67 (85%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + ++VRDNNV+QALR LKKK+Q EGV RE+K+R HYEKPS+KR R ++ A+RR+RKL RK
Sbjct: 1  MQIIVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRARERAAAVRRARKLERK 60

Query: 80 IAQREGA 86
           A+R+GA
Sbjct: 61 RAERDGA 67


>gi|225710592|gb|ACO11142.1| Mitochondrial 28S ribosomal protein S21 [Caligus rogercresseyi]
          Length = 98

 Score = 50.3 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
             +  V+V +N VE+A+++L   +  EG+L   K+   YEKP+Q R R+  E  R
Sbjct: 16 RWISRTVMVENNEVEKAMKILNGIVANEGILARWKLTRRYEKPTQMRSRVNYERAR 71


>gi|116784901|gb|ABK23512.1| unknown [Picea sitchensis]
          Length = 166

 Score = 50.3 bits (119), Expect = 8e-05,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 35/54 (64%), Gaps = 1/54 (1%)

Query: 10  IFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKM-RGHYEKPSQKR 62
           I   G++I  + V V D N+E+AL+VL++KM G G+ R ++    ++ K S+KR
Sbjct: 82  IAKHGQQIRGIRVKVLDGNLERALQVLQRKMIGSGMERLIRKVPRYHIKDSEKR 135


>gi|303327385|ref|ZP_07357826.1| ribosomal protein S21 [Desulfovibrio sp. 3_1_syn3]
 gi|302862325|gb|EFL85258.1| ribosomal protein S21 [Desulfovibrio sp. 3_1_syn3]
          Length = 70

 Score = 50.3 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 40/64 (62%)

Query: 17 ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
          +  V++   D N + ALR  KK+++  G+L E+K R HYEKPS  R + K+ A +R  K 
Sbjct: 4  LPGVFLNDDDYNFDIALRRFKKQVEKAGILSEMKKRQHYEKPSVMRKKKKAAARKRLMKK 63

Query: 77 MRKI 80
          +RK+
Sbjct: 64 IRKM 67


>gi|56552609|ref|YP_163448.1| 30S ribosomal protein S21 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241762146|ref|ZP_04760229.1| ribosomal protein S21 [Zymomonas mobilis subsp. mobilis ATCC
          10988]
 gi|260753736|ref|YP_003226629.1| 30S ribosomal protein S21 [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
 gi|61215793|sp|Q5NLS3|RS21_ZYMMO RecName: Full=30S ribosomal protein S21
 gi|56544183|gb|AAV90337.1| ribosomal protein S21 [Zymomonas mobilis subsp. mobilis ZM4]
 gi|241373396|gb|EER62996.1| ribosomal protein S21 [Zymomonas mobilis subsp. mobilis ATCC
          10988]
 gi|258553099|gb|ACV76045.1| ribosomal protein S21 [Zymomonas mobilis subsp. mobilis NCIMB
          11163]
          Length = 68

 Score = 50.3 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 43/66 (65%), Positives = 56/66 (84%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + ++VRDNNV+QALR LKKK+Q EGV RE+K+R HYEKPS+KR R ++ A+RRSRKL RK
Sbjct: 1  MQIIVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRARERAAAVRRSRKLERK 60

Query: 80 IAQREG 85
           A+R+G
Sbjct: 61 RAERDG 66


>gi|322780433|gb|EFZ09921.1| hypothetical protein SINV_09348 [Solenopsis invicta]
          Length = 90

 Score = 50.3 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 31/56 (55%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  +  + V++N+V++A R L + +  E +  + +   +YEKP+  R R+  E  +
Sbjct: 8  QFISRTIFVQNNDVDKACRTLNRILSQEDIFGQYRRTRYYEKPTYVRRRINFERCK 63


>gi|61215965|sp|Q72B46|RS21_DESVH RecName: Full=30S ribosomal protein S21
 gi|46449619|gb|AAS96269.1| ribosomal protein S21 [Desulfovibrio vulgaris str. Hildenborough]
          Length = 70

 Score = 50.3 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 40/65 (61%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           +  VY+   D N + ALR  KK+++  G+L E+K R HYEKPS  R + K+ A +R  K
Sbjct: 3  SLPGVYLNEDDYNFDIALRRFKKQVEKAGILSEMKKRQHYEKPSVMRKKKKAAARKRLLK 62

Query: 76 LMRKI 80
           +RK+
Sbjct: 63 KIRKM 67


>gi|34932484|ref|XP_344707.1| PREDICTED: mitochondrial ribosomal protein S21 [Rattus
          norvegicus]
 gi|109507606|ref|XP_001057655.1| PREDICTED: mitochondrial ribosomal protein S21-like [Rattus
          norvegicus]
          Length = 100

 Score = 50.3 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 33/63 (52%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  A  V+V++ NVE A R L + +  +G++  +K R +YEKP   + R   E   R R+
Sbjct: 6  KFIARTVMVQEGNVEGAYRTLNRILTTDGLIDVIKRRRYYEKPYVIKRRRYYEKPCRRRR 65

Query: 76 LMR 78
             
Sbjct: 66 QRE 68


>gi|308492047|ref|XP_003108214.1| hypothetical protein CRE_10244 [Caenorhabditis remanei]
 gi|308249062|gb|EFO93014.1| hypothetical protein CRE_10244 [Caenorhabditis remanei]
          Length = 118

 Score = 50.3 bits (119), Expect = 9e-05,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 37/66 (56%)

Query: 4  FNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRV 63
             F+G+++     +   V+V++N+V+ A  +L + M  EG+L+ ++    Y+KP  +R 
Sbjct: 22 IKLFKGVWNAHPRFATRTVMVQNNDVDGAFGLLNRLMDSEGMLKIIRRTQFYQKPYMQRK 81

Query: 64 RLKSEA 69
           L  EA
Sbjct: 82 SLSMEA 87


>gi|103486528|ref|YP_616089.1| 30S ribosomal protein S21 [Sphingopyxis alaskensis RB2256]
 gi|119367315|sp|Q1GUB6|RS21_SPHAL RecName: Full=30S ribosomal protein S21
 gi|98976605|gb|ABF52756.1| SSU ribosomal protein S21P [Sphingopyxis alaskensis RB2256]
          Length = 68

 Score = 50.3 bits (119), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 40/66 (60%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + ++VRDNNV+QALR LKKK+Q EGV RE+K+R HYEKPS+KR R ++ A+RR+RK+ RK
Sbjct: 1  MQIIVRDNNVDQALRALKKKLQREGVYREMKLRRHYEKPSEKRARERAAAVRRARKMERK 60

Query: 80 IAQREG 85
            +R+G
Sbjct: 61 RMERDG 66


>gi|79546640|ref|NP_201135.2| structural constituent of ribosome [Arabidopsis thaliana]
 gi|63147388|gb|AAY34167.1| At5g63300 [Arabidopsis thaliana]
 gi|332010346|gb|AED97729.1| ribosomal protein S21 family protein [Arabidopsis thaliana]
          Length = 185

 Score = 49.9 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 1/63 (1%)

Query: 16  EISAVYVLVRDNNVEQAL-RVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
               V V+ +D   E+ L    K+     GVL+E + R  +E   +K+ R   EA ++ R
Sbjct: 78  SYYNVEVVPKDGESEEQLVNDFKRSCFRAGVLQESRRRRFFESSLEKKTRKTKEAAKKYR 137

Query: 75  KLM 77
           K  
Sbjct: 138 KRR 140


>gi|18405254|ref|NP_566809.1| GHS1 (GLUCOSE HYPERSENSITIVE 1); structural constituent of ribosome
           [Arabidopsis thaliana]
 gi|9294081|dbj|BAB01933.1| unnamed protein product [Arabidopsis thaliana]
 gi|332643753|gb|AEE77274.1| ribosomal protein S21 family protein [Arabidopsis thaliana]
          Length = 183

 Score = 49.9 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 18  SAVYVLVRDNNVEQAL-RVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
             V V V DN  E+ L    ++++   GV++E K R ++E    ++ R   +A +R++K 
Sbjct: 85  YNVQVFVEDNESEERLVNRFRREVMRTGVIQECKRRRYFENKQDEKKRRTRDAAKRNKKR 144

Query: 77  M 77
            
Sbjct: 145 R 145


>gi|195109080|ref|XP_001999118.1| GI23247 [Drosophila mojavensis]
 gi|193915712|gb|EDW14579.1| GI23247 [Drosophila mojavensis]
          Length = 87

 Score = 49.9 bits (118), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 30/56 (53%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  V V +NNVE+A R+L + +  E +  + +    YEKP Q R R+  E  +
Sbjct: 5  QFIARTVFVHNNNVEEACRLLNRILGKEEIFDQFRRTRFYEKPYQVRRRVNFEKCK 60


>gi|14532554|gb|AAK64005.1| AT3g27160/MYF5_3 [Arabidopsis thaliana]
 gi|18655399|gb|AAL76155.1| AT3g27160/MYF5_3 [Arabidopsis thaliana]
          Length = 183

 Score = 49.5 bits (117), Expect = 1e-04,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 32/61 (52%), Gaps = 1/61 (1%)

Query: 18  SAVYVLVRDNNVEQAL-RVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
             V V V DN  E+ L    ++++   GV++E K R ++E    ++ R   +A +R++K 
Sbjct: 85  YNVQVFVEDNESEERLVNRFRREVMRTGVIQECKRRRYFENKQDEKKRRTRDAAKRNKKR 144

Query: 77  M 77
            
Sbjct: 145 R 145


>gi|225468127|ref|XP_002268677.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|225469463|ref|XP_002269726.1| PREDICTED: hypothetical protein [Vitis vinifera]
 gi|296086848|emb|CBI33015.3| unnamed protein product [Vitis vinifera]
          Length = 106

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 26/77 (33%), Positives = 42/77 (54%), Gaps = 3/77 (3%)

Query: 8  RGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKM-RGHYEKPSQKRVRLK 66
            +  E ++   + V V + N+E AL V+++KMQ  G+ R +K  + H+ K S+KRV  +
Sbjct: 20 NSLSCELQQWRGIRVKVFNGNLESALVVMQRKMQSSGIERLIKREQTHHIKNSEKRVLAR 79

Query: 67 SEAIRRSRK--LMRKIA 81
              RR R   L RK+ 
Sbjct: 80 KNLERRIRSQDLARKLK 96


>gi|39996009|ref|NP_951960.1| 30S ribosomal protein S21 [Geobacter sulfurreducens PCA]
 gi|81702986|sp|Q74EQ6|RS211_GEOSL RecName: Full=30S ribosomal protein S21 1
 gi|39982774|gb|AAR34233.1| ribosomal protein S21 [Geobacter sulfurreducens PCA]
 gi|298505031|gb|ADI83754.1| ribosomal protein S21 [Geobacter sulfurreducens KN400]
          Length = 66

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 30/59 (50%), Positives = 43/59 (72%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
          + V V+ N+V++ALR+LK+K+Q EG  +E+K R HYEKPS K+ R + EA R+ RK  R
Sbjct: 1  MQVSVQGNDVDKALRLLKRKLQTEGFFKEIKKRKHYEKPSVKKKRKQMEAERKRRKAQR 59


>gi|157124995|ref|XP_001654201.1| mitochondrial ribosomal protein, S21, putative [Aedes aegypti]
 gi|108882730|gb|EAT46955.1| mitochondrial ribosomal protein, S21, putative [Aedes aegypti]
          Length = 87

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 32/56 (57%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  VLV++NNVE+A RVL + +  E +  + +    YEKP Q R R+  E  +
Sbjct: 5  KFIARTVLVQNNNVEEACRVLNRILGKEEIFDQFRRTRFYEKPFQTRRRVNFEKCK 60


>gi|195036866|ref|XP_001989889.1| GH18548 [Drosophila grimshawi]
 gi|193894085|gb|EDV92951.1| GH18548 [Drosophila grimshawi]
          Length = 87

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 30/56 (53%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  V V +NNVE+A R+L + +  E +  + +    YEKP Q R R+  E  +
Sbjct: 5  QFLARTVFVHNNNVEEACRLLNRILGKEEIFDQFRRTRFYEKPFQVRRRVNFEKCK 60


>gi|258592865|emb|CBE69174.1| 30S ribosomal protein S21 [NC10 bacterium 'Dutch sediment']
          Length = 93

 Score = 49.5 bits (117), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 23/54 (42%), Positives = 32/54 (59%)

Query: 12 SEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
           +G     + V V    VE A+R+ KK +  +G+L+ELK R HYEKP +KR R 
Sbjct: 17 DKGGRHRPLEVKVDGRGVESAIRLFKKLVLRDGILKELKRRAHYEKPGEKRRRK 70


>gi|88606718|ref|YP_505608.1| 30S ribosomal protein S21 [Anaplasma phagocytophilum HZ]
 gi|88597781|gb|ABD43251.1| ribosomal protein S21 [Anaplasma phagocytophilum HZ]
          Length = 91

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 30/76 (39%), Positives = 47/76 (61%), Gaps = 1/76 (1%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           V V+V   ++EQ +R LKKK+Q EG  R++K+  H+EKPS+KRVR + +  RR +KL  
Sbjct: 1  MVEVVVYHGDIEQGIRTLKKKLQREGKPRQMKI-VHHEKPSEKRVRKRDDCERRRKKLHG 59

Query: 79 KIAQREGAPVSRLRQH 94
            ++ +G       +H
Sbjct: 60 APSEPQGGRFKISARH 75


>gi|212702267|ref|ZP_03310395.1| hypothetical protein DESPIG_00278 [Desulfovibrio piger ATCC
          29098]
 gi|212674330|gb|EEB34813.1| hypothetical protein DESPIG_00278 [Desulfovibrio piger ATCC
          29098]
          Length = 70

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 40/64 (62%)

Query: 17 ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
          +  V++   D N + ALR  KK+++  GVL E+K R HYEKPS  R + K+ A +R  K 
Sbjct: 4  VPGVFLNEDDYNFDIALRRFKKQVEKAGVLSEMKKRQHYEKPSVMRKKKKAAARKRLMKK 63

Query: 77 MRKI 80
          +RK+
Sbjct: 64 IRKM 67


>gi|217075530|gb|ACJ86125.1| unknown [Medicago truncatula]
          Length = 198

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/75 (25%), Positives = 38/75 (50%), Gaps = 2/75 (2%)

Query: 18  SAVYVLVRDNNVEQA-LRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
             V ++V D+  E+  L   ++++   G+++E K R  +E P  ++ R   +A +R+R+ 
Sbjct: 92  YNVQIIVEDDEPEERFLNRFRREVFSAGIIQECKRRKRFENPQDEKKRRVRDAAKRNRRN 151

Query: 77  M-RKIAQREGAPVSR 90
              +    EG   SR
Sbjct: 152 KFARRPMGEGGNSSR 166


>gi|218193566|gb|EEC75993.1| hypothetical protein OsI_13118 [Oryza sativa Indica Group]
          Length = 144

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 15 REISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRG---HYEKPSQKRVRLKSEAIR 71
          ++   + V V+D N+E+AL V+ +KM+  G+ R ++ R    H+ K S+KRV  +   ++
Sbjct: 24 QQARGIVVHVKDGNLERALGVMARKMRSSGIERLIRARSQIHHHVKDSEKRVLARKALMQ 83

Query: 72 RSRKLMRKIAQRE 84
          R R        R+
Sbjct: 84 RVRSQELGKKLRD 96


>gi|321469280|gb|EFX80261.1| hypothetical protein DAPPUDRAFT_304201 [Daphnia pulex]
          Length = 88

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 30/56 (53%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  V V++N++EQA RV+ + M  EG   + +    YEKP   R R+  E  +
Sbjct: 7  KFIARTVFVQNNDIEQACRVINRIMGSEGWFDQFRRTRRYEKPYMARRRINFEKCK 62


>gi|120602411|ref|YP_966811.1| 30S ribosomal protein S21 [Desulfovibrio vulgaris DP4]
 gi|161343883|ref|YP_011010.2| 30S ribosomal protein S21 [Desulfovibrio vulgaris str.
          Hildenborough]
 gi|166224028|sp|A1VD68|RS21_DESVV RecName: Full=30S ribosomal protein S21
 gi|120562640|gb|ABM28384.1| SSU ribosomal protein S21P [Desulfovibrio vulgaris DP4]
 gi|311233810|gb|ADP86664.1| ribosomal protein S21 [Desulfovibrio vulgaris RCH1]
          Length = 67

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 40/64 (62%)

Query: 17 ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
          +  VY+   D N + ALR  KK+++  G+L E+K R HYEKPS  R + K+ A +R  K 
Sbjct: 1  MPGVYLNEDDYNFDIALRRFKKQVEKAGILSEMKKRQHYEKPSVMRKKKKAAARKRLLKK 60

Query: 77 MRKI 80
          +RK+
Sbjct: 61 IRKM 64


>gi|148259390|ref|YP_001233517.1| 30S ribosomal protein S21 [Acidiphilium cryptum JF-5]
 gi|326402612|ref|YP_004282693.1| 30S ribosomal protein S21 [Acidiphilium multivorum AIU301]
 gi|167011219|sp|A5FVG6|RS21_ACICJ RecName: Full=30S ribosomal protein S21
 gi|146401071|gb|ABQ29598.1| SSU ribosomal protein S21P [Acidiphilium cryptum JF-5]
 gi|325049473|dbj|BAJ79811.1| 30S ribosomal protein S21 [Acidiphilium multivorum AIU301]
          Length = 67

 Score = 49.1 bits (116), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 42/66 (63%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + VLVRDNNV+QAL+ LKKK+Q EGV RE+K+R HYEKPS++R R  +EA+RR+RK+ RK
Sbjct: 1  MQVLVRDNNVDQALKALKKKLQREGVFREMKLRRHYEKPSERRAREAAEAVRRARKMERK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 RIEREG 66


>gi|209363783|ref|YP_001423817.2| 30S ribosomal protein S21 [Coxiella burnetii Dugway 5J108-111]
 gi|207081716|gb|ABS77864.2| SSU ribosomal protein S21P [Coxiella burnetii Dugway 5J108-111]
          Length = 86

 Score = 48.7 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 40/77 (51%), Gaps = 1/77 (1%)

Query: 7  FRGIFSEGREISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
                 G +     + V DNN  + A+R  K+  +  G+L +L+   +YEKP+ KR R 
Sbjct: 1  MAFSHELGVDKRMPMIDVPDNNAFDVAMRRFKRACEKAGILSKLRQIEYYEKPTSKRKRK 60

Query: 66 KSEAIRRSRKLMRKIAQ 82
          ++ A++R  K ++K  +
Sbjct: 61 RAAAVKRYAKKLQKEQE 77


>gi|157964759|ref|YP_001499583.1| 30S ribosomal protein S21 [Rickettsia massiliae MTU5]
 gi|157844535|gb|ABV85036.1| 30S ribosomal protein S21 [Rickettsia massiliae MTU5]
          Length = 68

 Score = 48.7 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 36/65 (55%)

Query: 17 ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
          +  + V V   N +  L+  KKK+Q E   R++K + +YE PS KRVR   EA RR RK 
Sbjct: 1  MLVILVNVHAGNCDNTLKNFKKKLQRELYFRKMKEQRYYETPSAKRVRKAQEAARRQRKF 60

Query: 77 MRKIA 81
           RK  
Sbjct: 61 ARKKM 65


>gi|58393228|ref|XP_319913.2| AGAP009152-PA [Anopheles gambiae str. PEST]
 gi|55235489|gb|EAA14685.2| AGAP009152-PA [Anopheles gambiae str. PEST]
          Length = 87

 Score = 48.7 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  VLV++NNVE+A RVL + +  E +  + +   +YEKP Q R R+  E  +
Sbjct: 5  KFIARTVLVQNNNVEEACRVLNRILGKEEIFDQYRRTRYYEKPFQTRRRINFERCK 60


>gi|312377413|gb|EFR24246.1| hypothetical protein AND_27726 [Anopheles darlingi]
          Length = 87

 Score = 48.7 bits (115), Expect = 2e-04,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  VLV++NNVE+A RVL + +  E +  + +   +YEKP Q R R+  E  +
Sbjct: 5  KFIARTVLVQNNNVEEACRVLNRILGKEEIFDQFRRTRYYEKPFQTRRRINFERCK 60


>gi|51968394|dbj|BAD42889.1| unknown protein [Arabidopsis thaliana]
          Length = 189

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 18/63 (28%), Positives = 29/63 (46%), Gaps = 1/63 (1%)

Query: 16  EISAVYVLVRDNNVEQAL-RVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
               V V+ +D   E+ L    K+     GVL+E + R  +E   +K+ R   EA ++ R
Sbjct: 82  SYYNVEVVPKDGESEEQLVNDFKRSCFRAGVLQESRRRRFFESSLEKKTRKTKEAAKKYR 141

Query: 75  KLM 77
           K  
Sbjct: 142 KRR 144


>gi|117925072|ref|YP_865689.1| 30S ribosomal protein S21P [Magnetococcus sp. MC-1]
 gi|166224039|sp|A0L8J0|RS21_MAGSM RecName: Full=30S ribosomal protein S21
 gi|117608828|gb|ABK44283.1| SSU ribosomal protein S21P [Magnetococcus sp. MC-1]
          Length = 67

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 31/51 (60%), Positives = 40/51 (78%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
          + V V DNNV+QA+RVLKKKM  EG+ RE+K R  +EKPS++R R K+EAI
Sbjct: 1  MRVDVYDNNVDQAIRVLKKKMNREGMFREMKKRKFFEKPSERRRRKKAEAI 51


>gi|33573826|emb|CAE38134.1| 30S ribosomal protein S21 [Bordetella parapertussis]
 gi|33576577|emb|CAE33655.1| 30S ribosomal protein S21 [Bordetella bronchiseptica RB50]
          Length = 79

 Score = 48.7 bits (115), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +++N   E ALR  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R  K +
Sbjct: 10 MPIVRLKENEPFEAALRRFKRTIEKTGLLTELRSREFYEKPTAERKRKHAAAVKRHYKRI 69

Query: 78 R 78
          R
Sbjct: 70 R 70


>gi|212212055|ref|YP_002302991.1| 30S ribosomal protein S21 [Coxiella burnetii CbuG_Q212]
 gi|212219304|ref|YP_002306091.1| 30S ribosomal protein S21 [Coxiella burnetii CbuK_Q154]
 gi|215919212|ref|NP_820576.2| 30S ribosomal protein S21 [Coxiella burnetii RSA 493]
 gi|206584096|gb|AAO91090.2| SSU ribosomal protein S21P [Coxiella burnetii RSA 493]
 gi|212010465|gb|ACJ17846.1| SSU ribosomal protein S21P [Coxiella burnetii CbuG_Q212]
 gi|212013566|gb|ACJ20946.1| SSU ribosomal protein S21P [Coxiella burnetii CbuK_Q154]
          Length = 86

 Score = 48.3 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 22/77 (28%), Positives = 39/77 (50%), Gaps = 1/77 (1%)

Query: 7  FRGIFSEGREISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
                 G       + V DNN  + A+R  K+  +  G+L +L+   +YEKP+ KR R 
Sbjct: 1  MAFSHELGVNKRMPMIDVPDNNAFDVAMRRFKRACEKAGILSKLRQIEYYEKPTSKRKRK 60

Query: 66 KSEAIRRSRKLMRKIAQ 82
          ++ A++R  K ++K  +
Sbjct: 61 RAAAVKRYAKKLQKEQE 77


>gi|332975763|gb|EGK12644.1| 30S ribosomal protein S21 [Desmospora sp. 8437]
          Length = 78

 Score = 48.3 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 17 ISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          I+   V VR N  +++ALR  KK +  +G +RELK R  YEKPS KR +    A +R
Sbjct: 21 ITMAEVHVRKNESLDKALRRFKKSIAKDGTMRELKKRKFYEKPSVKRKKKSDAARKR 77


>gi|218778062|ref|YP_002429380.1| ribosomal protein S21 [Desulfatibacillum alkenivorans AK-01]
 gi|218759446|gb|ACL01912.1| ribosomal protein S21 [Desulfatibacillum alkenivorans AK-01]
          Length = 70

 Score = 48.3 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 32/67 (47%), Positives = 46/67 (68%)

Query: 17 ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
          +  + V V DN++E+A+RVLKKK+Q +G+ R LKM+  YEKPS+ R R + E++RR R  
Sbjct: 1  MKDLEVKVFDNDLEKAMRVLKKKIQNDGLFRRLKMKKAYEKPSESRRRKQRESVRRLRSA 60

Query: 77 MRKIAQR 83
           RK   R
Sbjct: 61 ARKARSR 67


>gi|296536913|ref|ZP_06898950.1| 30S ribosomal protein S21 [Roseomonas cervicalis ATCC 49957]
 gi|296262761|gb|EFH09349.1| 30S ribosomal protein S21 [Roseomonas cervicalis ATCC 49957]
          Length = 67

 Score = 48.3 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 40/66 (60%), Positives = 55/66 (83%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V+VRDNN++QAL+ LKKK+Q EGV RE+K+R HYEKPS++R R  +EA+RR+RK+ RK
Sbjct: 1  MQVVVRDNNIDQALKALKKKLQREGVFREMKLRRHYEKPSERRAREAAEAVRRARKVERK 60

Query: 80 IAQREG 85
            +REG
Sbjct: 61 RLEREG 66


>gi|254455531|ref|ZP_05068960.1| ribosomal protein S21 [Candidatus Pelagibacter sp. HTCC7211]
 gi|207082533|gb|EDZ59959.1| ribosomal protein S21 [Candidatus Pelagibacter sp. HTCC7211]
          Length = 64

 Score = 48.3 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 45/59 (76%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
          + + V+DNN+EQALRVLK+K+Q +G  + +K++  YEKPS+K+ R+  E I+R +KL +
Sbjct: 1  MKIEVKDNNIEQALRVLKRKLQRDGFFKVIKLKNTYEKPSEKKKRILQENIKRVKKLNK 59


>gi|170051458|ref|XP_001861771.1| mitochondrial 28S ribosomal protein S21 [Culex quinquefasciatus]
 gi|170073237|ref|XP_001870336.1| mitochondrial 28S ribosomal protein S21 [Culex quinquefasciatus]
 gi|167869753|gb|EDS33136.1| mitochondrial 28S ribosomal protein S21 [Culex quinquefasciatus]
 gi|167872708|gb|EDS36091.1| mitochondrial 28S ribosomal protein S21 [Culex quinquefasciatus]
          Length = 87

 Score = 48.3 bits (114), Expect = 3e-04,   Method: Composition-based stats.
 Identities = 20/56 (35%), Positives = 32/56 (57%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  VLV++NN+E+A RVL + +  E +  + +    YEKP Q R R+  E  +
Sbjct: 5  KFIARTVLVQNNNIEEACRVLNRILGKEEIFDQFRRTRFYEKPFQTRRRVNFERCK 60


>gi|227519866|ref|ZP_03949915.1| 30S ribosomal protein S21 [Enterococcus faecalis TX0104]
 gi|227553947|ref|ZP_03983994.1| 30S ribosomal protein S21 [Enterococcus faecalis HH22]
 gi|229545163|ref|ZP_04433888.1| 30S ribosomal protein S21 [Enterococcus faecalis TX1322]
 gi|229549412|ref|ZP_04438137.1| 30S ribosomal protein S21 [Enterococcus faecalis ATCC 29200]
 gi|293383574|ref|ZP_06629484.1| conserved domain protein [Enterococcus faecalis R712]
 gi|293387313|ref|ZP_06631869.1| conserved domain protein [Enterococcus faecalis S613]
 gi|307270827|ref|ZP_07552115.1| ribosomal protein S21 [Enterococcus faecalis TX4248]
 gi|307271522|ref|ZP_07552794.1| ribosomal protein S21 [Enterococcus faecalis TX0855]
 gi|307277150|ref|ZP_07558254.1| ribosomal protein S21 [Enterococcus faecalis TX2134]
 gi|307285802|ref|ZP_07565936.1| ribosomal protein S21 [Enterococcus faecalis TX0860]
 gi|307287705|ref|ZP_07567748.1| ribosomal protein S21 [Enterococcus faecalis TX0109]
 gi|307290532|ref|ZP_07570444.1| ribosomal protein S21 [Enterococcus faecalis TX0411]
 gi|312905138|ref|ZP_07764259.1| ribosomal protein S21 [Enterococcus faecalis TX0635]
 gi|312906124|ref|ZP_07765136.1| ribosomal protein S21 [Enterococcus faecalis DAPTO 512]
 gi|312909470|ref|ZP_07768325.1| ribosomal protein S21 [Enterococcus faecalis DAPTO 516]
 gi|312953495|ref|ZP_07772335.1| ribosomal protein S21 [Enterococcus faecalis TX0102]
 gi|227072660|gb|EEI10623.1| 30S ribosomal protein S21 [Enterococcus faecalis TX0104]
 gi|227176933|gb|EEI57905.1| 30S ribosomal protein S21 [Enterococcus faecalis HH22]
 gi|229305649|gb|EEN71645.1| 30S ribosomal protein S21 [Enterococcus faecalis ATCC 29200]
 gi|229309708|gb|EEN75695.1| 30S ribosomal protein S21 [Enterococcus faecalis TX1322]
 gi|291079086|gb|EFE16450.1| conserved domain protein [Enterococcus faecalis R712]
 gi|291083211|gb|EFE20174.1| conserved domain protein [Enterococcus faecalis S613]
 gi|306498387|gb|EFM67892.1| ribosomal protein S21 [Enterococcus faecalis TX0411]
 gi|306501443|gb|EFM70746.1| ribosomal protein S21 [Enterococcus faecalis TX0109]
 gi|306502563|gb|EFM71830.1| ribosomal protein S21 [Enterococcus faecalis TX0860]
 gi|306506080|gb|EFM75246.1| ribosomal protein S21 [Enterococcus faecalis TX2134]
 gi|306511794|gb|EFM80792.1| ribosomal protein S21 [Enterococcus faecalis TX0855]
 gi|306512828|gb|EFM81472.1| ribosomal protein S21 [Enterococcus faecalis TX4248]
 gi|310627770|gb|EFQ11053.1| ribosomal protein S21 [Enterococcus faecalis DAPTO 512]
 gi|310628704|gb|EFQ11987.1| ribosomal protein S21 [Enterococcus faecalis TX0102]
 gi|310631528|gb|EFQ14811.1| ribosomal protein S21 [Enterococcus faecalis TX0635]
 gi|311290143|gb|EFQ68699.1| ribosomal protein S21 [Enterococcus faecalis DAPTO 516]
 gi|315025397|gb|EFT37329.1| ribosomal protein S21 [Enterococcus faecalis TX2137]
 gi|315030205|gb|EFT42137.1| ribosomal protein S21 [Enterococcus faecalis TX4000]
 gi|315032909|gb|EFT44841.1| ribosomal protein S21 [Enterococcus faecalis TX0017]
 gi|315035607|gb|EFT47539.1| ribosomal protein S21 [Enterococcus faecalis TX0027]
 gi|315144799|gb|EFT88815.1| ribosomal protein S21 [Enterococcus faecalis TX2141]
 gi|315146691|gb|EFT90707.1| ribosomal protein S21 [Enterococcus faecalis TX4244]
 gi|315152162|gb|EFT96178.1| ribosomal protein S21 [Enterococcus faecalis TX0031]
 gi|315155349|gb|EFT99365.1| ribosomal protein S21 [Enterococcus faecalis TX0043]
 gi|315159075|gb|EFU03092.1| ribosomal protein S21 [Enterococcus faecalis TX0312]
 gi|315161667|gb|EFU05684.1| ribosomal protein S21 [Enterococcus faecalis TX0645]
 gi|315164804|gb|EFU08821.1| ribosomal protein S21 [Enterococcus faecalis TX1302]
 gi|315166390|gb|EFU10407.1| ribosomal protein S21 [Enterococcus faecalis TX1341]
 gi|315173679|gb|EFU17696.1| ribosomal protein S21 [Enterococcus faecalis TX1346]
 gi|315574352|gb|EFU86543.1| ribosomal protein S21 [Enterococcus faecalis TX0309B]
 gi|315579034|gb|EFU91225.1| ribosomal protein S21 [Enterococcus faecalis TX0630]
 gi|315580173|gb|EFU92364.1| ribosomal protein S21 [Enterococcus faecalis TX0309A]
 gi|327535701|gb|AEA94535.1| 30S ribosomal protein S21 [Enterococcus faecalis OG1RF]
 gi|329572228|gb|EGG53888.1| ribosomal protein S21 [Enterococcus faecalis TX1467]
          Length = 79

 Score = 48.3 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 36/67 (53%)

Query: 8  RGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKS 67
            + SEG    +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR +   
Sbjct: 12 YFLSSEGGNNMSKTVVRKNESLDDALRRFKRSVSKAGTLQESRKREFYEKPSVKRKKKSE 71

Query: 68 EAIRRSR 74
           A +R +
Sbjct: 72 AARKRKK 78


>gi|220904361|ref|YP_002479673.1| 30S ribosomal protein S21 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. ATCC 27774]
 gi|254813612|sp|B8IZR8|RS21_DESDA RecName: Full=30S ribosomal protein S21
 gi|219868660|gb|ACL48995.1| ribosomal protein S21 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. ATCC 27774]
          Length = 67

 Score = 48.3 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 40/64 (62%)

Query: 17 ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
          +  V++   D N + ALR  KK+++  G+L E+K R HYEKPS  R + K+ A +R  K 
Sbjct: 1  MPGVFLNEDDYNFDIALRRFKKQVEKAGILSEMKKRQHYEKPSVMRKKKKAAARKRLMKK 60

Query: 77 MRKI 80
          +RK+
Sbjct: 61 IRKM 64


>gi|85860501|ref|YP_462703.1| 30S ribosomal protein S21P [Syntrophus aciditrophicus SB]
 gi|119367329|sp|Q2LWS7|RS21_SYNAS RecName: Full=30S ribosomal protein S21
 gi|85723592|gb|ABC78535.1| SSU ribosomal protein S21P [Syntrophus aciditrophicus SB]
          Length = 63

 Score = 48.3 bits (114), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 30/61 (49%), Positives = 41/61 (67%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V V DN+VE+AL++LK K+   G+ +ELK+R  YEKPS KR R   EA RR  K+ R+
Sbjct: 1  MEVKVFDNDVEKALKILKNKLSKSGLFKELKVRRAYEKPSVKRKRKAIEARRRFAKVQRR 60

Query: 80 I 80
           
Sbjct: 61 R 61


>gi|317484457|ref|ZP_07943369.1| ribosomal protein S21 [Bilophila wadsworthia 3_1_6]
 gi|316924281|gb|EFV45455.1| ribosomal protein S21 [Bilophila wadsworthia 3_1_6]
          Length = 67

 Score = 48.0 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 26/64 (40%), Positives = 40/64 (62%)

Query: 17 ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
          +  V++   D N + ALR  KK+++  G+L E+K R H+EKPS  R + K+ A +R  K 
Sbjct: 1  MPGVFLNEDDYNFDIALRRFKKQVEKAGILSEMKKRQHFEKPSVMRKKKKAAARKRLLKK 60

Query: 77 MRKI 80
          MRK+
Sbjct: 61 MRKM 64


>gi|153810793|ref|ZP_01963461.1| hypothetical protein RUMOBE_01177 [Ruminococcus obeum ATCC 29174]
 gi|149833189|gb|EDM88271.1| hypothetical protein RUMOBE_01177 [Ruminococcus obeum ATCC 29174]
          Length = 95

 Score = 48.0 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 9  GIFSEGREISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKS 67
            + E R  S   V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +   
Sbjct: 28 YNWREVRCESMSNVIVKENETLDSALRRFKRSCAKAGIQQEIRKREHYEKPSVRRKKKSE 87

Query: 68 EAIRR 72
           A +R
Sbjct: 88 AARKR 92


>gi|161598449|ref|YP_180020.2| 30S ribosomal protein S21 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|161598456|ref|YP_197025.2| 30S ribosomal protein S21 [Ehrlichia ruminantium str.
          Welgevonden]
 gi|161986612|ref|YP_196071.2| 30S ribosomal protein S21 [Ehrlichia ruminantium str. Gardel]
          Length = 95

 Score = 48.0 bits (113), Expect = 4e-04,   Method: Composition-based stats.
 Identities = 28/60 (46%), Positives = 41/60 (68%), Gaps = 1/60 (1%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           V V+V   ++EQ +R LKKK+Q EG  R++K+  H+EKPS+KR R K +  RR +KL +
Sbjct: 1  MVEVIVYHGDIEQGIRTLKKKLQREGKPRQMKI-THHEKPSEKRARKKDDCERRRKKLHK 59


>gi|71083283|ref|YP_266002.1| 30S ribosomal protein S21 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|91762287|ref|ZP_01264252.1| 30S ribosomal protein S21 [Candidatus Pelagibacter ubique
          HTCC1002]
 gi|119367286|sp|Q4FN40|RS21_PELUB RecName: Full=30S ribosomal protein S21
 gi|71062396|gb|AAZ21399.1| 30S ribosomal protein S21 [Candidatus Pelagibacter ubique
          HTCC1062]
 gi|91718089|gb|EAS84739.1| 30S ribosomal protein S21 [Candidatus Pelagibacter ubique
          HTCC1002]
          Length = 64

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/59 (47%), Positives = 45/59 (76%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
          + + V+DNN+EQALRVLK+K+Q +G  + +K++  YEKPS+K+ R+  E I+R +KL +
Sbjct: 1  MKIEVKDNNIEQALRVLKRKLQRDGFFKVVKLKSVYEKPSEKKKRILQENIKRVKKLNK 59


>gi|157826011|ref|YP_001493731.1| 30S ribosomal protein S21 [Rickettsia akari str. Hartford]
 gi|166224063|sp|A8GP98|RS21_RICAH RecName: Full=30S ribosomal protein S21
 gi|157799969|gb|ABV75223.1| 30S ribosomal protein S21 [Rickettsia akari str. Hartford]
          Length = 66

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/63 (44%), Positives = 35/63 (55%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + V V   N +  LR  KKK+Q E   R++K + +YE PS KRVR   EA RR RK  R
Sbjct: 1  MILVNVHAGNCDNTLRNFKKKLQRELYFRKMKEQRYYETPSAKRVRKAQEAARRQRKFAR 60

Query: 79 KIA 81
          K  
Sbjct: 61 KKM 63


>gi|52842568|ref|YP_096367.1| 30S ribosomal protein S21 [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|54295200|ref|YP_127615.1| 30S ribosomal protein S21 [Legionella pneumophila str. Lens]
 gi|54298249|ref|YP_124618.1| 30S ribosomal protein S21 [Legionella pneumophila str. Paris]
 gi|148359899|ref|YP_001251106.1| 30S ribosomal protein S21 [Legionella pneumophila str. Corby]
 gi|296107950|ref|YP_003619651.1| small subunit ribosomal protein S21 [Legionella pneumophila
          2300/99 Alcoy]
 gi|81679152|sp|Q5WU88|RS21_LEGPL RecName: Full=30S ribosomal protein S21
 gi|81679408|sp|Q5X2T0|RS21_LEGPA RecName: Full=30S ribosomal protein S21
 gi|81680406|sp|Q5ZT07|RS21_LEGPH RecName: Full=30S ribosomal protein S21
 gi|166224038|sp|A5IEG0|RS21_LEGPC RecName: Full=30S ribosomal protein S21
 gi|52629679|gb|AAU28420.1| 30S ribosomal protein S21 [Legionella pneumophila subsp.
          pneumophila str. Philadelphia 1]
 gi|53752034|emb|CAH13460.1| 30S ribosomal protein S21 [Legionella pneumophila str. Paris]
 gi|53755032|emb|CAH16520.1| 30S ribosomal protein S21 [Legionella pneumophila str. Lens]
 gi|148281672|gb|ABQ55760.1| 30S ribosomal protein S21 [Legionella pneumophila str. Corby]
 gi|295649852|gb|ADG25699.1| small subunit ribosomal protein S21 [Legionella pneumophila
          2300/99 Alcoy]
 gi|307611205|emb|CBX00851.1| 30S ribosomal protein S21 [Legionella pneumophila 130b]
          Length = 79

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 1/76 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++  N E ALR  K+  +  G+L EL+ R  YEKP+ +R R ++ A++R  K +
Sbjct: 1  MPTVRVKEGENPEYALRRFKRSCEKAGILTELRRREFYEKPTAERKRKQAAAVKRHLKKI 60

Query: 78 RKIAQREGAPVSRLRQ 93
           +          R ++
Sbjct: 61 SRDVSSRRGVGHRRKK 76


>gi|302877606|ref|YP_003846170.1| 30S ribosomal protein S21 [Gallionella capsiferriformans ES-2]
 gi|302580395|gb|ADL54406.1| ribosomal protein S21 [Gallionella capsiferriformans ES-2]
          Length = 70

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   E A+R  K+ ++  G+L +L+ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MTTVRVKENEPFEVAMRRFKRSVEKTGLLTDLRAREFYEKPTAERKRKLAAAVKRHYKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|15604464|ref|NP_220982.1| 30S ribosomal protein S21 [Rickettsia prowazekii str. Madrid E]
 gi|51473793|ref|YP_067550.1| 30S ribosomal protein S21 [Rickettsia typhi str. Wilmington]
 gi|6226095|sp|Q9ZCU6|RS21_RICPR RecName: Full=30S ribosomal protein S21
 gi|61215891|sp|Q68WC4|RS21_RICTY RecName: Full=30S ribosomal protein S21
 gi|3861158|emb|CAA15058.1| RIBOSOMAL PROTEIN S21 (rpsU) [Rickettsia prowazekii]
 gi|51460105|gb|AAU04068.1| 30S ribosomal protein S21 [Rickettsia typhi str. Wilmington]
 gi|292572239|gb|ADE30154.1| 30S ribosomal protein S21 [Rickettsia prowazekii Rp22]
          Length = 66

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 28/66 (42%), Positives = 36/66 (54%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + V V   N +  L+  KKK+Q E   R++K + +YE PS KRVR   EA RR RK  R
Sbjct: 1  MILVNVHAGNCDNTLKNFKKKLQRELYFRKMKEQRYYETPSAKRVRKAQEAARRIRKFAR 60

Query: 79 KIAQRE 84
          K    E
Sbjct: 61 KKMYEE 66


>gi|312899845|ref|ZP_07759164.1| ribosomal protein S21 [Enterococcus faecalis TX0470]
 gi|311293095|gb|EFQ71651.1| ribosomal protein S21 [Enterococcus faecalis TX0470]
 gi|315170286|gb|EFU14303.1| ribosomal protein S21 [Enterococcus faecalis TX1342]
          Length = 79

 Score = 48.0 bits (113), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 36/67 (53%)

Query: 8  RGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKS 67
            + SEG    +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR +   
Sbjct: 12 YFLSSEGGNNMSKTVVRKNESLDDALRRFKRSVSKAGTLQESRKREFYEKPSVKRKKKSE 71

Query: 68 EAIRRSR 74
           A +R +
Sbjct: 72 AARKRKK 78


>gi|270158975|ref|ZP_06187631.1| ribosomal protein S21 [Legionella longbeachae D-4968]
 gi|289166182|ref|YP_003456320.1| 30S ribosomal protein S21 [Legionella longbeachae NSW150]
 gi|269987314|gb|EEZ93569.1| ribosomal protein S21 [Legionella longbeachae D-4968]
 gi|288859355|emb|CBJ13291.1| 30S ribosomal protein S21 [Legionella longbeachae NSW150]
          Length = 76

 Score = 47.6 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 25/76 (32%), Positives = 40/76 (52%), Gaps = 1/76 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++  N E ALR  K+  +  G+L EL+ R  YEKP+ +R R ++ A++R  K +
Sbjct: 1  MPTVRVKEGENPEYALRRFKRSCEKAGILTELRRREFYEKPTAERKRKQAAAVKRHLKKI 60

Query: 78 RKIAQREGAPVSRLRQ 93
           + A        R R+
Sbjct: 61 SRDASARQQGSKRRRK 76


>gi|157803520|ref|YP_001492069.1| 30S ribosomal protein S21 [Rickettsia canadensis str. McKiel]
 gi|157828803|ref|YP_001495045.1| 30S ribosomal protein S21 [Rickettsia rickettsii str. 'Sheila
          Smith']
 gi|165933529|ref|YP_001650318.1| 30S ribosomal protein S21 [Rickettsia rickettsii str. Iowa]
 gi|238651069|ref|YP_002916927.1| 30S ribosomal protein S21 [Rickettsia peacockii str. Rustic]
 gi|166224064|sp|A8EY51|RS21_RICCK RecName: Full=30S ribosomal protein S21
 gi|166224065|sp|A8GT12|RS21_RICRS RecName: Full=30S ribosomal protein S21
 gi|189044910|sp|B0BUK2|RS21_RICRO RecName: Full=30S ribosomal protein S21
 gi|259494893|sp|C4K2S8|RS21_RICPU RecName: Full=30S ribosomal protein S21
 gi|157784783|gb|ABV73284.1| 30S ribosomal protein S21 [Rickettsia canadensis str. McKiel]
 gi|157801284|gb|ABV76537.1| 30S ribosomal protein S21 [Rickettsia rickettsii str. 'Sheila
          Smith']
 gi|165908616|gb|ABY72912.1| SSU ribosomal protein S21P [Rickettsia rickettsii str. Iowa]
 gi|238625167|gb|ACR47873.1| 30S ribosomal protein S21 [Rickettsia peacockii str. Rustic]
          Length = 66

 Score = 47.6 bits (112), Expect = 5e-04,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 35/63 (55%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + V V   N +  L+  KKK+Q E   R++K + +YE PS KRVR   EA RR RK  R
Sbjct: 1  MILVNVHAGNCDNTLKNFKKKLQRELYFRKMKEQRYYETPSAKRVRKAQEAARRQRKFAR 60

Query: 79 KIA 81
          K  
Sbjct: 61 KKM 63


>gi|222474891|ref|YP_002563306.1| 30s ribosomal protein s21 (rpsU) [Anaplasma marginale str.
          Florida]
 gi|56387755|gb|AAV86342.1| 30s ribosomal protein s21 [Anaplasma marginale str. St. Maries]
 gi|222419027|gb|ACM49050.1| 30s ribosomal protein s21 (rpsU) [Anaplasma marginale str.
          Florida]
          Length = 92

 Score = 47.6 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 29/62 (46%), Positives = 42/62 (67%), Gaps = 1/62 (1%)

Query: 15 REISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          R  S V V+V   ++EQ +R LKKK+Q EG  R++K+  H+EKPS+KR R + +  RR +
Sbjct: 2  RGFSLVEVVVYHGDIEQGIRTLKKKLQREGKPRQMKI-THHEKPSEKRARKRDDCERRRK 60

Query: 75 KL 76
          KL
Sbjct: 61 KL 62


>gi|34499220|ref|NP_903435.1| 30S ribosomal protein S21 [Chromobacterium violaceum ATCC 12472]
 gi|61216010|sp|Q7NRL5|RS21_CHRVO RecName: Full=30S ribosomal protein S21
 gi|34105071|gb|AAQ61427.1| 30S ribosomal protein S21 [Chromobacterium violaceum ATCC 12472]
          Length = 70

 Score = 47.6 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E ALR  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPTIRVKENEPFEVALRRFKRAVEKTGLLTELRAREFYEKPTTERKRKHAAAVKRHYKRI 60

Query: 78 RKIA 81
          R   
Sbjct: 61 RSQM 64


>gi|319789503|ref|YP_004151136.1| ribosomal protein S21 [Thermovibrio ammonificans HB-1]
 gi|317114005|gb|ADU96495.1| ribosomal protein S21 [Thermovibrio ammonificans HB-1]
          Length = 75

 Score = 47.6 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VRD    E+AL+  KK  + EG+L E+K R +YEKPS+KR R    A +R  K +
Sbjct: 1  MATVYVRDGEPFEKALKRFKKLCEREGILTEIKRREYYEKPSEKRKRKAMAARKRLIKAL 60

Query: 78 RKI 80
          +K 
Sbjct: 61 KKR 63


>gi|121997889|ref|YP_001002676.1| 30S ribosomal protein S21 [Halorhodospira halophila SL1]
 gi|166224033|sp|A1WW12|RS21_HALHL RecName: Full=30S ribosomal protein S21
 gi|121589294|gb|ABM61874.1| SSU ribosomal protein S21P [Halorhodospira halophila SL1]
          Length = 71

 Score = 47.6 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 27/71 (38%), Positives = 40/71 (56%), Gaps = 1/71 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   E ALR  K+  +  GVL E++ R +YEKP+Q R R ++ A++R  K +
Sbjct: 1  MPIVKVRENEPFEVALRRFKRSCEKAGVLSEIRRREYYEKPTQVRKRKQAAAVKRHMKRL 60

Query: 78 RKIAQREGAPV 88
           +  QR   P 
Sbjct: 61 NREQQRRQRPY 71


>gi|325294983|ref|YP_004281497.1| 30S ribosomal protein S21 [Desulfurobacterium thermolithotrophum
          DSM 11699]
 gi|325065431|gb|ADY73438.1| 30S ribosomal protein S21 [Desulfurobacterium thermolithotrophum
          DSM 11699]
          Length = 74

 Score = 47.6 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VRD    E+AL+  KK  + EG+L E+K R +YEKPS+KR R    A +R  K +
Sbjct: 1  MATVYVRDGEPFEKALKRFKKLCEKEGILTEIKRREYYEKPSEKRKRKAMAARKRLIKAL 60

Query: 78 RKI 80
          +K 
Sbjct: 61 KKR 63


>gi|73666782|ref|YP_302798.1| 30S ribosomal protein S21 [Ehrlichia canis str. Jake]
 gi|72393923|gb|AAZ68200.1| hypothetical protein Ecaj_0149 [Ehrlichia canis str. Jake]
          Length = 91

 Score = 47.6 bits (112), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 28/60 (46%), Positives = 41/60 (68%), Gaps = 1/60 (1%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           V V+V   ++EQ +R LKKK+Q EG  R++K+  H+EKPS+KR R K +  RR +KL +
Sbjct: 1  MVEVIVYHGDIEQGIRTLKKKLQREGKPRQMKI-THHEKPSEKRARKKDDCERRRKKLHK 59


>gi|88810994|ref|ZP_01126250.1| 30S ribosomal subunit protein S21 [Nitrococcus mobilis Nb-231]
 gi|88791533|gb|EAR22644.1| 30S ribosomal subunit protein S21 [Nitrococcus mobilis Nb-231]
          Length = 71

 Score = 47.6 bits (112), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 25/67 (37%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   E ALR  K+  +  G+L E++ R HYEKP+Q R R ++ A++R  K +
Sbjct: 1  MPQVKVRENEPFEVALRRFKRSCEKAGILSEIRRREHYEKPTQVRKRKQAAAVKRHLKRL 60

Query: 78 RKIAQRE 84
          ++   R 
Sbjct: 61 QREQLRR 67


>gi|91776677|ref|YP_546433.1| SSU ribosomal protein S21P [Methylobacillus flagellatus KT]
 gi|119367274|sp|Q1GYU5|RS21_METFK RecName: Full=30S ribosomal protein S21
 gi|91710664|gb|ABE50592.1| SSU ribosomal protein S21P [Methylobacillus flagellatus KT]
          Length = 70

 Score = 47.2 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+ ++  G+L +L+ R +YEKP+ +R R  + A++R  + +
Sbjct: 1  MSSVRVKENEPFDVALRRFKRMIEKTGLLTDLRAREYYEKPTWERKRKAAAAVKRHYRRI 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|225849699|ref|YP_002729933.1| 30S ribosomal protein S21 [Persephonella marina EX-H1]
 gi|254813726|sp|C0QTB8|RS21_PERMH RecName: Full=30S ribosomal protein S21
 gi|225645474|gb|ACO03660.1| ribosomal protein S21 [Persephonella marina EX-H1]
          Length = 66

 Score = 47.2 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 25/63 (39%), Positives = 37/63 (58%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           AV V+    + E+AL+  KK  + EG++ E+K R  YEKPS KR R +  A +R  K +
Sbjct: 1  MAVVVVQEGESFEKALKRFKKICEKEGIITEMKRREFYEKPSVKRKRKQRAARKRLIKAL 60

Query: 78 RKI 80
          +K 
Sbjct: 61 KKK 63


>gi|15892872|ref|NP_360586.1| 30S ribosomal protein S21 [Rickettsia conorii str. Malish 7]
 gi|34581423|ref|ZP_00142903.1| 30S ribosomal protein S21 [Rickettsia sibirica 246]
 gi|229586960|ref|YP_002845461.1| 30S ribosomal protein S21 [Rickettsia africae ESF-5]
 gi|20140111|sp|Q92H23|RS21_RICCN RecName: Full=30S ribosomal protein S21
 gi|259494892|sp|C3PP58|RS21_RICAE RecName: Full=30S ribosomal protein S21
 gi|15620060|gb|AAL03487.1| 30S ribosomal protein S21 [Rickettsia conorii str. Malish 7]
 gi|28262808|gb|EAA26312.1| 30S ribosomal protein S21 [Rickettsia sibirica 246]
 gi|228022010|gb|ACP53718.1| 30S ribosomal protein S21 [Rickettsia africae ESF-5]
          Length = 66

 Score = 47.2 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 35/63 (55%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + V V   N +  L+  KKK+Q E   R++K + +YE PS KRVR   EA RR RK  R
Sbjct: 1  MILVNVHAGNCDNTLKNFKKKLQRELYFRKMKEQRYYETPSAKRVRKVQEAARRQRKFAR 60

Query: 79 KIA 81
          K  
Sbjct: 61 KKM 63


>gi|291614902|ref|YP_003525059.1| ribosomal protein S21 [Sideroxydans lithotrophicus ES-1]
 gi|291585014|gb|ADE12672.1| ribosomal protein S21 [Sideroxydans lithotrophicus ES-1]
          Length = 70

 Score = 47.2 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MTTVRVKENEPFEVAMRRFKRSVEKTGLLTELRAREFYEKPTAERKRKLAAAVKRHYKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|218885602|ref|YP_002434923.1| 30S ribosomal protein S21 [Desulfovibrio vulgaris str. 'Miyazaki
          F']
 gi|226694997|sp|B8DKM6|RS21_DESVM RecName: Full=30S ribosomal protein S21
 gi|218756556|gb|ACL07455.1| ribosomal protein S21 [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 67

 Score = 47.2 bits (111), Expect = 7e-04,   Method: Composition-based stats.
 Identities = 27/64 (42%), Positives = 40/64 (62%)

Query: 17 ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
          +  VY+   + N + ALR  KK+++  GVL E+K R HYEKPS  R + K+ A +R  K 
Sbjct: 1  MPGVYLNDDEYNFDIALRRFKKQVEKAGVLSEMKKRQHYEKPSVMRKKKKAAARKRLLKK 60

Query: 77 MRKI 80
          +RK+
Sbjct: 61 IRKM 64


>gi|220936175|ref|YP_002515074.1| ribosomal protein S21 [Thioalkalivibrio sp. HL-EbGR7]
 gi|254764440|sp|B8GPU0|RS21_THISH RecName: Full=30S ribosomal protein S21
 gi|219997485|gb|ACL74087.1| ribosomal protein S21 [Thioalkalivibrio sp. HL-EbGR7]
          Length = 71

 Score = 47.2 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
            +V V++N   E ALR  K+  +  GVL E++ R  YEKP++ R R  + A++R  K +
Sbjct: 1  MPHVRVKENEPFEVALRRFKRTCEKAGVLTEVRRREFYEKPTEIRKRKAAAAVKRQAKRV 60

Query: 78 RKIAQRE 84
           K   R 
Sbjct: 61 SKEVARR 67


>gi|30248250|ref|NP_840320.1| 30S ribosomal protein S21 [Nitrosomonas europaea ATCC 19718]
 gi|114330324|ref|YP_746546.1| 30S ribosomal protein S21 [Nitrosomonas eutropha C91]
 gi|81722250|sp|Q82XN1|RS21_NITEU RecName: Full=30S ribosomal protein S21
 gi|122314635|sp|Q0AJ90|RS21_NITEC RecName: Full=30S ribosomal protein S21
 gi|30180135|emb|CAD84137.1| Ribosomal protein S21 [Nitrosomonas europaea ATCC 19718]
 gi|114307338|gb|ABI58581.1| SSU ribosomal protein S21P [Nitrosomonas eutropha C91]
          Length = 70

 Score = 47.2 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 22/64 (34%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   E A+R  K+ ++  G+L EL+ R  YEKP+  R R  + A++R+ K +
Sbjct: 1  MTTVKVKENEPFEIAMRRFKRSIEKTGLLTELRAREFYEKPTAVRKRKHAAAVKRTYKRL 60

Query: 78 RKIA 81
          R   
Sbjct: 61 RSQM 64


>gi|307189560|gb|EFN73930.1| 28S ribosomal protein S21, mitochondrial [Camponotus floridanus]
          Length = 90

 Score = 47.2 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 32/56 (57%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  +  + V++N+V++A R+L + +  E +  + +   +YEKP+  R R+  E  +
Sbjct: 8  QFISRTIFVQNNDVDKACRILNRILSKEEIFGQYRRTRYYEKPTYARRRINFEKCK 63


>gi|239948239|ref|ZP_04699992.1| ribosomal protein S21 [Rickettsia endosymbiont of Ixodes
          scapularis]
 gi|239922515|gb|EER22539.1| ribosomal protein S21 [Rickettsia endosymbiont of Ixodes
          scapularis]
          Length = 66

 Score = 47.2 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 35/63 (55%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + V V   N +  L+  KKK+Q E   R++K + +YE PS KR+R   EA RR RK  R
Sbjct: 1  MILVNVHAGNCDNTLKNFKKKLQRELYFRKMKEQRYYETPSAKRIRKAQEAARRQRKFAR 60

Query: 79 KIA 81
          K  
Sbjct: 61 KKM 63


>gi|196004917|ref|XP_002112325.1| hypothetical protein TRIADDRAFT_25208 [Trichoplax adhaerens]
 gi|190584366|gb|EDV24435.1| hypothetical protein TRIADDRAFT_25208 [Trichoplax adhaerens]
          Length = 85

 Score = 47.2 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 34/65 (52%)

Query: 17 ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
            A  V VR+N +E   + L++ +  E + ++++ + +YEKP+ KR RL+ E   R    
Sbjct: 7  FLARTVFVRNNAIEAGYKSLQRILNREWIPQKVERKRYYEKPTVKRRRLEHEKCNRILLR 66

Query: 77 MRKIA 81
            K  
Sbjct: 67 ESKKR 71


>gi|68171550|ref|ZP_00544928.1| hypothetical protein EchaDRAFT_0333 [Ehrlichia chaffeensis str.
          Sapulpa]
 gi|88658072|ref|YP_507765.1| 30S ribosomal protein S21 [Ehrlichia chaffeensis str. Arkansas]
 gi|67999034|gb|EAM85707.1| hypothetical protein EchaDRAFT_0333 [Ehrlichia chaffeensis str.
          Sapulpa]
 gi|88599529|gb|ABD44998.1| ribosomal protein S21 [Ehrlichia chaffeensis str. Arkansas]
          Length = 90

 Score = 47.2 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 28/60 (46%), Positives = 41/60 (68%), Gaps = 1/60 (1%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           V V+V   ++EQ +R LKKK+Q EG  R++K+  H+EKPS+KR R K +  RR +KL +
Sbjct: 1  MVEVIVYHGDIEQGIRTLKKKLQREGKPRQMKI-THHEKPSEKRARKKDDCERRRKKLHK 59


>gi|254000084|ref|YP_003052147.1| 30S ribosomal protein S21 [Methylovorus sp. SIP3-4]
 gi|313202043|ref|YP_004040701.1| 30S ribosomal protein S21 [Methylovorus sp. MP688]
 gi|253986763|gb|ACT51620.1| ribosomal protein S21 [Methylovorus sp. SIP3-4]
 gi|312441359|gb|ADQ85465.1| ribosomal protein S21 [Methylovorus sp. MP688]
          Length = 70

 Score = 47.2 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+ ++  G+L +L+ R  YEKP+ +R R  + A++R  + +
Sbjct: 1  MSSVRVKENEPFDVALRRFKRMIEKTGLLTDLRAREFYEKPTWERKRKAAAAVKRHYRRI 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|288941557|ref|YP_003443797.1| 30S ribosomal protein S21 [Allochromatium vinosum DSM 180]
 gi|288896929|gb|ADC62765.1| ribosomal protein S21 [Allochromatium vinosum DSM 180]
          Length = 71

 Score = 47.2 bits (111), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 25/71 (35%), Positives = 42/71 (59%), Gaps = 1/71 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   E A+R  K+  +  GVL E++ R  YEKP+ +R R K+ A++R +K +
Sbjct: 1  MPSVRVKENEPFEVAMRRFKRSCEKAGVLAEVRRREFYEKPTSERKRKKAAAVKRHQKKL 60

Query: 78 RKIAQREGAPV 88
          ++ A+R   P 
Sbjct: 61 QREARRWERPY 71


>gi|195146140|ref|XP_002014048.1| GL23067 [Drosophila persimilis]
 gi|198451494|ref|XP_002137310.1| GA27131 [Drosophila pseudoobscura pseudoobscura]
 gi|194102991|gb|EDW25034.1| GL23067 [Drosophila persimilis]
 gi|198131513|gb|EDY67868.1| GA27131 [Drosophila pseudoobscura pseudoobscura]
          Length = 87

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  VLV++NNVE+A R+L + +  E +L + +    YEKP Q R R+  E  +
Sbjct: 5  QFLARTVLVQNNNVEEACRMLNRVLGKEEILDQFRRTRFYEKPYQVRRRVNFEKCK 60


>gi|194901478|ref|XP_001980279.1| GG17058 [Drosophila erecta]
 gi|195500783|ref|XP_002097522.1| GE24447 [Drosophila yakuba]
 gi|190651982|gb|EDV49237.1| GG17058 [Drosophila erecta]
 gi|194183623|gb|EDW97234.1| GE24447 [Drosophila yakuba]
          Length = 87

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  VLV++NNVE+A R+L + +  E +L + +    YEKP Q R R+  E  +
Sbjct: 5  QFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQVRRRINFEKCK 60


>gi|114321666|ref|YP_743349.1| 30S ribosomal protein S21 [Alkalilimnicola ehrlichii MLHE-1]
 gi|119367233|sp|Q0A5M8|RS21_ALHEH RecName: Full=30S ribosomal protein S21
 gi|114228060|gb|ABI57859.1| SSU ribosomal protein S21P [Alkalilimnicola ehrlichii MLHE-1]
          Length = 71

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 1/71 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   E ALR  K+  +  GVL E++ R HYEKP+Q+R R  + A++R  K +
Sbjct: 1  MPIVKVRENEPFEVALRRFKRSCEKAGVLSEIRRREHYEKPTQERKRKAAAAVKRHMKRL 60

Query: 78 RKIAQREGAPV 88
           +   R     
Sbjct: 61 SREQARRRRLY 71


>gi|194741236|ref|XP_001953095.1| GF17387 [Drosophila ananassae]
 gi|190626154|gb|EDV41678.1| GF17387 [Drosophila ananassae]
          Length = 87

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  VLV++NNVE+A R+L + +  E +L + +    YEKP Q R R+  E  +
Sbjct: 5  QFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQVRRRINFEKCK 60


>gi|24646553|ref|NP_731803.1| mitochondrial ribosomal protein S21 [Drosophila melanogaster]
 gi|195329278|ref|XP_002031338.1| GM25944 [Drosophila sechellia]
 gi|195571165|ref|XP_002103574.1| GD20504 [Drosophila simulans]
 gi|23171167|gb|AAN13563.1| mitochondrial ribosomal protein S21 [Drosophila melanogaster]
 gi|25012453|gb|AAN71332.1| RE23482p [Drosophila melanogaster]
 gi|194120281|gb|EDW42324.1| GM25944 [Drosophila sechellia]
 gi|194199501|gb|EDX13077.1| GD20504 [Drosophila simulans]
 gi|220950770|gb|ACL87928.1| mRpS21-PA [synthetic construct]
 gi|220959562|gb|ACL92324.1| mRpS21-PA [synthetic construct]
          Length = 87

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 33/56 (58%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  VLV++NNVE+A R+L + +  E +L + +    YEKP Q R R+  E  +
Sbjct: 5  QFLARTVLVQNNNVEEACRLLNRVLGKEELLDQFRRTRFYEKPYQVRRRINFEKCK 60


>gi|153875272|ref|ZP_02003147.1| Ribosomal protein S21 [Beggiatoa sp. PS]
 gi|152068263|gb|EDN66852.1| Ribosomal protein S21 [Beggiatoa sp. PS]
          Length = 72

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             V V++N   E A+R  K+  +  G+L E+  R  YEKP+  R R  + A++R  K
Sbjct: 1  MPQVRVKENEPFEIAMRRFKRACEKAGILAEVHRREFYEKPTTIRKRKAAAAVKRHLK 58


>gi|261856517|ref|YP_003263800.1| ribosomal protein S21 [Halothiobacillus neapolitanus c2]
 gi|261836986|gb|ACX96753.1| ribosomal protein S21 [Halothiobacillus neapolitanus c2]
          Length = 71

 Score = 46.8 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VRDN   E A+R  K+  +  G++ EL+ R  YEKP+ +R R  + A++R++K +
Sbjct: 1  MPSVRVRDNEPFEVAVRRFKRSCEKAGIISELREREFYEKPTTERKRKNAAAVKRNQKRL 60

Query: 78 RKIAQRE 84
           K   R 
Sbjct: 61 SKEQSRR 67


>gi|257092098|ref|YP_003165739.1| 30S ribosomal protein S21 [Candidatus Accumulibacter phosphatis
          clade IIA str. UW-1]
 gi|257044622|gb|ACV33810.1| ribosomal protein S21 [Candidatus Accumulibacter phosphatis clade
          IIA str. UW-1]
          Length = 70

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R  K M
Sbjct: 1  MPAIRVKENEPFEVAIRRFKRTVEKTGLLTELRAREFYEKPTAERKRKLAAAVKRHHKRM 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|85711763|ref|ZP_01042819.1| Ribosomal protein S21 [Idiomarina baltica OS145]
 gi|85694378|gb|EAQ32320.1| Ribosomal protein S21 [Idiomarina baltica OS145]
          Length = 71

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+  +  GVL E++ R HYEKP+ +R R K+ A++R  K +
Sbjct: 1  MPVVKVKENEPFDVALRRFKRSCEKAGVLSEVRRREHYEKPTAERKRKKAAAVKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|118594357|ref|ZP_01551704.1| 30S ribosomal protein S21 [Methylophilales bacterium HTCC2181]
 gi|118440135|gb|EAV46762.1| 30S ribosomal protein S21 [Methylophilales bacterium HTCC2181]
          Length = 70

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   + ALR  K+ ++  G++ +L+ R  YEKP+ +R R  + A++R  + +
Sbjct: 1  MSTIKVKENEPFDVALRRFKRLIEKTGLINDLRAREFYEKPTWERKRKAAAAVKRQYRRL 60

Query: 78 RKIA 81
          R   
Sbjct: 61 RNQM 64


>gi|67458818|ref|YP_246442.1| 30S ribosomal protein S21 [Rickettsia felis URRWXCal2]
 gi|75536733|sp|Q4UMD5|RS21_RICFE RecName: Full=30S ribosomal protein S21
 gi|67004351|gb|AAY61277.1| 30S ribosomal protein S21 [Rickettsia felis URRWXCal2]
          Length = 66

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 35/63 (55%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + V V   N +  L+  KK++Q E   R++K + +YE PS KRVR   EA RR RK  R
Sbjct: 1  MILVNVHAGNCDNTLKNFKKRLQRELYFRKMKEQRYYETPSAKRVRKAQEAARRQRKFAR 60

Query: 79 KIA 81
          K  
Sbjct: 61 KKM 63


>gi|325983605|ref|YP_004296007.1| 30S ribosomal protein S21 [Nitrosomonas sp. AL212]
 gi|325533124|gb|ADZ27845.1| ribosomal protein S21 [Nitrosomonas sp. AL212]
          Length = 70

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R+ K +
Sbjct: 1  MTTIKVKENEPFEVAMRRFKRSIEKTGILTELRAREFYEKPTAERKRKLAAAVKRNYKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|195451786|ref|XP_002073075.1| GK13350 [Drosophila willistoni]
 gi|194169160|gb|EDW84061.1| GK13350 [Drosophila willistoni]
          Length = 87

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 32/56 (57%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          +  A  +LV++NNVE+A R+L + +  E +  + +    YEKP Q R R+  E  +
Sbjct: 5  QFLARTILVQNNNVEEACRLLNRVLGKEELFDQFRRTRFYEKPYQVRRRINFEKCK 60


>gi|78357099|ref|YP_388548.1| 30S ribosomal protein S21 [Desulfovibrio desulfuricans subsp.
          desulfuricans str. G20]
 gi|119367255|sp|Q30ZP3|RS21_DESDG RecName: Full=30S ribosomal protein S21
 gi|78219504|gb|ABB38853.1| SSU ribosomal protein S21P [Desulfovibrio desulfuricans subsp.
          desulfuricans str. G20]
          Length = 67

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 27/63 (42%), Positives = 39/63 (61%)

Query: 17 ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
          +  VY+   + N + ALR  KK+++  GVL E+K R H+EKPS  R + K+ A +R  K 
Sbjct: 1  MPGVYLDDNEYNFDIALRRFKKQVEKAGVLSEMKKRQHFEKPSVMRKKKKAAARKRLLKK 60

Query: 77 MRK 79
          MRK
Sbjct: 61 MRK 63


>gi|307136121|gb|ADN33967.1| structural constituent of ribosome [Cucumis melo subsp. melo]
          Length = 168

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 25/53 (47%), Gaps = 1/53 (1%)

Query: 18  SAVYVLVRDNNVE-QALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
             V + V +N  E Q +   + ++   G+L+E K R  +E    KR R   EA
Sbjct: 68  YNVLITVGENESEDQVVNRFRTQVLRAGILQECKRRRFFENSQAKRKRKAREA 120


>gi|116787789|gb|ABK24643.1| unknown [Picea sitchensis]
 gi|148907536|gb|ABR16898.1| unknown [Picea sitchensis]
 gi|224285659|gb|ACN40545.1| unknown [Picea sitchensis]
          Length = 161

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 14/65 (21%), Positives = 25/65 (38%), Gaps = 1/65 (1%)

Query: 15  REISAVYVLVRDNNV-EQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
            +     V V ++   +  +R  +K +   GV+ E K R  +E P     R    +  R 
Sbjct: 60  GKHYNAQVFVGEDEPADAVVRRFRKAVMDAGVISECKRRRFFESPQDVAKRKTEASRARK 119

Query: 74  RKLMR 78
            +  R
Sbjct: 120 LRNKR 124


>gi|304312385|ref|YP_003811983.1| 30S ribosomal protein S21 [gamma proteobacterium HdN1]
 gi|301798118|emb|CBL46340.1| 30S ribosomal protein S21 [gamma proteobacterium HdN1]
          Length = 71

 Score = 46.4 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 1/68 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+  +  GVL E++ R  YEKP+Q+R R  + A++R  K +
Sbjct: 1  MPQVKVKENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTQERKRKMAAAVKRHAKKL 60

Query: 78 RKIAQREG 85
           +   R  
Sbjct: 61 ARETLRRK 68


>gi|161544993|ref|YP_153597.2| 30S ribosomal protein S21 [Anaplasma marginale str. St. Maries]
 gi|254994744|ref|ZP_05276934.1| 30S ribosomal protein S21 [Anaplasma marginale str. Mississippi]
 gi|255002863|ref|ZP_05277827.1| 30S ribosomal protein S21 [Anaplasma marginale str. Puerto Rico]
 gi|255003994|ref|ZP_05278795.1| 30S ribosomal protein S21 [Anaplasma marginale str. Virginia]
 gi|269959062|ref|YP_003328851.1| 30S ribosomal protein S21 [Anaplasma centrale str. Israel]
 gi|269848893|gb|ACZ49537.1| 30S ribosomal protein S21 [Anaplasma centrale str. Israel]
          Length = 87

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 27/58 (46%), Positives = 40/58 (68%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
           V V+V   ++EQ +R LKKK+Q EG  R++K+  H+EKPS+KR R + +  RR +KL
Sbjct: 1  MVEVVVYHGDIEQGIRTLKKKLQREGKPRQMKI-THHEKPSEKRARKRDDCERRRKKL 57


>gi|148652172|ref|YP_001279265.1| 30S ribosomal protein S21 [Psychrobacter sp. PRwf-1]
 gi|172048463|sp|A5WCC4|RS21_PSYWF RecName: Full=30S ribosomal protein S21
 gi|148571256|gb|ABQ93315.1| SSU ribosomal protein S21P [Psychrobacter sp. PRwf-1]
 gi|332977403|gb|EGK14180.1| 30S ribosomal protein S21 [Psychrobacter sp. 1501(2011)]
          Length = 71

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 42/66 (63%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N  V+ A+R  K+  +  GVL +++ R  YEKP+Q+R R K+ A++R +K +
Sbjct: 1  MPSVKVKENEPVDIAIRRFKRACEKAGVLSDVRKREFYEKPTQERKRKKAAAVKRYKKKL 60

Query: 78 RKIAQR 83
          ++ + R
Sbjct: 61 QRESIR 66


>gi|254497837|ref|ZP_05110603.1| 30S ribosomal protein S21 [Legionella drancourtii LLAP12]
 gi|254352915|gb|EET11684.1| 30S ribosomal protein S21 [Legionella drancourtii LLAP12]
          Length = 75

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++  N E ALR  K+  +  G+L EL+ R  YEKP+ +R R ++ A++R  K +
Sbjct: 1  MPTVRVKEGENPEYALRRFKRSCEKAGILTELRRREFYEKPTAERKRKQAAAVKRHLKKI 60

Query: 78 RKIAQREGAPVSRLR 92
           +          R +
Sbjct: 61 SRDTSSRQGTKHRRK 75


>gi|86157145|ref|YP_463930.1| SSU ribosomal protein S21P [Anaeromyxobacter dehalogenans 2CP-C]
 gi|85773656|gb|ABC80493.1| SSU ribosomal protein S21P [Anaeromyxobacter dehalogenans 2CP-C]
          Length = 93

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 37/65 (56%), Gaps = 1/65 (1%)

Query: 16 EISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          E     V V+D    E A++  KK+ +  G+L E++ R HYEKPS KR +    A +R+ 
Sbjct: 27 EERMTGVRVKDGESFENAMKRFKKQCEKAGILSEIRKREHYEKPSVKRKKKALAAKKRAL 86

Query: 75 KLMRK 79
          K MRK
Sbjct: 87 KKMRK 91


>gi|326529781|dbj|BAK04837.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 106

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 1/75 (1%)

Query: 1  MLVFNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMR-GHYEKPS 59
          +    A  G   + +    + V VRD N+E+AL+V+++KM+  G+ R +K R  H+ K S
Sbjct: 13 LWPAAAAAGSRGQVQPSRGIVVQVRDGNLERALQVMERKMRSSGIERLIKRRTEHHVKNS 72

Query: 60 QKRVRLKSEAIRRSR 74
          +KRV  +   + R R
Sbjct: 73 EKRVLARKALMARVR 87


>gi|82703180|ref|YP_412746.1| 30S ribosomal protein S21 [Nitrosospira multiformis ATCC 25196]
 gi|119367279|sp|Q2Y7B7|RS21_NITMU RecName: Full=30S ribosomal protein S21
 gi|82411245|gb|ABB75354.1| SSU ribosomal protein S21P [Nitrosospira multiformis ATCC 25196]
          Length = 70

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R+ K +
Sbjct: 1  MTTIKVKENEPFEVAMRRFKRTIEKTGLLTELRAREFYEKPTAERKRKLAAAVKRTYKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|253997430|ref|YP_003049494.1| 30S ribosomal protein S21 [Methylotenera mobilis JLW8]
 gi|253984109|gb|ACT48967.1| ribosomal protein S21 [Methylotenera mobilis JLW8]
          Length = 70

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+ ++  G+L +L+ R  YEKP+ +R R  + A++R  + +
Sbjct: 1  MSSVRVKENEPFDVALRRFKRLIEKTGLLNDLRAREFYEKPTWERKRKAAAAVKRQYRRL 60

Query: 78 RKI 80
           K 
Sbjct: 61 MKQ 63


>gi|72059036|ref|XP_785667.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
 gi|115966061|ref|XP_001177280.1| PREDICTED: hypothetical protein [Strongylocentrotus purpuratus]
          Length = 86

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/59 (25%), Positives = 32/59 (54%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             A  V V+  +V+ A R L   +  +G++  ++ + ++EKP Q+R R + E +++  
Sbjct: 6  RFVARTVFVKGGDVDGAYRTLNNSLNRDGLIESVRRKRYFEKPFQERRRKEYENMKKIY 64


>gi|71906169|ref|YP_283756.1| 30S ribosomal protein S21 [Dechloromonas aromatica RCB]
 gi|119367252|sp|Q47IP5|RS21_DECAR RecName: Full=30S ribosomal protein S21
 gi|71845790|gb|AAZ45286.1| SSU ribosomal protein S21P [Dechloromonas aromatica RCB]
          Length = 70

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 37/63 (58%), Gaps = 1/63 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPNIRVKENEPFEVAIRRFKRTVEKTGLLTELRAREFYEKPTTERKRKAAAAVKRQHKRL 60

Query: 78 RKI 80
          R +
Sbjct: 61 RSL 63


>gi|119626950|gb|EAX06545.1| hCG1790232 [Homo sapiens]
          Length = 59

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 29/54 (53%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
          +  A  V+V++ N+E A R L + +  + ++  +K + + EKP  +R R   E 
Sbjct: 6  KFIARTVMVQEGNMEGAYRTLSRILTTDRLIEGIKPQRYCEKPCHRRQRESYER 59


>gi|56461302|ref|YP_156583.1| 30S ribosomal protein S21 [Idiomarina loihiensis L2TR]
 gi|61215800|sp|Q5QVL5|RS21_IDILO RecName: Full=30S ribosomal protein S21
 gi|56180312|gb|AAV83034.1| Ribosomal protein S21 [Idiomarina loihiensis L2TR]
          Length = 71

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+  +  GVL E++ R HYEKP+ +R R K+ A++R  K +
Sbjct: 1  MPVVKVKENEPFDVALRRFKRSCEKAGVLSEVRRREHYEKPTSERKRKKAAAVKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRDNARR 67


>gi|77359318|ref|YP_338893.1| 30S ribosomal protein S21 [Pseudoalteromonas haloplanktis TAC125]
 gi|119473193|ref|ZP_01614890.1| 30S ribosomal subunit protein S21 [Alteromonadales bacterium
          TW-7]
 gi|315127799|ref|YP_004069802.1| 30S ribosomal protein S21 [Pseudoalteromonas sp. SM9913]
 gi|332531765|ref|ZP_08407650.1| 30S ribosomal protein S21 [Pseudoalteromonas haloplanktis
          ANT/505]
 gi|119367293|sp|Q3IIB6|RS21_PSEHT RecName: Full=30S ribosomal protein S21
 gi|76874229|emb|CAI85450.1| 30S ribosomal subunit protein S21 [Pseudoalteromonas haloplanktis
          TAC125]
 gi|119444557|gb|EAW25872.1| 30S ribosomal subunit protein S21 [Alteromonadales bacterium
          TW-7]
 gi|315016313|gb|ADT69651.1| 30S ribosomal protein S21 [Pseudoalteromonas sp. SM9913]
 gi|332038741|gb|EGI75183.1| 30S ribosomal protein S21 [Pseudoalteromonas haloplanktis
          ANT/505]
          Length = 71

 Score = 46.0 bits (108), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R HYEKP+ +R R K+ A++R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGILSEVRRREHYEKPTAERKRKKAAAVKRHMKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRDNARR 67


>gi|59712857|ref|YP_205633.1| 30S ribosomal protein S21 [Vibrio fischeri ES114]
 gi|197334639|ref|YP_002157045.1| ribosomal protein S21 [Vibrio fischeri MJ11]
 gi|75506919|sp|Q5E2K1|RS21_VIBF1 RecName: Full=30S ribosomal protein S21
 gi|226695065|sp|B5FB83|RS21_VIBFM RecName: Full=30S ribosomal protein S21
 gi|59480958|gb|AAW86745.1| 30S ribosomal subunit protein S21 [Vibrio fischeri ES114]
 gi|197316129|gb|ACH65576.1| ribosomal protein S21 [Vibrio fischeri MJ11]
          Length = 71

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   + ALR  K+  +  G+L E++ R HYEKP+  R R K+ A +R  K +
Sbjct: 1  MPVVKVRENEPFDVALRRFKRSCEKAGILSEVRRREHYEKPTTVRKRAKAAAQKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|291278628|ref|YP_003495463.1| 30S ribosomal protein S21 [Deferribacter desulfuricans SSM1]
 gi|290753330|dbj|BAI79707.1| 30S ribosomal protein S21 [Deferribacter desulfuricans SSM1]
          Length = 75

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 46/62 (74%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
          V V  +N++ AL++LKKK++ EG++RE+K   +YEKP++ R +   +A R+ +KL+RK+ 
Sbjct: 10 VKVDGDNIDYALKLLKKKVEREGLIREIKRHTYYEKPTEVRRKKLLKARRKQQKLVRKLK 69

Query: 82 QR 83
          ++
Sbjct: 70 EK 71


>gi|297539661|ref|YP_003675430.1| 30S ribosomal protein S21 [Methylotenera sp. 301]
 gi|297259008|gb|ADI30853.1| ribosomal protein S21 [Methylotenera sp. 301]
          Length = 70

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+ ++  G+L +L+ R  YEKP+ +R R  + A++R  + +
Sbjct: 1  MSSVRVKENEPFDVALRRFKRLIEKTGLLNDLRAREFYEKPTWERKRKAAAAVKRQYRRL 60

Query: 78 RKI 80
           K 
Sbjct: 61 LKQ 63


>gi|291238426|ref|XP_002739132.1| PREDICTED: mitochondrial ribosomal protein S21-like [Saccoglossus
          kowalevskii]
          Length = 85

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 34/59 (57%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             A  V+V++ NV+ A R L   +  E ++  +K R ++EKP +KR R++ E +++  
Sbjct: 5  RFIARTVMVQNGNVDAAYRSLNNMLGRENIIEIVKRRRYFEKPFRKRQRIEYETVKKIY 63


>gi|71064791|ref|YP_263518.1| 30S ribosomal protein S21 [Psychrobacter arcticus 273-4]
 gi|93005062|ref|YP_579499.1| 30S ribosomal protein S21 [Psychrobacter cryohalolentis K5]
 gi|119367295|sp|Q4FV74|RS21_PSYA2 RecName: Full=30S ribosomal protein S21
 gi|119367296|sp|Q1QE88|RS21_PSYCK RecName: Full=30S ribosomal protein S21
 gi|71037776|gb|AAZ18084.1| SSU ribosomal protein S21P [Psychrobacter arcticus 273-4]
 gi|92392740|gb|ABE74015.1| SSU ribosomal protein S21P [Psychrobacter cryohalolentis K5]
          Length = 71

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N  V+ A+R  K+  +  GVL +++ R  YEKP+Q R R K+ A++R +K +
Sbjct: 1  MPAVKVKENEPVDIAIRRFKRACEKAGVLSDVRKREFYEKPTQVRKRKKAAAVKRYKKKL 60

Query: 78 RKIAQR 83
          ++   R
Sbjct: 61 QRETIR 66


>gi|289549124|ref|YP_003474112.1| ribosomal protein S21 [Thermocrinis albus DSM 14484]
 gi|289182741|gb|ADC89985.1| ribosomal protein S21 [Thermocrinis albus DSM 14484]
          Length = 69

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/62 (35%), Positives = 39/62 (62%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
          A+ V+  + + E+ L+  K+ ++ EG+L E++ R  YEKPS+KR R +  A +R  K ++
Sbjct: 5  AIVVVGDNESFEKVLKKFKRVVEKEGILTEVRRRQFYEKPSEKRKRKERAARKRIIKALK 64

Query: 79 KI 80
          K 
Sbjct: 65 KR 66


>gi|166030433|ref|ZP_02233262.1| hypothetical protein DORFOR_00094 [Dorea formicigenerans ATCC
          27755]
 gi|166029791|gb|EDR48548.1| hypothetical protein DORFOR_00094 [Dorea formicigenerans ATCC
          27755]
          Length = 83

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 33/56 (58%), Gaps = 1/56 (1%)

Query: 18 SAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          +   V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R
Sbjct: 25 TMSNVIVKENETLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKR 80


>gi|56477914|ref|YP_159503.1| 30S ribosomal protein S21 [Aromatoleum aromaticum EbN1]
 gi|61215797|sp|Q5P262|RS21_AZOSE RecName: Full=30S ribosomal protein S21
 gi|56313957|emb|CAI08602.1| 30S ribosomal protein S21 [Aromatoleum aromaticum EbN1]
          Length = 70

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 22 VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
          + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R+ K +R
Sbjct: 4  IRVKENEPFEVAIRRFKRTIEKTGLLTELRAREFYEKPTAERKRKSAAAVKRNHKRLR 61


>gi|226939392|ref|YP_002794465.1| 30S ribosomal protein S21 [Laribacter hongkongensis HLHK9]
 gi|254813721|sp|C1DC39|RS21_LARHH RecName: Full=30S ribosomal protein S21
 gi|226714318|gb|ACO73456.1| RpsU [Laribacter hongkongensis HLHK9]
          Length = 70

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MPSVRVKENEPFEVAMRRFKRSIEKTGLLTELRAREFYEKPTTERKRKKAAAVKRHYKRL 60

Query: 78 RKIA 81
          R   
Sbjct: 61 RSQM 64


>gi|298529693|ref|ZP_07017096.1| ribosomal protein S21 [Desulfonatronospira thiodismutans ASO3-1]
 gi|298511129|gb|EFI35032.1| ribosomal protein S21 [Desulfonatronospira thiodismutans ASO3-1]
          Length = 66

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 18/33 (54%), Positives = 24/33 (72%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPS 59
          +N + ALR  KK+++  G+L ELK R HYEKPS
Sbjct: 10 DNFDYALRKFKKQVEKSGILSELKKRQHYEKPS 42


>gi|86148896|ref|ZP_01067142.1| 30S ribosomal protein S21 [Vibrio sp. MED222]
 gi|148979376|ref|ZP_01815482.1| 30S ribosomal protein S21 [Vibrionales bacterium SWAT-3]
 gi|163802690|ref|ZP_02196581.1| 30S ribosomal protein S21 [Vibrio sp. AND4]
 gi|218708437|ref|YP_002416058.1| 30S ribosomal protein S21 [Vibrio splendidus LGP32]
 gi|260773554|ref|ZP_05882470.1| SSU ribosomal protein S21p [Vibrio metschnikovii CIP 69.14]
 gi|254764442|sp|B7VIH1|RS21_VIBSL RecName: Full=30S ribosomal protein S21
 gi|85833314|gb|EAQ51526.1| 30S ribosomal protein S21 [Vibrio sp. MED222]
 gi|145961812|gb|EDK27105.1| 30S ribosomal protein S21 [Vibrionales bacterium SWAT-3]
 gi|159173578|gb|EDP58398.1| 30S ribosomal protein S21 [Vibrio sp. AND4]
 gi|218321456|emb|CAV17408.1| ribosomal protein S21 [Vibrio splendidus LGP32]
 gi|260612693|gb|EEX37896.1| SSU ribosomal protein S21p [Vibrio metschnikovii CIP 69.14]
          Length = 71

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   + ALR  K+  +  G+L E++ R HYEKP+  R R K+ A +R  K +
Sbjct: 1  MPIVKVRENEPFDVALRRFKRSCEKAGILSEVRRREHYEKPTTVRKRAKAAAQKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|294634615|ref|ZP_06713149.1| conserved domain protein [Edwardsiella tarda ATCC 23685]
 gi|291091945|gb|EFE24506.1| conserved domain protein [Edwardsiella tarda ATCC 23685]
          Length = 85

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/74 (29%), Positives = 37/74 (50%)

Query: 11 FSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
          F  G     V  +  +   + ALR  K+  +  G+L E++ R  YEKP+ +R R K+ A+
Sbjct: 8  FYRGERHMPVIKVRENEPFDVALRRFKRSCEKAGILAEVRRREFYEKPTTERKRAKASAV 67

Query: 71 RRSRKLMRKIAQRE 84
          +R  K + +   R 
Sbjct: 68 KRHAKKLARENARR 81


>gi|217969612|ref|YP_002354846.1| 30S ribosomal protein S21 [Thauera sp. MZ1T]
 gi|217506939|gb|ACK53950.1| ribosomal protein S21 [Thauera sp. MZ1T]
          Length = 70

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 37/58 (63%), Gaps = 1/58 (1%)

Query: 22 VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
          + V++N   E A+R  K+ ++  GVL EL+ R  YEKP+ +R R  + A++R+ K +R
Sbjct: 4  IRVKENEPFEVAIRRFKRTIEKTGVLTELRSREFYEKPTAERKRKLAAAVKRNHKRLR 61


>gi|15640543|ref|NP_230171.1| 30S ribosomal protein S21 [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|27364088|ref|NP_759616.1| 30S ribosomal protein S21 [Vibrio vulnificus CMCP6]
 gi|28897181|ref|NP_796786.1| 30S ribosomal protein S21 [Vibrio parahaemolyticus RIMD 2210633]
 gi|37678748|ref|NP_933357.1| 30S ribosomal protein S21 [Vibrio vulnificus YJ016]
 gi|91227147|ref|ZP_01261631.1| 30S ribosomal protein S21 [Vibrio alginolyticus 12G01]
 gi|147674201|ref|YP_001216020.1| 30S ribosomal protein S21 [Vibrio cholerae O395]
 gi|153214947|ref|ZP_01949730.1| ribosomal protein S21 [Vibrio cholerae 1587]
 gi|153829920|ref|ZP_01982587.1| ribosomal protein S21 [Vibrio cholerae 623-39]
 gi|153839261|ref|ZP_01991928.1| ribosomal protein S21 [Vibrio parahaemolyticus AQ3810]
 gi|156973171|ref|YP_001444078.1| 30S ribosomal protein S21 [Vibrio harveyi ATCC BAA-1116]
 gi|227080703|ref|YP_002809254.1| ribosomal protein S21 [Vibrio cholerae M66-2]
 gi|229507131|ref|ZP_04396637.1| SSU ribosomal protein S21p [Vibrio cholerae BX 330286]
 gi|229509006|ref|ZP_04398494.1| SSU ribosomal protein S21p [Vibrio cholerae B33]
 gi|229512574|ref|ZP_04402045.1| SSU ribosomal protein S21p [Vibrio cholerae TMA 21]
 gi|229519674|ref|ZP_04409117.1| SSU ribosomal protein S21p [Vibrio cholerae RC9]
 gi|229520816|ref|ZP_04410238.1| SSU ribosomal protein S21p [Vibrio cholerae TM 11079-80]
 gi|229525183|ref|ZP_04414588.1| SSU ribosomal protein S21p [Vibrio cholerae bv. albensis VL426]
 gi|229530334|ref|ZP_04419722.1| SSU ribosomal protein S21p [Vibrio cholerae 12129(1)]
 gi|229606190|ref|YP_002876838.1| 30S ribosomal protein S21 [Vibrio cholerae MJ-1236]
 gi|254291204|ref|ZP_04962000.1| ribosomal protein S21 [Vibrio cholerae AM-19226]
 gi|254850759|ref|ZP_05240109.1| 30S ribosomal protein S21 [Vibrio cholerae MO10]
 gi|255744252|ref|ZP_05418205.1| SSU ribosomal protein S21p [Vibrio cholera CIRS 101]
 gi|258623539|ref|ZP_05718540.1| 30S ribosomal protein S21 [Vibrio mimicus VM573]
 gi|260767409|ref|ZP_05876346.1| SSU ribosomal protein S21p [Vibrio furnissii CIP 102972]
 gi|260775517|ref|ZP_05884414.1| SSU ribosomal protein S21p [Vibrio coralliilyticus ATCC BAA-450]
 gi|260878086|ref|ZP_05890441.1| ribosomal protein S21 [Vibrio parahaemolyticus AN-5034]
 gi|260896981|ref|ZP_05905477.1| ribosomal protein S21 [Vibrio parahaemolyticus Peru-466]
 gi|260902500|ref|ZP_05910895.1| ribosomal protein S21 [Vibrio parahaemolyticus AQ4037]
 gi|261210091|ref|ZP_05924389.1| SSU ribosomal protein S21p [Vibrio sp. RC341]
 gi|261250215|ref|ZP_05942791.1| SSU ribosomal protein S21p [Vibrio orientalis CIP 102891]
 gi|262164050|ref|ZP_06031789.1| SSU ribosomal protein S21p [Vibrio mimicus VM223]
 gi|262169831|ref|ZP_06037521.1| SSU ribosomal protein S21p [Vibrio cholerae RC27]
 gi|262172392|ref|ZP_06040070.1| SSU ribosomal protein S21p [Vibrio mimicus MB-451]
 gi|262392395|ref|YP_003284249.1| 30S ribosomal protein S21p [Vibrio sp. Ex25]
 gi|262401780|ref|ZP_06078346.1| SSU ribosomal protein S21p [Vibrio sp. RC586]
 gi|269960190|ref|ZP_06174565.1| 30S ribosomal protein S21 [Vibrio harveyi 1DA3]
 gi|269968564|ref|ZP_06182567.1| 30S ribosomal protein S21 [Vibrio alginolyticus 40B]
 gi|297580653|ref|ZP_06942579.1| ribosomal protein S21 [Vibrio cholerae RC385]
 gi|298500977|ref|ZP_07010778.1| SSU ribosomal protein S21 [Vibrio cholerae MAK 757]
 gi|312883928|ref|ZP_07743645.1| 30S ribosomal protein S21 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|320157472|ref|YP_004189851.1| 30S ribosomal protein S21p [Vibrio vulnificus MO6-24/O]
 gi|323493628|ref|ZP_08098749.1| 30S ribosomal protein S21 [Vibrio brasiliensis LMG 20546]
 gi|323495837|ref|ZP_08100905.1| 30S ribosomal protein S21 [Vibrio sinaloensis DSM 21326]
 gi|54039488|sp|P66533|RS21_VIBPA RecName: Full=30S ribosomal protein S21
 gi|54039489|sp|P66534|RS21_VIBVU RecName: Full=30S ribosomal protein S21
 gi|54042173|sp|P66532|RS21_VIBCH RecName: Full=30S ribosomal protein S21
 gi|61216000|sp|Q7MP00|RS21_VIBVY RecName: Full=30S ribosomal protein S21
 gi|166225207|sp|A7MWP7|RS21_VIBHB RecName: Full=30S ribosomal protein S21
 gi|172047738|sp|A5F9E6|RS21_VIBC3 RecName: Full=30S ribosomal protein S21
 gi|254764441|sp|C3LS10|RS21_VIBCM RecName: Full=30S ribosomal protein S21
 gi|9654947|gb|AAF93689.1| ribosomal protein S21 [Vibrio cholerae O1 biovar El Tor str.
          N16961]
 gi|27360206|gb|AAO09143.1| ribosomal protein S21 [Vibrio vulnificus CMCP6]
 gi|28805390|dbj|BAC58670.1| ribosomal protein S21 [Vibrio parahaemolyticus RIMD 2210633]
 gi|37197489|dbj|BAC93328.1| ribosomal protein S21 [Vibrio vulnificus YJ016]
 gi|91188799|gb|EAS75086.1| 30S ribosomal protein S21 [Vibrio alginolyticus 12G01]
 gi|124115020|gb|EAY33840.1| ribosomal protein S21 [Vibrio cholerae 1587]
 gi|146316084|gb|ABQ20623.1| ribosomal protein S21 [Vibrio cholerae O395]
 gi|148874608|gb|EDL72743.1| ribosomal protein S21 [Vibrio cholerae 623-39]
 gi|149747226|gb|EDM58214.1| ribosomal protein S21 [Vibrio parahaemolyticus AQ3810]
 gi|150422898|gb|EDN14849.1| ribosomal protein S21 [Vibrio cholerae AM-19226]
 gi|156524765|gb|ABU69851.1| hypothetical protein VIBHAR_00851 [Vibrio harveyi ATCC BAA-1116]
 gi|227008591|gb|ACP04803.1| ribosomal protein S21 [Vibrio cholerae M66-2]
 gi|227012346|gb|ACP08556.1| ribosomal protein S21 [Vibrio cholerae O395]
 gi|229332107|gb|EEN97595.1| SSU ribosomal protein S21p [Vibrio cholerae 12129(1)]
 gi|229338764|gb|EEO03781.1| SSU ribosomal protein S21p [Vibrio cholerae bv. albensis VL426]
 gi|229342049|gb|EEO07045.1| SSU ribosomal protein S21p [Vibrio cholerae TM 11079-80]
 gi|229344363|gb|EEO09338.1| SSU ribosomal protein S21p [Vibrio cholerae RC9]
 gi|229350467|gb|EEO15416.1| SSU ribosomal protein S21p [Vibrio cholerae TMA 21]
 gi|229353931|gb|EEO18865.1| SSU ribosomal protein S21p [Vibrio cholerae B33]
 gi|229355876|gb|EEO20796.1| SSU ribosomal protein S21p [Vibrio cholerae BX 330286]
 gi|229368845|gb|ACQ59268.1| SSU ribosomal protein S21p [Vibrio cholerae MJ-1236]
 gi|254846464|gb|EET24878.1| 30S ribosomal protein S21 [Vibrio cholerae MO10]
 gi|255738192|gb|EET93584.1| SSU ribosomal protein S21p [Vibrio cholera CIRS 101]
 gi|258584201|gb|EEW08949.1| 30S ribosomal protein S21 [Vibrio mimicus VM573]
 gi|260608698|gb|EEX34863.1| SSU ribosomal protein S21p [Vibrio coralliilyticus ATCC BAA-450]
 gi|260617521|gb|EEX42703.1| SSU ribosomal protein S21p [Vibrio furnissii CIP 102972]
 gi|260840856|gb|EEX67398.1| SSU ribosomal protein S21p [Vibrio sp. RC341]
 gi|260939331|gb|EEX95317.1| SSU ribosomal protein S21p [Vibrio orientalis CIP 102891]
 gi|261893468|gb|EEY39454.1| SSU ribosomal protein S21p [Vibrio mimicus MB-451]
 gi|262021565|gb|EEY40276.1| SSU ribosomal protein S21p [Vibrio cholerae RC27]
 gi|262027578|gb|EEY46244.1| SSU ribosomal protein S21p [Vibrio mimicus VM223]
 gi|262335989|gb|ACY49784.1| SSU ribosomal protein S21p [Vibrio sp. Ex25]
 gi|262352197|gb|EEZ01327.1| SSU ribosomal protein S21p [Vibrio sp. RC586]
 gi|269826822|gb|EEZ81153.1| 30S ribosomal protein S21 [Vibrio alginolyticus 40B]
 gi|269834997|gb|EEZ89081.1| 30S ribosomal protein S21 [Vibrio harveyi 1DA3]
 gi|297535069|gb|EFH73904.1| ribosomal protein S21 [Vibrio cholerae RC385]
 gi|297540225|gb|EFH76285.1| SSU ribosomal protein S21 [Vibrio cholerae MAK 757]
 gi|308088728|gb|EFO38423.1| ribosomal protein S21 [Vibrio parahaemolyticus Peru-466]
 gi|308089860|gb|EFO39555.1| ribosomal protein S21 [Vibrio parahaemolyticus AN-5034]
 gi|308109812|gb|EFO47352.1| ribosomal protein S21 [Vibrio parahaemolyticus AQ4037]
 gi|309368386|gb|EFP95921.1| 30S ribosomal protein S21 [Vibrio caribbenthicus ATCC BAA-2122]
 gi|315181192|gb|ADT88106.1| 30S ribosomal protein S21 [Vibrio furnissii NCTC 11218]
 gi|319932784|gb|ADV87648.1| SSU ribosomal protein S21p [Vibrio vulnificus MO6-24/O]
 gi|323312151|gb|EGA65294.1| 30S ribosomal protein S21 [Vibrio brasiliensis LMG 20546]
 gi|323319053|gb|EGA71996.1| 30S ribosomal protein S21 [Vibrio sinaloensis DSM 21326]
 gi|327483341|gb|AEA77748.1| SSU ribosomal protein S21p [Vibrio cholerae LMA3894-4]
 gi|328471950|gb|EGF42827.1| 30S ribosomal protein S21 [Vibrio parahaemolyticus 10329]
          Length = 71

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   + ALR  K+  +  G+L E++ R HYEKP+  R R K+ A +R  K +
Sbjct: 1  MPVVKVRENEPFDVALRRFKRSCEKAGILSEVRRREHYEKPTTVRKRAKAAAQKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|303257745|ref|ZP_07343757.1| ribosomal protein S21 [Burkholderiales bacterium 1_1_47]
 gi|331001171|ref|ZP_08324798.1| ribosomal protein S21 [Parasutterella excrementihominis YIT
          11859]
 gi|302859715|gb|EFL82794.1| ribosomal protein S21 [Burkholderiales bacterium 1_1_47]
 gi|329569103|gb|EGG50895.1| ribosomal protein S21 [Parasutterella excrementihominis YIT
          11859]
          Length = 70

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E ALR  K+ ++  G+L EL+ R  YEKP+ +R R K+ AI+R  K +
Sbjct: 1  MPTIRVKENEPFEVALRRFKRTIEKSGLLTELRAREFYEKPTAERKRKKAAAIKRHYKRL 60

Query: 78 RKIAQREGA 86
          R +   +  
Sbjct: 61 RSMMLPKKL 69


>gi|297570025|ref|YP_003691369.1| ribosomal protein S21 [Desulfurivibrio alkaliphilus AHT2]
 gi|296925940|gb|ADH86750.1| ribosomal protein S21 [Desulfurivibrio alkaliphilus AHT2]
          Length = 64

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 1/64 (1%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + V VR  +VE A+R+LKKK+Q +G+ +ELK R  YEKPS KR R  +E+ R+ RKLM 
Sbjct: 1  MIEVEVR-GDVEHAIRILKKKLQLDGMKKELKRREFYEKPSAKRRRKTAESRRKLRKLMY 59

Query: 79 KIAQ 82
          K+ +
Sbjct: 60 KMER 63


>gi|323142884|ref|ZP_08077595.1| ribosomal protein S21 [Succinatimonas hippei YIT 12066]
 gi|322417312|gb|EFY07935.1| ribosomal protein S21 [Succinatimonas hippei YIT 12066]
          Length = 71

 Score = 45.7 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L +++ R  YEKP+  R R K+ AI+R  K M
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGILADVRAREFYEKPTTVRKRAKASAIKRHAKKM 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|225848584|ref|YP_002728747.1| 30S ribosomal protein S21 [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225643246|gb|ACN98296.1| ribosomal protein S21 [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 64

 Score = 45.7 bits (107), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 34/55 (61%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
          + + E+AL+  KK ++ EG+L E K +  YEKPS KR R +  A +R  K ++K 
Sbjct: 7  EGDFEKALKKFKKIVEKEGILTEYKRKEFYEKPSVKRKRKERAARKRLIKALKKK 61


>gi|195641662|gb|ACG40299.1| ribosome-like protein [Zea mays]
          Length = 139

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 18 SAVYVLVRDNNVEQAL-RVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
            V +LV +N  E+++ R  ++++   GVL+E+K R  YE  + ++ R   EA
Sbjct: 47 YNVQILVDENEGEESIFRRFRREVMRAGVLQEIKRRRRYESKTDEKKRKAREA 99


>gi|224823885|ref|ZP_03696994.1| ribosomal protein S21 [Lutiella nitroferrum 2002]
 gi|224604340|gb|EEG10514.1| ribosomal protein S21 [Lutiella nitroferrum 2002]
          Length = 70

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R ++ A++R  K +
Sbjct: 1  MPNIRVKENEPFEVAMRRFKRAVEKTGLLTELRAREFYEKPTAERKRKQAAAVKRHYKRL 60

Query: 78 RKIA 81
          R   
Sbjct: 61 RSQM 64


>gi|257454024|ref|ZP_05619298.1| ribosomal protein S21 [Enhydrobacter aerosaccus SK60]
 gi|257448502|gb|EEV23471.1| ribosomal protein S21 [Enhydrobacter aerosaccus SK60]
          Length = 71

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N  V+ A+R  K+  +  G+L +++    YEKP+Q+R R K+ A++R +K M
Sbjct: 1  MPAVKVKENEPVDIAIRRFKRACEKAGILADVRKHEFYEKPTQERKRKKAAAVKRYKKKM 60

Query: 78 RKIAQR 83
           + + R
Sbjct: 61 SRESVR 66


>gi|312794986|ref|YP_004027908.1| SSU ribosomal protein S21P [Burkholderia rhizoxinica HKI 454]
 gi|312166761|emb|CBW73764.1| SSU ribosomal protein S21P [Burkholderia rhizoxinica HKI 454]
          Length = 107

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 19/72 (26%), Positives = 38/72 (52%)

Query: 15  REISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           R+     V+  +   E A+R  ++ ++  G++ EL+ R  YEKP+  R R K+ A++R +
Sbjct: 35  RDNMTTIVIKENEPFEVAIRRFRRTIERNGLIAELRERQSYEKPTAVRKRKKAAAVKRLQ 94

Query: 75  KLMRKIAQREGA 86
           + +R     +  
Sbjct: 95  RRLRSQQLPKKL 106


>gi|226529830|ref|NP_001151834.1| ribosome-like protein [Zea mays]
 gi|195650093|gb|ACG44514.1| ribosome-like protein [Zea mays]
          Length = 139

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 31/51 (60%), Gaps = 1/51 (1%)

Query: 20 VYVLVRDNNVEQAL-RVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
          V +LV +N  E+++ R  ++++   GVL+E+K R  YE  + ++ R   EA
Sbjct: 49 VQILVDENEGEESIFRRFRREVMRAGVLQEIKRRRRYESKTDEKKRKAREA 99


>gi|254468461|ref|ZP_05081867.1| ribosomal protein S21 [beta proteobacterium KB13]
 gi|207087271|gb|EDZ64554.1| ribosomal protein S21 [beta proteobacterium KB13]
          Length = 70

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 17/64 (26%), Positives = 36/64 (56%), Gaps = 1/64 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   + ALR  K+ ++  G++ +L+ +  YEKP+ +R R  + A++R  + +
Sbjct: 1  MTTIKVKENEPFDVALRRFKRLVEKTGLMNDLRAKEFYEKPTWERKRKAAAAVKRQYRRL 60

Query: 78 RKIA 81
          R   
Sbjct: 61 RNQM 64


>gi|289207454|ref|YP_003459520.1| ribosomal protein S21 [Thioalkalivibrio sp. K90mix]
 gi|288943085|gb|ADC70784.1| ribosomal protein S21 [Thioalkalivibrio sp. K90mix]
          Length = 71

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
            +V VR+N   E ALR  K+  +  GV+ E++ R +YEKP+ +R R  + A++R  K  
Sbjct: 1  MPHVRVRENEPFEVALRRFKRTCEKAGVVAEVRRREYYEKPTTERKRKAAAAVKRQLKKN 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRDMTRR 67


>gi|161829908|ref|YP_001597428.1| 30S ribosomal protein S21 [Coxiella burnetii RSA 331]
 gi|164686128|ref|ZP_01946963.2| ribosomal protein S21 [Coxiella burnetii 'MSU Goat Q177']
 gi|165918776|ref|ZP_02218862.1| ribosomal protein S21 [Coxiella burnetii RSA 334]
 gi|61216042|sp|Q83BB9|RS21_COXBU RecName: Full=30S ribosomal protein S21
 gi|189044896|sp|A9KDP4|RS21_COXBN RecName: Full=30S ribosomal protein S21
 gi|189044897|sp|A9N9M4|RS21_COXBR RecName: Full=30S ribosomal protein S21
 gi|161761775|gb|ABX77417.1| ribosomal protein S21 [Coxiella burnetii RSA 331]
 gi|164601693|gb|EAX32381.2| ribosomal protein S21 [Coxiella burnetii 'MSU Goat Q177']
 gi|165917500|gb|EDR36104.1| ribosomal protein S21 [Coxiella burnetii RSA 334]
          Length = 74

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 35/57 (61%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQ 82
          +N  + A+R  K+  +  G+L +L+   +YEKP+ KR R ++ A++R  K ++K  +
Sbjct: 9  NNAFDVAMRRFKRACEKAGILSKLRQIEYYEKPTSKRKRKRAAAVKRYAKKLQKEQE 65


>gi|119899514|ref|YP_934727.1| 30S ribosomal protein S21 [Azoarcus sp. BH72]
 gi|166224009|sp|A1KAI5|RS21_AZOSB RecName: Full=30S ribosomal protein S21
 gi|119671927|emb|CAL95841.1| 30S ribosomal protein S21 [Azoarcus sp. BH72]
          Length = 70

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 22 VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
          + V++N   E A+R  K+ ++  GVL EL+ R  YEKP+ +R R  + A++R+ K +R  
Sbjct: 4  IRVKENEPFEVAIRRFKRTIEKTGVLTELRSREFYEKPTAERKRKLAAAVKRNHKRLRSQ 63

Query: 81 A 81
           
Sbjct: 64 M 64


>gi|319941930|ref|ZP_08016251.1| 30S ribosomal protein S21 [Sutterella wadsworthensis 3_1_45B]
 gi|319804583|gb|EFW01453.1| 30S ribosomal protein S21 [Sutterella wadsworthensis 3_1_45B]
          Length = 70

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E ALR  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MPTIRVKENEPFEVALRRFKRTIEKSGLLTELRAREFYEKPTAERKRKKAAAVKRHYKRL 60

Query: 78 RKIAQREGA 86
          R +   +  
Sbjct: 61 RSMMLPKKL 69


>gi|189184261|ref|YP_001938046.1| 30S ribosomal protein S21 [Orientia tsutsugamushi str. Ikeda]
 gi|226695031|sp|B3CTW5|RS21_ORITI RecName: Full=30S ribosomal protein S21
 gi|189181032|dbj|BAG40812.1| 30S ribosomal protein S21 [Orientia tsutsugamushi str. Ikeda]
          Length = 68

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 38/64 (59%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           ++V V  NN E A+R LKKKMQ E V R +KM   YE PS KRVR K E+ RR RK   
Sbjct: 1  MIHVPVNANNSELAIRSLKKKMQRELVFRSMKMSRFYEPPSVKRVRKKQESERRHRKERA 60

Query: 79 KIAQ 82
             +
Sbjct: 61 MRRR 64


>gi|262275018|ref|ZP_06052829.1| SSU ribosomal protein S21p [Grimontia hollisae CIP 101886]
 gi|262221581|gb|EEY72895.1| SSU ribosomal protein S21p [Grimontia hollisae CIP 101886]
          Length = 71

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   + ALR  K+  +  G+L E++ R H+EKP+  R R K+ A++R  K +
Sbjct: 1  MPVVKVRENEPFDVALRRFKRSCEKAGILSEVRRREHFEKPTTVRKRAKAAAVKRHLKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|74318403|ref|YP_316143.1| 30S ribosomal protein S21 [Thiobacillus denitrificans ATCC 25259]
 gi|119367338|sp|Q3SGB2|RS21_THIDA RecName: Full=30S ribosomal protein S21
 gi|74057898|gb|AAZ98338.1| ribosomal protein S21 [Thiobacillus denitrificans ATCC 25259]
          Length = 70

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
            +V V++N   + ALR  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPHVKVKENEPFDVALRRFKRSIEKVGLLTELRAREFYEKPTAERKRKLAAAVKRQSKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|148284077|ref|YP_001248167.1| 30S ribosomal protein S21 [Orientia tsutsugamushi str. Boryong]
 gi|166224045|sp|A5CC57|RS21_ORITB RecName: Full=30S ribosomal protein S21
 gi|146739516|emb|CAM79222.1| 30S ribosomal protein S21 [Orientia tsutsugamushi str. Boryong]
          Length = 68

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 31/64 (48%), Positives = 38/64 (59%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           ++V V  NN + A+R LKKKMQ E V R +KM   YE PS KRVR K E+ RR RK   
Sbjct: 1  MIHVPVNANNSDLAIRSLKKKMQRELVFRSMKMSRFYEPPSVKRVRKKQESERRHRKERA 60

Query: 79 KIAQ 82
             +
Sbjct: 61 MRRR 64


>gi|170691123|ref|ZP_02882289.1| ribosomal protein S21 [Burkholderia graminis C4D1M]
 gi|170144372|gb|EDT12534.1| ribosomal protein S21 [Burkholderia graminis C4D1M]
          Length = 70

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V+DN   E A+R  K+ M+  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKDNEPFEVAMRRFKRTMEKSGLLTELRAREFYEKPTAERKRKKAAAVKRHFKRL 60

Query: 78 RKIAQREG 85
          R     + 
Sbjct: 61 RSQMLPKK 68


>gi|91789144|ref|YP_550096.1| 30S ribosomal protein S21 [Polaromonas sp. JS666]
 gi|121604294|ref|YP_981623.1| 30S ribosomal protein S21 [Polaromonas naphthalenivorans CJ2]
 gi|119367287|sp|Q127U4|RS21_POLSJ RecName: Full=30S ribosomal protein S21
 gi|166224049|sp|A1VM24|RS21_POLNA RecName: Full=30S ribosomal protein S21
 gi|91698369|gb|ABE45198.1| SSU ribosomal protein S21P [Polaromonas sp. JS666]
 gi|120593263|gb|ABM36702.1| SSU ribosomal protein S21P [Polaromonas naphthalenivorans CJ2]
          Length = 70

 Score = 45.3 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V+DN   + ALR  K+ ++  G+L +L+ R  YEKP+ +R R K+ A++R+ K +
Sbjct: 1  MTTIRVKDNEPFDVALRRFKRTIEKLGLLTDLRAREFYEKPTAERKRKKAAAVKRNYKRI 60

Query: 78 RKIAQREGA 86
          R +   +  
Sbjct: 61 RAMQLPKKL 69


>gi|54778774|gb|AAV39608.1| ribosomal protein S21 [synthetic construct]
          Length = 98

 Score = 44.9 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 1/75 (1%)

Query: 16 EISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          +     + VR+N   + ALR  K+  +  GVL E++ R  YEKP+ +R R K+ A++R  
Sbjct: 22 KHMTPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHA 81

Query: 75 KLMRKIAQREGAPVS 89
          K + +   R      
Sbjct: 82 KKLARENARRTRLYG 96


>gi|71891848|ref|YP_277577.1| 30S ribosomal subunit protein S21 [Candidatus Blochmannia
          pennsylvanicus str. BPEN]
 gi|119367237|sp|Q493X9|RS21_BLOPB RecName: Full=30S ribosomal protein S21
 gi|71795954|gb|AAZ40705.1| 30S ribosomal subunit protein S21 [Candidatus Blochmannia
          pennsylvanicus str. BPEN]
          Length = 71

 Score = 44.9 bits (105), Expect = 0.003,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+ +R R K+ AI+R  K +
Sbjct: 1  MPIIKVRENESFDVALRRFKRSCEKSGILSEVRRREFYEKPTTERKRAKASAIKRHIKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENLRR 67


>gi|94676489|ref|YP_589043.1| 30S ribosomal protein S21 [Baumannia cicadellinicola str. Hc
          (Homalodisca coagulata)]
 gi|119367236|sp|Q1LSM1|RS21_BAUCH RecName: Full=30S ribosomal protein S21
 gi|94219639|gb|ABF13798.1| ribosomal protein S21 [Baumannia cicadellinicola str. Hc
          (Homalodisca coagulata)]
          Length = 71

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VRDN   E ALR  K+  +  G+L E++ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MPVIKVRDNEPFEVALRRFKRSCEKAGILSEVRRREFYEKPTTERKRAKASAVKRYTKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|332288974|ref|YP_004419826.1| 30S ribosomal protein S21 [Gallibacterium anatis UMN179]
 gi|330431870|gb|AEC16929.1| 30S ribosomal protein S21 [Gallibacterium anatis UMN179]
          Length = 71

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R K+ A +R  K +
Sbjct: 1  MPVIKVRENESFDVALRRFKRSCEKAGILAEVRSREFYEKPTTIRKREKASAAKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARH 67


>gi|319779664|ref|YP_004130577.1| SSU ribosomal protein S21p [Taylorella equigenitalis MCE9]
 gi|317109688|gb|ADU92434.1| SSU ribosomal protein S21p [Taylorella equigenitalis MCE9]
          Length = 70

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 32/54 (59%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           +   E ALR  K+ ++  G+L +L+ R  YEKP+ +R R  + A++R  K +R
Sbjct: 8  ENEQFESALRRFKRTIEKTGLLTDLRAREFYEKPTTERKRKHAAAVKRHHKRIR 61


>gi|94499956|ref|ZP_01306491.1| ribosomal protein S21 [Oceanobacter sp. RED65]
 gi|94427814|gb|EAT12789.1| ribosomal protein S21 [Oceanobacter sp. RED65]
          Length = 71

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 39/66 (59%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+  +  GVL E++ R  +EKP+ +R R K+ A++R +K +
Sbjct: 1  MPQVKVKENEPFDVALRRFKRSCEKAGVLSEVRRREQFEKPTAERKRKKAAAVKRHQKKV 60

Query: 78 RKIAQR 83
           +  ++
Sbjct: 61 MREQRK 66


>gi|124266430|ref|YP_001020434.1| 30S ribosomal protein S21 [Methylibium petroleiphilum PM1]
 gi|166224041|sp|A2SF60|RS21_METPP RecName: Full=30S ribosomal protein S21
 gi|124259205|gb|ABM94199.1| SSU ribosomal protein S21P [Methylibium petroleiphilum PM1]
          Length = 70

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+ ++  G+L +L+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTVRVKENEPFDVALRRFKRTIEKIGLLTDLRAREFYEKPTAERKRKKAAAVKRHFKRV 60

Query: 78 RKIAQREGA 86
          R +   +  
Sbjct: 61 RSMQLPKKL 69


>gi|91777314|ref|YP_552522.1| 30S ribosomal protein S21 [Burkholderia xenovorans LB400]
 gi|296159639|ref|ZP_06842462.1| ribosomal protein S21 [Burkholderia sp. Ch1-1]
 gi|119367217|sp|Q13RW7|RS212_BURXL RecName: Full=30S ribosomal protein S21 2
 gi|91689974|gb|ABE33172.1| SSU ribosomal protein S21P [Burkholderia xenovorans LB400]
 gi|295890083|gb|EFG69878.1| ribosomal protein S21 [Burkholderia sp. Ch1-1]
          Length = 70

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/61 (39%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V+DN   E A+R  K+ M+  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKDNEPFEVAMRRFKRTMEKTGLLTELRAREFYEKPTAERKRKKAAAVKRHFKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|117618153|ref|YP_855375.1| 30S ribosomal protein S21 [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|145300339|ref|YP_001143180.1| 30S ribosomal protein S21 [Aeromonas salmonicida subsp.
          salmonicida A449]
 gi|330831097|ref|YP_004394049.1| 30S ribosomal protein S21 [Aeromonas veronii B565]
 gi|166224006|sp|A0KGI4|RS21_AERHH RecName: Full=30S ribosomal protein S21
 gi|166224007|sp|A4SRB0|RS21_AERS4 RecName: Full=30S ribosomal protein S21
 gi|117559560|gb|ABK36508.1| ribosomal protein S21 [Aeromonas hydrophila subsp. hydrophila
          ATCC 7966]
 gi|142853111|gb|ABO91432.1| ribosomal protein S21 [Aeromonas salmonicida subsp. salmonicida
          A449]
 gi|328806233|gb|AEB51432.1| 30S ribosomal protein S21 [Aeromonas veronii B565]
          Length = 71

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R K+ A++R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGILSEVRSREFYEKPTTIRKRAKASAVKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|307726546|ref|YP_003909759.1| 30S ribosomal protein S21 [Burkholderia sp. CCGE1003]
 gi|323529248|ref|YP_004231400.1| ribosomal protein S21 [Burkholderia sp. CCGE1001]
 gi|307587071|gb|ADN60468.1| ribosomal protein S21 [Burkholderia sp. CCGE1003]
 gi|323386250|gb|ADX58340.1| ribosomal protein S21 [Burkholderia sp. CCGE1001]
          Length = 70

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V+DN   E A+R  K+ M+  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKDNEPFEVAMRRFKRTMEKNGLLTELRAREFYEKPTAERKRKKAAAVKRHFKRL 60

Query: 78 RKIAQREG 85
          R     + 
Sbjct: 61 RSQMLPKK 68


>gi|33593190|ref|NP_880834.1| 30S ribosomal protein S21 [Bordetella pertussis Tohama I]
 gi|161609270|ref|NP_889699.2| 30S ribosomal protein S21 [Bordetella bronchiseptica RB50]
 gi|161610389|ref|NP_885042.2| 30S ribosomal protein S21 [Bordetella parapertussis 12822]
 gi|163856344|ref|YP_001630642.1| 30S ribosomal protein S21 [Bordetella petrii DSM 12804]
 gi|293604554|ref|ZP_06686959.1| 30S ribosomal protein S21 [Achromobacter piechaudii ATCC 43553]
 gi|311105372|ref|YP_003978225.1| 30S ribosomal protein S21 [Achromobacter xylosoxidans A8]
 gi|61216024|sp|Q7VWM3|RS21_BORPE RecName: Full=30S ribosomal protein S21
 gi|61216029|sp|Q7W6Q9|RS21_BORPA RecName: Full=30S ribosomal protein S21
 gi|61216031|sp|Q7WHP3|RS21_BORBR RecName: Full=30S ribosomal protein S21
 gi|226694981|sp|A9IK87|RS21_BORPD RecName: Full=30S ribosomal protein S21
 gi|33563565|emb|CAE42464.1| 30S ribosomal protein S21 [Bordetella pertussis Tohama I]
 gi|163260072|emb|CAP42373.1| 30S ribosomal protein S21 [Bordetella petrii]
 gi|292817135|gb|EFF76211.1| 30S ribosomal protein S21 [Achromobacter piechaudii ATCC 43553]
 gi|310760061|gb|ADP15510.1| ribosomal protein S21 [Achromobacter xylosoxidans A8]
 gi|317403351|gb|EFV83864.1| 30S ribosomal protein S21 [Achromobacter xylosoxidans C54]
 gi|332382601|gb|AEE67448.1| 30S ribosomal protein S21 [Bordetella pertussis CS]
          Length = 70

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +++N   E ALR  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPIVRLKENEPFEAALRRFKRTIEKTGLLTELRSREFYEKPTAERKRKHAAAVKRHYKRI 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|238918480|ref|YP_002931994.1| 30S ribosomal protein S21 [Edwardsiella ictaluri 93-146]
 gi|269137814|ref|YP_003294514.1| 30S ribosomal protein S21 [Edwardsiella tarda EIB202]
 gi|259494883|sp|C5BHG0|RS21_EDWI9 RecName: Full=30S ribosomal protein S21
 gi|238868048|gb|ACR67759.1| ribosomal protein S21, putative [Edwardsiella ictaluri 93-146]
 gi|267983474|gb|ACY83303.1| 30S ribosomal protein S21 [Edwardsiella tarda EIB202]
 gi|304557869|gb|ADM40533.1| SSU ribosomal protein S21p [Edwardsiella tarda FL6-60]
          Length = 71

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGILAEVRRREFYEKPTTERKRAKASAVKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|49082376|gb|AAT50588.1| PA0579 [synthetic construct]
          Length = 72

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 22/72 (30%), Positives = 38/72 (52%), Gaps = 1/72 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+  +  GVL E++ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAERKRKAAAAVKRHAKKV 60

Query: 78 RKIAQREGAPVS 89
          ++  +R      
Sbjct: 61 QREQRRRERLYG 72


>gi|192359130|ref|YP_001981275.1| 30S ribosomal protein S21 [Cellvibrio japonicus Ueda107]
 gi|226694983|sp|B3PKA4|RS21_CELJU RecName: Full=30S ribosomal protein S21
 gi|190685295|gb|ACE82973.1| ribosomal protein S21 [Cellvibrio japonicus Ueda107]
          Length = 71

 Score = 44.9 bits (105), Expect = 0.004,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +++N   + ALR  K+  +  G+L +++ R  YEKP+  R R  + A++R  K +
Sbjct: 1  MPSVKIKENEPFDVALRRFKRACEKAGILADVRARECYEKPTTVRKREAAAAVKRHAKKV 60

Query: 78 RKIAQR 83
          ++ +++
Sbjct: 61 QRESKK 66


>gi|88858403|ref|ZP_01133045.1| ribosomal protein S21 [Pseudoalteromonas tunicata D2]
 gi|88820020|gb|EAR29833.1| ribosomal protein S21 [Pseudoalteromonas tunicata D2]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L +++ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGILSDVRSREFYEKPTAERKRKKAAAVKRHMKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|323163115|gb|EFZ48948.1| ribosomal protein S21 [Escherichia coli E128010]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  GVL E++ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGVLAEIRRREFYEKPTTERKRAKASAVKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|296116574|ref|ZP_06835184.1| hypothetical protein GXY_12243 [Gluconacetobacter hansenii ATCC
          23769]
 gi|295976786|gb|EFG83554.1| hypothetical protein GXY_12243 [Gluconacetobacter hansenii ATCC
          23769]
          Length = 47

 Score = 44.5 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 26/46 (56%), Positives = 37/46 (80%)

Query: 40 MQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREG 85
          MQ EG+ RE+K+R HYEKPS+++ R  +EA+RR+RK+ RK  +REG
Sbjct: 1  MQREGIFREMKLRRHYEKPSERKAREAAEAVRRARKMERKRLEREG 46


>gi|258623779|ref|ZP_05718736.1| 30S ribosomal protein S21 [Vibrio mimicus VM603]
 gi|258583902|gb|EEW08694.1| 30S ribosomal protein S21 [Vibrio mimicus VM603]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N     ALR  K+  +  G+L E++ R HYEKP+  R R K+ A +R  K +
Sbjct: 1  MPVVKVRENEPFNVALRRFKRSCEKAGILSEVRRREHYEKPTTVRKRAKAAAQKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|226500430|ref|NP_001150588.1| LOC100284221 [Zea mays]
 gi|195640380|gb|ACG39658.1| ribosome-like protein [Zea mays]
          Length = 155

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 18 SAVYVLVRDNNVEQAL-RVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
            V +LV +N  E+++ R  ++++   GVL+E+K R  YE  + ++ R   EA
Sbjct: 47 YNVQILVDENEGEESIFRRFRREVMRAGVLQEIKRRRRYESKTDEKKRKAREA 99


>gi|54307646|ref|YP_128666.1| 30S ribosomal protein S21 [Photobacterium profundum SS9]
 gi|90411912|ref|ZP_01219920.1| 30S ribosomal protein S21 [Photobacterium profundum 3TCK]
 gi|90580770|ref|ZP_01236573.1| 30S ribosomal protein S21 [Vibrio angustum S14]
 gi|269103526|ref|ZP_06156223.1| SSU ribosomal protein S21p [Photobacterium damselae subsp.
          damselae CIP 102761]
 gi|330448775|ref|ZP_08312422.1| ribosomal protein S21 [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
 gi|81697517|sp|Q6LV11|RS21_PHOPR RecName: Full=30S ribosomal protein S21
 gi|46912069|emb|CAG18864.1| putative ribosomal protein S21 [Photobacterium profundum SS9]
 gi|90327170|gb|EAS43542.1| 30S ribosomal protein S21 [Photobacterium profundum 3TCK]
 gi|90438038|gb|EAS63226.1| 30S ribosomal protein S21 [Vibrio angustum S14]
 gi|268163424|gb|EEZ41920.1| SSU ribosomal protein S21p [Photobacterium damselae subsp.
          damselae CIP 102761]
 gi|328492966|dbj|GAA06919.1| ribosomal protein S21 [Photobacterium leiognathi subsp.
          mandapamensis svers.1.1.]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R H+EKP+  R R K+ A++R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGILSEVRRREHFEKPTTVRKRAKAAAVKRHLKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|332704208|ref|ZP_08424296.1| 30S ribosomal protein S21 [Desulfovibrio africanus str. Walvis
          Bay]
 gi|332554357|gb|EGJ51401.1| 30S ribosomal protein S21 [Desulfovibrio africanus str. Walvis
          Bay]
          Length = 68

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 17/35 (48%), Positives = 25/35 (71%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQK 61
          +N + +LR  KK+++  GVL ELK R H+EKPS +
Sbjct: 12 DNFDISLRRFKKQVEKAGVLSELKKRQHFEKPSVQ 46


>gi|313673001|ref|YP_004051112.1| ribosomal protein s21 [Calditerrivibrio nitroreducens DSM 19672]
 gi|312939757|gb|ADR18949.1| ribosomal protein S21 [Calditerrivibrio nitroreducens DSM 19672]
          Length = 72

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 27/62 (43%), Positives = 46/62 (74%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
          V V   NV+QAL++LKKK++ EG++RE+K   +YEKP++ + R   +A R+ +KL+RK+ 
Sbjct: 7  VKVDGENVDQALKLLKKKVEREGLVREIKKHAYYEKPTEVKRRKILKAKRKQQKLVRKLQ 66

Query: 82 QR 83
          ++
Sbjct: 67 EK 68


>gi|242279080|ref|YP_002991209.1| 30S ribosomal protein S21 [Desulfovibrio salexigens DSM 2638]
 gi|259494880|sp|C6BSW6|RS21_DESAD RecName: Full=30S ribosomal protein S21
 gi|242121974|gb|ACS79670.1| ribosomal protein S21 [Desulfovibrio salexigens DSM 2638]
          Length = 66

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 28/54 (51%), Positives = 37/54 (68%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
          +N E ALR  KK+++  GVL ELK R HYEKPS +R + K+ A +R  K MRK+
Sbjct: 10 DNFEIALRRFKKQVEKAGVLSELKKRQHYEKPSVQRKKKKAAARKRLIKKMRKM 63


>gi|320355010|ref|YP_004196349.1| 30S ribosomal protein S21P [Desulfobulbus propionicus DSM 2032]
 gi|320123512|gb|ADW19058.1| SSU ribosomal protein S21P [Desulfobulbus propionicus DSM 2032]
          Length = 64

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + V VR  ++E A+R LKKK+Q +G+ RELK R +YEKPS K+ R  +EA+R+ RK  R
Sbjct: 1  MIEVDVR-GDLEYAIRQLKKKLQIDGIKRELKRREYYEKPSVKKRRKAAEALRKLRKFNR 59

Query: 79 KIAQ 82
            ++
Sbjct: 60 MRSR 63


>gi|120610770|ref|YP_970448.1| 30S ribosomal protein S21 [Acidovorax citrulli AAC00-1]
 gi|121595179|ref|YP_987075.1| 30S ribosomal protein S21 [Acidovorax sp. JS42]
 gi|222111520|ref|YP_002553784.1| 30S ribosomal protein s21 [Acidovorax ebreus TPSY]
 gi|239816513|ref|YP_002945423.1| 30S ribosomal protein S21 [Variovorax paradoxus S110]
 gi|319763109|ref|YP_004127046.1| ribosomal protein s21 [Alicycliphilus denitrificans BC]
 gi|319794700|ref|YP_004156340.1| ribosomal protein s21 [Variovorax paradoxus EPS]
 gi|326317861|ref|YP_004235533.1| 30S ribosomal protein S21 [Acidovorax avenae subsp. avenae ATCC
          19860]
 gi|330825172|ref|YP_004388475.1| 30S ribosomal protein S21 [Alicycliphilus denitrificans K601]
 gi|166224003|sp|A1TNY6|RS21_ACIAC RecName: Full=30S ribosomal protein S21
 gi|166224004|sp|A1W9S4|RS21_ACISJ RecName: Full=30S ribosomal protein S21
 gi|254813614|sp|B9MC79|RS21_DIAST RecName: Full=30S ribosomal protein S21
 gi|259494896|sp|C5CTG9|RS21_VARPS RecName: Full=30S ribosomal protein S21
 gi|120589234|gb|ABM32674.1| SSU ribosomal protein S21P [Acidovorax citrulli AAC00-1]
 gi|120607259|gb|ABM42999.1| SSU ribosomal protein S21P [Acidovorax sp. JS42]
 gi|221730964|gb|ACM33784.1| ribosomal protein S21 [Acidovorax ebreus TPSY]
 gi|239803090|gb|ACS20157.1| ribosomal protein S21 [Variovorax paradoxus S110]
 gi|315597163|gb|ADU38229.1| ribosomal protein S21 [Variovorax paradoxus EPS]
 gi|317117670|gb|ADV00159.1| ribosomal protein S21 [Alicycliphilus denitrificans BC]
 gi|323374697|gb|ADX46966.1| 30S ribosomal protein S21 [Acidovorax avenae subsp. avenae ATCC
          19860]
 gi|329310544|gb|AEB84959.1| 30S ribosomal protein S21 [Alicycliphilus denitrificans K601]
          Length = 70

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   + ALR  K+ ++  G+L +L+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKENEPFDVALRRFKRTIEKLGLLTDLRAREFYEKPTAERKRKKAAAVKRHYKRV 60

Query: 78 RKIAQREGA 86
          R +   +  
Sbjct: 61 RSMQLPKKL 69


>gi|284008587|emb|CBA75165.1| 30S ribosomal subunit protein S21 [Arsenophonus nasoniae]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R K+ A++R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGILAEVRRREFYEKPTTVRKREKASAVKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|308273169|emb|CBX29772.1| 30S ribosomal protein S21 [uncultured Desulfobacterium sp.]
          Length = 68

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 46/65 (70%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V V DN++E+A+R+LKKK+Q +G+ + LK++  YEKPS+ R R + EA+RR R  + +
Sbjct: 4  IQVKVFDNDLEKAIRILKKKIQNDGLFKRLKLKKSYEKPSEFRRRKQREALRRERIAISR 63

Query: 80 IAQRE 84
             R+
Sbjct: 64 SKYRK 68


>gi|255578365|ref|XP_002530049.1| conserved hypothetical protein [Ricinus communis]
 gi|223530465|gb|EEF32349.1| conserved hypothetical protein [Ricinus communis]
          Length = 109

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/80 (28%), Positives = 42/80 (52%), Gaps = 3/80 (3%)

Query: 5  NAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRG-HYEKPSQKRV 63
          ++      + ++   + V V D N+E+AL V+++KMQ  G+ R +K    H+ K S+KRV
Sbjct: 19 DSLSQELYQIQQWRGIRVKVFDGNLERALTVMQRKMQSSGIERLIKREQIHHIKNSEKRV 78

Query: 64 RLKSEAIRRSRK--LMRKIA 81
            +     + +   L RK+ 
Sbjct: 79 LARKRLQHKIQSQELARKLK 98


>gi|332232085|ref|XP_003265233.1| PREDICTED: 28S ribosomal protein S21, mitochondrial-like
          [Nomascus leucogenys]
          Length = 70

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 27/55 (49%), Gaps = 4/55 (7%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
          +  A  V+V++ N+E A R L        ++  +K R +YEKP  +R R   E  
Sbjct: 6  KFIARTVMVQEGNMEGAYRTL----SMNRLIEGIKPRRYYEKPCHQRQRESYEKC 56


>gi|146329207|ref|YP_001209968.1| 30S ribosomal protein S21 [Dichelobacter nodosus VCS1703A]
 gi|166224029|sp|A5EXR7|RS21_DICNV RecName: Full=30S ribosomal protein S21
 gi|146232677|gb|ABQ13655.1| 30S ribosomal protein S21 [Dichelobacter nodosus VCS1703A]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 39/66 (59%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VRDN   + A+R  K+  +  GVL E++ R  YEKP+Q+R R  + A++R+ + +
Sbjct: 1  MPSVKVRDNEPFDVAMRRFKRSCEKAGVLAEVRSREFYEKPTQERKRKLAAAVKRNSRRL 60

Query: 78 RKIAQR 83
          +K   R
Sbjct: 61 KKERSR 66


>gi|209517797|ref|ZP_03266632.1| ribosomal protein S21 [Burkholderia sp. H160]
 gi|295700832|ref|YP_003608725.1| ribosomal protein S21 [Burkholderia sp. CCGE1002]
 gi|209501743|gb|EEA01764.1| ribosomal protein S21 [Burkholderia sp. H160]
 gi|295440045|gb|ADG19214.1| ribosomal protein S21 [Burkholderia sp. CCGE1002]
          Length = 70

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V+DN   E A+R  K+ M+  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKDNEPFEVAMRRFKRTMEKNGLLTELRAREFYEKPTAERKRKKAAAVKRHFKRL 60

Query: 78 RKIAQREGA 86
          R     +  
Sbjct: 61 RGQMLPKKL 69


>gi|195953119|ref|YP_002121409.1| 30S ribosomal protein S21 [Hydrogenobaculum sp. Y04AAS1]
 gi|226695018|sp|B4U8H0|RS21_HYDS0 RecName: Full=30S ribosomal protein S21
 gi|195932731|gb|ACG57431.1| ribosomal protein S21 [Hydrogenobaculum sp. Y04AAS1]
          Length = 67

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 34/53 (64%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
           E+A++  KK ++ EG+L ELK R  YEKPSQK+ R +  A +R  K M+K  
Sbjct: 12 FEKAMKRFKKVVEREGILSELKRREFYEKPSQKKKRKERAARKRLLKAMKKKR 64


>gi|329298673|ref|ZP_08256009.1| 30S ribosomal protein S21 [Plautia stali symbiont]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  GVL E++ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|238762465|ref|ZP_04623436.1| 30S ribosomal protein S21 [Yersinia kristensenii ATCC 33638]
 gi|238699450|gb|EEP92196.1| 30S ribosomal protein S21 [Yersinia kristensenii ATCC 33638]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  GVL E++ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|227902954|ref|ZP_04020759.1| 30S ribosomal protein S21 [Lactobacillus acidophilus ATCC 4796]
 gi|227869291|gb|EEJ76712.1| 30S ribosomal protein S21 [Lactobacillus acidophilus ATCC 4796]
          Length = 67

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  GVL E++ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|15803607|ref|NP_289640.1| 30S ribosomal protein S21 [Escherichia coli O157:H7 EDL933]
 gi|15833202|ref|NP_311975.1| 30S ribosomal protein S21 [Escherichia coli O157:H7 str. Sakai]
 gi|16130961|ref|NP_417537.1| 30S ribosomal subunit protein S21 [Escherichia coli str. K-12
          substr. MG1655]
 gi|16761983|ref|NP_457600.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhi str. CT18]
 gi|16766509|ref|NP_462124.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. LT2]
 gi|22127409|ref|NP_670832.1| 30S ribosomal protein S21 [Yersinia pestis KIM 10]
 gi|24114365|ref|NP_708875.1| 30S ribosomal protein S21 [Shigella flexneri 2a str. 301]
 gi|26249647|ref|NP_755687.1| 30S ribosomal protein S21 [Escherichia coli CFT073]
 gi|29143470|ref|NP_806812.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhi str. Ty2]
 gi|30064413|ref|NP_838584.1| 30S ribosomal protein S21 [Shigella flexneri 2a str. 2457T]
 gi|37527832|ref|NP_931177.1| 30S ribosomal protein S21 [Photorhabdus luminescens subsp.
          laumondii TTO1]
 gi|45442723|ref|NP_994262.1| 30S ribosomal protein S21 [Yersinia pestis biovar Microtus str.
          91001]
 gi|50119630|ref|YP_048797.1| 30S ribosomal protein S21 [Pectobacterium atrosepticum SCRI1043]
 gi|51597714|ref|YP_071905.1| 30S ribosomal protein S21 [Yersinia pseudotuberculosis IP 32953]
 gi|56415149|ref|YP_152224.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. ATCC 9150]
 gi|62181726|ref|YP_218143.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|74313600|ref|YP_312019.1| 30S ribosomal protein S21 [Shigella sonnei Ss046]
 gi|82545320|ref|YP_409267.1| 30S ribosomal protein S21 [Shigella boydii Sb227]
 gi|82778395|ref|YP_404744.1| 30S ribosomal protein S21 [Shigella dysenteriae Sd197]
 gi|85058231|ref|YP_453933.1| 30S ribosomal protein S21 [Sodalis glossinidius str. 'morsitans']
 gi|89109835|ref|AP_003615.1| 30S ribosomal subunit protein S21 [Escherichia coli str. K-12
          substr. W3110]
 gi|91212494|ref|YP_542480.1| 30S ribosomal protein S21 [Escherichia coli UTI89]
 gi|108809136|ref|YP_653052.1| 30S ribosomal protein S21 [Yersinia pestis Antiqua]
 gi|108810670|ref|YP_646437.1| 30S ribosomal protein S21 [Yersinia pestis Nepal516]
 gi|110643309|ref|YP_671039.1| 30S ribosomal protein S21 [Escherichia coli 536]
 gi|110806952|ref|YP_690472.1| 30S ribosomal protein S21 [Shigella flexneri 5 str. 8401]
 gi|123443866|ref|YP_001007837.1| 30S ribosomal protein S21 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|145597739|ref|YP_001161815.1| 30S ribosomal protein S21 [Yersinia pestis Pestoides F]
 gi|146313107|ref|YP_001178181.1| 30S ribosomal protein S21 [Enterobacter sp. 638]
 gi|150260323|ref|ZP_01917051.1| 30S ribosomal protein S21 [Yersinia pestis CA88-4125]
 gi|152971989|ref|YP_001337098.1| 30S ribosomal protein S21 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|153949671|ref|YP_001399548.1| 30S ribosomal protein S21 [Yersinia pseudotuberculosis IP 31758]
 gi|157148635|ref|YP_001455955.1| 30S ribosomal protein S21 [Citrobacter koseri ATCC BAA-895]
 gi|157156151|ref|YP_001464526.1| 30S ribosomal protein S21 [Escherichia coli E24377A]
 gi|157162541|ref|YP_001459859.1| 30S ribosomal protein S21 [Escherichia coli HS]
 gi|157372531|ref|YP_001480520.1| 30S ribosomal protein S21 [Serratia proteamaculans 568]
 gi|161506227|ref|YP_001573339.1| 30S ribosomal protein S21 [Salmonella enterica subsp. arizonae
          serovar 62:z4,z23:-- str. RSK2980]
 gi|161616202|ref|YP_001590167.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Paratyphi B str. SPB7]
 gi|162420391|ref|YP_001604918.1| 30S ribosomal protein S21 [Yersinia pestis Angola]
 gi|165925133|ref|ZP_02220965.1| ribosomal protein S21 [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|166008995|ref|ZP_02229893.1| ribosomal protein S21 [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166211967|ref|ZP_02238002.1| ribosomal protein S21 [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|167399388|ref|ZP_02304912.1| ribosomal protein S21 [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167419236|ref|ZP_02310989.1| ribosomal protein S21 [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167425182|ref|ZP_02316935.1| ribosomal protein S21 [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|167551875|ref|ZP_02345628.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA29]
 gi|167990236|ref|ZP_02571336.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar 4,[5],12:i:- str. CVM23701]
 gi|168231812|ref|ZP_02656870.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CDC 191]
 gi|168243040|ref|ZP_02667972.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL486]
 gi|168262829|ref|ZP_02684802.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
 gi|168463578|ref|ZP_02697495.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|168754036|ref|ZP_02779043.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4401]
 gi|168769474|ref|ZP_02794481.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4486]
 gi|168773278|ref|ZP_02798285.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4196]
 gi|168785940|ref|ZP_02810947.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC869]
 gi|168797657|ref|ZP_02822664.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC508]
 gi|168819725|ref|ZP_02831725.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. HI_N05-537]
 gi|170018683|ref|YP_001723637.1| 30S ribosomal protein S21 [Escherichia coli ATCC 8739]
 gi|170022887|ref|YP_001719392.1| 30S ribosomal protein S21 [Yersinia pseudotuberculosis YPIII]
 gi|170082608|ref|YP_001731928.1| 30S ribosomal subunit protein S21 [Escherichia coli str. K-12
          substr. DH10B]
 gi|170680203|ref|YP_001745337.1| 30S ribosomal protein S21 [Escherichia coli SMS-3-5]
 gi|170765906|ref|ZP_02900717.1| ribosomal protein S21 [Escherichia albertii TW07627]
 gi|183597878|ref|ZP_02959371.1| hypothetical protein PROSTU_01213 [Providencia stuartii ATCC
          25827]
 gi|186896858|ref|YP_001873970.1| 30S ribosomal protein S21 [Yersinia pseudotuberculosis PB1/+]
 gi|187731585|ref|YP_001881827.1| 30S ribosomal protein S21 [Shigella boydii CDC 3083-94]
 gi|188493550|ref|ZP_03000820.1| ribosomal protein S21 [Escherichia coli 53638]
 gi|188532571|ref|YP_001906368.1| 30S ribosomal protein S21 [Erwinia tasmaniensis Et1/99]
 gi|193062119|ref|ZP_03043215.1| ribosomal protein S21 [Escherichia coli E22]
 gi|193067357|ref|ZP_03048325.1| ribosomal protein S21 [Escherichia coli E110019]
 gi|194431815|ref|ZP_03064106.1| ribosomal protein S21 [Shigella dysenteriae 1012]
 gi|194444125|ref|YP_002042476.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194448162|ref|YP_002047207.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|194471886|ref|ZP_03077870.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|194735467|ref|YP_002116166.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|195937211|ref|ZP_03082593.1| 30S ribosomal protein S21 [Escherichia coli O157:H7 str. EC4024]
 gi|197250864|ref|YP_002148139.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|197265061|ref|ZP_03165135.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197286216|ref|YP_002152088.1| 30S ribosomal protein S21 [Proteus mirabilis HI4320]
 gi|197364079|ref|YP_002143716.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Paratyphi A str. AKU_12601]
 gi|198243486|ref|YP_002217190.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|200388553|ref|ZP_03215165.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|204927993|ref|ZP_03219193.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|205354124|ref|YP_002227925.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 287/91]
 gi|206576861|ref|YP_002236520.1| ribosomal protein S21 [Klebsiella pneumoniae 342]
 gi|207858467|ref|YP_002245118.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Enteritidis str. P125109]
 gi|208806765|ref|ZP_03249102.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4206]
 gi|208812053|ref|ZP_03253382.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4045]
 gi|208818960|ref|ZP_03259280.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4042]
 gi|209396168|ref|YP_002272538.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4115]
 gi|209920537|ref|YP_002294621.1| 30S ribosomal protein S21 [Escherichia coli SE11]
 gi|212711169|ref|ZP_03319297.1| hypothetical protein PROVALCAL_02241 [Providencia alcalifaciens
          DSM 30120]
 gi|213026991|ref|ZP_03341438.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhi str. 404ty]
 gi|213161045|ref|ZP_03346755.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhi str. E00-7866]
 gi|213416611|ref|ZP_03349755.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhi str. E01-6750]
 gi|213425628|ref|ZP_03358378.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhi str. E02-1180]
 gi|213579983|ref|ZP_03361809.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-0664]
 gi|213616354|ref|ZP_03372180.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-2068]
 gi|213646108|ref|ZP_03376161.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhi str. J185]
 gi|213855454|ref|ZP_03383694.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhi str. M223]
 gi|215488396|ref|YP_002330827.1| 30S ribosomal protein S21 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217326850|ref|ZP_03442933.1| ribosomal protein S21 [Escherichia coli O157:H7 str. TW14588]
 gi|218550314|ref|YP_002384105.1| 30S ribosomal protein S21 [Escherichia fergusonii ATCC 35469]
 gi|218555635|ref|YP_002388548.1| 30S ribosomal protein S21 [Escherichia coli IAI1]
 gi|218560152|ref|YP_002393065.1| 30S ribosomal protein S21 [Escherichia coli S88]
 gi|218691370|ref|YP_002399582.1| 30S ribosomal protein S21 [Escherichia coli ED1a]
 gi|218696770|ref|YP_002404437.1| 30S ribosomal protein S21 [Escherichia coli 55989]
 gi|218701836|ref|YP_002409465.1| 30S ribosomal protein S21 [Escherichia coli IAI39]
 gi|218706690|ref|YP_002414209.1| 30S ribosomal protein S21 [Escherichia coli UMN026]
 gi|218927838|ref|YP_002345713.1| 30S ribosomal protein S21 [Yersinia pestis CO92]
 gi|224585012|ref|YP_002638811.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|227113750|ref|ZP_03827406.1| 30S ribosomal protein S21 [Pectobacterium carotovorum subsp.
          brasiliensis PBR1692]
 gi|227329607|ref|ZP_03833631.1| 30S ribosomal protein S21 [Pectobacterium carotovorum subsp.
          carotovorum WPP14]
 gi|227357332|ref|ZP_03841689.1| 30S ribosomal protein S21 [Proteus mirabilis ATCC 29906]
 gi|227887789|ref|ZP_04005594.1| 30S ribosomal protein S21 [Escherichia coli 83972]
 gi|229837323|ref|ZP_04457486.1| 30S ribosomal subunit protein S21 [Yersinia pestis Pestoides A]
 gi|229840535|ref|ZP_04460694.1| 30S ribosomal subunit protein S21 [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229900863|ref|ZP_04515987.1| 30S ribosomal subunit protein S21 [Yersinia pestis Nepal516]
 gi|237706173|ref|ZP_04536654.1| ribosomal protein S21 [Escherichia sp. 3_2_53FAA]
 gi|237729993|ref|ZP_04560474.1| ribosomal protein S21 [Citrobacter sp. 30_2]
 gi|238750947|ref|ZP_04612444.1| 30S ribosomal protein S21 [Yersinia rohdei ATCC 43380]
 gi|238756614|ref|ZP_04617909.1| 30S ribosomal protein S21 [Yersinia ruckeri ATCC 29473]
 gi|238760055|ref|ZP_04621206.1| 30S ribosomal protein S21 [Yersinia aldovae ATCC 35236]
 gi|238782838|ref|ZP_04626867.1| 30S ribosomal protein S21 [Yersinia bercovieri ATCC 43970]
 gi|238789195|ref|ZP_04632983.1| 30S ribosomal protein S21 [Yersinia frederiksenii ATCC 33641]
 gi|238794323|ref|ZP_04637935.1| 30S ribosomal protein S21 [Yersinia intermedia ATCC 29909]
 gi|238796948|ref|ZP_04640452.1| 30S ribosomal protein S21 [Yersinia mollaretii ATCC 43969]
 gi|238896569|ref|YP_002921312.1| 30S ribosomal protein S21 [Klebsiella pneumoniae NTUH-K2044]
 gi|238902176|ref|YP_002927972.1| 30S ribosomal subunit protein S21 [Escherichia coli BW2952]
 gi|238910012|ref|ZP_04653849.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Tennessee str. CDC07-0191]
 gi|242240771|ref|YP_002988952.1| ribosomal protein S21 [Dickeya dadantii Ech703]
 gi|251791056|ref|YP_003005777.1| 30S ribosomal protein S21 [Dickeya zeae Ech1591]
 gi|253686951|ref|YP_003016141.1| ribosomal protein S21 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|253772099|ref|YP_003034930.1| 30S ribosomal protein S21 [Escherichia coli 'BL21-Gold(DE3)pLysS
          AG']
 gi|253991031|ref|YP_003042387.1| 30S ribosomal protein S21 [Photorhabdus asymbiotica subsp.
          asymbiotica ATCC 43949]
 gi|254038234|ref|ZP_04872292.1| ribosomal protein S21 [Escherichia sp. 1_1_43]
 gi|254163012|ref|YP_003046120.1| 30S ribosomal protein S21 [Escherichia coli B str. REL606]
 gi|254795016|ref|YP_003079853.1| 30S ribosomal protein S21 [Escherichia coli O157:H7 str. TW14359]
 gi|256019019|ref|ZP_05432884.1| 30S ribosomal protein S21 [Shigella sp. D9]
 gi|256024355|ref|ZP_05438220.1| 30S ribosomal protein S21 [Escherichia sp. 4_1_40B]
 gi|259907102|ref|YP_002647458.1| 30S ribosomal protein S21 [Erwinia pyrifoliae Ep1/96]
 gi|260599322|ref|YP_003211893.1| 30S ribosomal protein S21 [Cronobacter turicensis z3032]
 gi|260845819|ref|YP_003223597.1| 30S ribosomal subunit protein S21 [Escherichia coli O103:H2 str.
          12009]
 gi|260857195|ref|YP_003231086.1| 30S ribosomal subunit protein S21 [Escherichia coli O26:H11 str.
          11368]
 gi|260869817|ref|YP_003236219.1| 30S ribosomal subunit protein S21 [Escherichia coli O111:H- str.
          11128]
 gi|261228078|ref|ZP_05942359.1| 30S ribosomal subunit protein S21 [Escherichia coli O157:H7 str.
          FRIK2000]
 gi|261254934|ref|ZP_05947467.1| 30S ribosomal subunit protein S21 [Escherichia coli O157:H7 str.
          FRIK966]
 gi|261342493|ref|ZP_05970351.1| ribosomal protein S21 [Enterobacter cancerogenus ATCC 35316]
 gi|261344810|ref|ZP_05972454.1| ribosomal protein S21 [Providencia rustigianii DSM 4541]
 gi|261820105|ref|YP_003258211.1| 30S ribosomal protein S21 [Pectobacterium wasabiae WPP163]
 gi|262042265|ref|ZP_06015430.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|268590606|ref|ZP_06124827.1| ribosomal protein S21 [Providencia rettgeri DSM 1131]
 gi|270263177|ref|ZP_06191447.1| 30S ribosomal protein S21 [Serratia odorifera 4Rx13]
 gi|270487761|ref|ZP_06204835.1| ribosomal protein S21 [Yersinia pestis KIM D27]
 gi|271499152|ref|YP_003332177.1| 30S ribosomal protein S21 [Dickeya dadantii Ech586]
 gi|283787201|ref|YP_003367066.1| 30S ribosomal subunit protein S21 [Citrobacter rodentium ICC168]
 gi|283836399|ref|ZP_06356140.1| ribosomal protein S21 [Citrobacter youngae ATCC 29220]
 gi|288933505|ref|YP_003437564.1| ribosomal protein S21 [Klebsiella variicola At-22]
 gi|289827083|ref|ZP_06545872.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhi str. E98-3139]
 gi|290474858|ref|YP_003467738.1| 30S ribosomal subunit protein S21 [Xenorhabdus bovienii SS-2004]
 gi|290511436|ref|ZP_06550805.1| 30S ribosomal protein S21 [Klebsiella sp. 1_1_55]
 gi|291284444|ref|YP_003501262.1| Ribosomal protein S21 [Escherichia coli O55:H7 str. CB9615]
 gi|291618941|ref|YP_003521683.1| RpsU [Pantoea ananatis LMG 20103]
 gi|292486905|ref|YP_003529775.1| 30S ribosomal protein S21 [Erwinia amylovora CFBP1430]
 gi|292900700|ref|YP_003540069.1| 30S ribosomal protein S21 [Erwinia amylovora ATCC 49946]
 gi|293394295|ref|ZP_06638595.1| 30S ribosomal protein S21 [Serratia odorifera DSM 4582]
 gi|293406678|ref|ZP_06650604.1| rpsU [Escherichia coli FVEC1412]
 gi|293412442|ref|ZP_06655165.1| 30S ribosomal protein S21 [Escherichia coli B354]
 gi|293416504|ref|ZP_06659143.1| 30S ribosomal protein S21 [Escherichia coli B185]
 gi|293449403|ref|ZP_06663824.1| 30S ribosomal protein S21 [Escherichia coli B088]
 gi|296104729|ref|YP_003614875.1| 30S ribosomal protein S21 [Enterobacter cloacae subsp. cloacae
          ATCC 13047]
 gi|298382419|ref|ZP_06992016.1| small subunit ribosomal protein S21 [Escherichia coli FVEC1302]
 gi|300718453|ref|YP_003743256.1| 30S ribosomal protein S21 [Erwinia billingiae Eb661]
 gi|300724879|ref|YP_003714204.1| 30S ribosomal subunit protein S21 [Xenorhabdus nematophila ATCC
          19061]
 gi|300818832|ref|ZP_07099038.1| ribosomal protein S21 [Escherichia coli MS 107-1]
 gi|300821660|ref|ZP_07101806.1| ribosomal protein S21 [Escherichia coli MS 119-7]
 gi|300901447|ref|ZP_07119532.1| ribosomal protein S21 [Escherichia coli MS 198-1]
 gi|300905794|ref|ZP_07123528.1| ribosomal protein S21 [Escherichia coli MS 84-1]
 gi|300917396|ref|ZP_07134062.1| ribosomal protein S21 [Escherichia coli MS 115-1]
 gi|300923727|ref|ZP_07139752.1| ribosomal protein S21 [Escherichia coli MS 182-1]
 gi|300931951|ref|ZP_07147248.1| ribosomal protein S21 [Escherichia coli MS 187-1]
 gi|300937451|ref|ZP_07152277.1| ribosomal protein S21 [Escherichia coli MS 21-1]
 gi|300950725|ref|ZP_07164613.1| ribosomal protein S21 [Escherichia coli MS 116-1]
 gi|300958452|ref|ZP_07170591.1| ribosomal protein S21 [Escherichia coli MS 175-1]
 gi|300973234|ref|ZP_07172073.1| ribosomal protein S21 [Escherichia coli MS 45-1]
 gi|300977464|ref|ZP_07173927.1| ribosomal protein S21 [Escherichia coli MS 200-1]
 gi|301021229|ref|ZP_07185261.1| ribosomal protein S21 [Escherichia coli MS 196-1]
 gi|301021857|ref|ZP_07185820.1| ribosomal protein S21 [Escherichia coli MS 69-1]
 gi|301048098|ref|ZP_07195136.1| ribosomal protein S21 [Escherichia coli MS 185-1]
 gi|301301893|ref|ZP_07208027.1| ribosomal protein S21 [Escherichia coli MS 124-1]
 gi|301325581|ref|ZP_07219049.1| ribosomal protein S21 [Escherichia coli MS 78-1]
 gi|301644761|ref|ZP_07244736.1| ribosomal protein S21 [Escherichia coli MS 146-1]
 gi|304396865|ref|ZP_07378745.1| ribosomal protein S21 [Pantoea sp. aB]
 gi|306816581|ref|ZP_07450713.1| 30S ribosomal protein S21 [Escherichia coli NC101]
 gi|307129362|ref|YP_003881378.1| 30S ribosomal subunit protein S21 [Dickeya dadantii 3937]
 gi|307139753|ref|ZP_07499109.1| 30S ribosomal protein S21 [Escherichia coli H736]
 gi|307310310|ref|ZP_07589958.1| ribosomal protein S21 [Escherichia coli W]
 gi|308188144|ref|YP_003932275.1| 30S ribosomal protein S21 [Pantoea vagans C9-1]
 gi|309785374|ref|ZP_07680005.1| ribosomal protein S21 [Shigella dysenteriae 1617]
 gi|309793630|ref|ZP_07688056.1| ribosomal protein S21 [Escherichia coli MS 145-7]
 gi|311278026|ref|YP_003940257.1| ribosomal protein S21 [Enterobacter cloacae SCF1]
 gi|312968592|ref|ZP_07782801.1| ribosomal protein S21 [Escherichia coli 2362-75]
 gi|312972670|ref|ZP_07786843.1| ribosomal protein S21 [Escherichia coli 1827-70]
 gi|317049601|ref|YP_004117249.1| 30S ribosomal protein S21 [Pantoea sp. At-9b]
 gi|317493718|ref|ZP_07952135.1| ribosomal protein S21 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|320539901|ref|ZP_08039560.1| 30S ribosomal subunit protein S21 [Serratia symbiotica str.
          Tucson]
 gi|322831341|ref|YP_004211368.1| ribosomal protein S21 [Rahnella sp. Y9602]
 gi|331643763|ref|ZP_08344894.1| ribosomal protein S21 [Escherichia coli H736]
 gi|331648866|ref|ZP_08349954.1| ribosomal protein S21 [Escherichia coli M605]
 gi|331654664|ref|ZP_08355664.1| ribosomal protein S21 [Escherichia coli M718]
 gi|331659356|ref|ZP_08360298.1| ribosomal protein S21 [Escherichia coli TA206]
 gi|331664678|ref|ZP_08365584.1| ribosomal protein S21 [Escherichia coli TA143]
 gi|331669911|ref|ZP_08370756.1| ribosomal protein S21 [Escherichia coli TA271]
 gi|331674604|ref|ZP_08375364.1| ribosomal protein S21 [Escherichia coli TA280]
 gi|331679141|ref|ZP_08379813.1| ribosomal protein S21 [Escherichia coli H591]
 gi|331684717|ref|ZP_08385309.1| ribosomal protein S21 [Escherichia coli H299]
 gi|332162999|ref|YP_004299576.1| 30S ribosomal protein S21 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|332280118|ref|ZP_08392531.1| 30S ribosomal subunit protein S21 [Shigella sp. D9]
 gi|56405133|sp|P68679|RS21_ECOLI RecName: Full=30S ribosomal protein S21
 gi|56405134|sp|P68680|RS21_ECOL6 RecName: Full=30S ribosomal protein S21
 gi|56405135|sp|P68681|RS21_ECO57 RecName: Full=30S ribosomal protein S21
 gi|56405136|sp|P68682|RS21_PHOLL RecName: Full=30S ribosomal protein S21
 gi|56405137|sp|P68683|RS21_SALTI RecName: Full=30S ribosomal protein S21
 gi|56405138|sp|P68684|RS21_SALTY RecName: Full=30S ribosomal protein S21
 gi|56405139|sp|P68685|RS21_SHIFL RecName: Full=30S ribosomal protein S21
 gi|56405140|sp|P68686|RS21_YERPE RecName: Full=30S ribosomal protein S21
 gi|61215878|sp|Q665U4|RS21_YERPS RecName: Full=30S ribosomal protein S21
 gi|61215911|sp|Q6D9D4|RS21_ERWCT RecName: Full=30S ribosomal protein S21
 gi|75505548|sp|Q57JQ0|RS21_SALCH RecName: Full=30S ribosomal protein S21
 gi|81678061|sp|Q5PKX8|RS21_SALPA RecName: Full=30S ribosomal protein S21
 gi|119367257|sp|Q0TD41|RS21_ECOL5 RecName: Full=30S ribosomal protein S21
 gi|119367258|sp|Q1R6R5|RS21_ECOUT RecName: Full=30S ribosomal protein S21
 gi|119367310|sp|Q31WW9|RS21_SHIBS RecName: Full=30S ribosomal protein S21
 gi|119367311|sp|Q32BQ2|RS21_SHIDS RecName: Full=30S ribosomal protein S21
 gi|119367312|sp|Q3YXH8|RS21_SHISS RecName: Full=30S ribosomal protein S21
 gi|119367314|sp|Q2NWE7|RS21_SODGM RecName: Full=30S ribosomal protein S21
 gi|119367344|sp|Q1C365|RS21_YERPA RecName: Full=30S ribosomal protein S21
 gi|119367345|sp|Q1CME3|RS21_YERPN RecName: Full=30S ribosomal protein S21
 gi|123342508|sp|Q0T0J8|RS21_SHIF8 RecName: Full=30S ribosomal protein S21
 gi|166224022|sp|A8APV6|RS21_CITK8 RecName: Full=30S ribosomal protein S21
 gi|166224036|sp|A6TE47|RS21_KLEP7 RecName: Full=30S ribosomal protein S21
 gi|166225208|sp|A1JQX1|RS21_YERE8 RecName: Full=30S ribosomal protein S21
 gi|166225209|sp|A4THT0|RS21_YERPP RecName: Full=30S ribosomal protein S21
 gi|167011223|sp|A7ZRU7|RS21_ECO24 RecName: Full=30S ribosomal protein S21
 gi|167011224|sp|A8A4M2|RS21_ECOHS RecName: Full=30S ribosomal protein S21
 gi|167011225|sp|A4WEK0|RS21_ENT38 RecName: Full=30S ribosomal protein S21
 gi|167011228|sp|A8GJV2|RS21_SERP5 RecName: Full=30S ribosomal protein S21
 gi|167011229|sp|A7FE70|RS21_YERP3 RecName: Full=30S ribosomal protein S21
 gi|189044900|sp|B1IRQ1|RS21_ECOLC RecName: Full=30S ribosomal protein S21
 gi|189044911|sp|A9MPV4|RS21_SALAR RecName: Full=30S ribosomal protein S21
 gi|189044912|sp|A9N5Y8|RS21_SALPB RecName: Full=30S ribosomal protein S21
 gi|226695000|sp|B7MB01|RS21_ECO45 RecName: Full=30S ribosomal protein S21
 gi|226695001|sp|B5YRA5|RS21_ECO5E RecName: Full=30S ribosomal protein S21
 gi|226695002|sp|B7NJS8|RS21_ECO7I RecName: Full=30S ribosomal protein S21
 gi|226695003|sp|B7LZL5|RS21_ECO8A RecName: Full=30S ribosomal protein S21
 gi|226695004|sp|B1XG70|RS21_ECODH RecName: Full=30S ribosomal protein S21
 gi|226695005|sp|B7ND54|RS21_ECOLU RecName: Full=30S ribosomal protein S21
 gi|226695006|sp|B6I437|RS21_ECOSE RecName: Full=30S ribosomal protein S21
 gi|226695007|sp|B1LF57|RS21_ECOSM RecName: Full=30S ribosomal protein S21
 gi|226695009|sp|B2VGJ7|RS21_ERWT9 RecName: Full=30S ribosomal protein S21
 gi|226695010|sp|B7LQD9|RS21_ESCF3 RecName: Full=30S ribosomal protein S21
 gi|226695019|sp|B5XU21|RS21_KLEP3 RecName: Full=30S ribosomal protein S21
 gi|226695037|sp|B4EW58|RS21_PROMH RecName: Full=30S ribosomal protein S21
 gi|226695042|sp|B5F6A5|RS21_SALA4 RecName: Full=30S ribosomal protein S21
 gi|226695043|sp|B5FHU4|RS21_SALDC RecName: Full=30S ribosomal protein S21
 gi|226695044|sp|B5QZ45|RS21_SALEP RecName: Full=30S ribosomal protein S21
 gi|226695045|sp|B5REG7|RS21_SALG2 RecName: Full=30S ribosomal protein S21
 gi|226695046|sp|B4TI60|RS21_SALHS RecName: Full=30S ribosomal protein S21
 gi|226695047|sp|B4T679|RS21_SALNS RecName: Full=30S ribosomal protein S21
 gi|226695048|sp|B5BG21|RS21_SALPK RecName: Full=30S ribosomal protein S21
 gi|226695049|sp|B4TVU3|RS21_SALSV RecName: Full=30S ribosomal protein S21
 gi|226695052|sp|B2U1G8|RS21_SHIB3 RecName: Full=30S ribosomal protein S21
 gi|226695067|sp|B1JM17|RS21_YERPY RecName: Full=30S ribosomal protein S21
 gi|226732167|sp|B2K2I4|RS21_YERPB RecName: Full=30S ribosomal protein S21
 gi|226732168|sp|A9R7E4|RS21_YERPG RecName: Full=30S ribosomal protein S21
 gi|254813615|sp|B7UIX3|RS21_ECO27 RecName: Full=30S ribosomal protein S21
 gi|254813616|sp|B7LH01|RS21_ECO55 RecName: Full=30S ribosomal protein S21
 gi|254813617|sp|B7N0L5|RS21_ECO81 RecName: Full=30S ribosomal protein S21
 gi|254813729|sp|C0PYY2|RS21_SALPC RecName: Full=30S ribosomal protein S21
 gi|259494882|sp|C4ZQY2|RS21_ECOBW RecName: Full=30S ribosomal protein S21
 gi|259494891|sp|C6DKG8|RS21_PECCP RecName: Full=30S ribosomal protein S21
 gi|25294879|pir||AH0892 30S ribosomal chain protein S21 [imported] - Salmonella enterica
          subsp. enterica serovar Typhi (strain CT18)
 gi|83754060|pdb|2AVY|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 30s Subunit Of One 70s Ribosome. The
          Entire Crystal Structure Contains Two 70s Ribosomes And
          Is Described In Remark 400.
 gi|83754116|pdb|2AW7|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli At 3.5 A Resolution. This File
          Contains The 30s Subunit Of The Second 70s Ribosome.
          The Entire Crystal Structure Contains Two 70s Ribosomes
          And Is Described In Remark 400.
 gi|116666569|pdb|1VS5|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|116666621|pdb|1VS7|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With The Antibiotic
          Kasugamyin At 3.5a Resolution. This File Contains The
          30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|168988808|pdb|2VHO|U Chain U, Structure Of Pdf Binding Helix In Complex With The
          Ribosome (Part 3 Of 4)
 gi|168988829|pdb|2VHP|U Chain U, Structure Of Pdf Binding Helix In Complex With The
          Ribosome (Part 4 Of 4)
 gi|197107299|pdb|3DF1|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 30s Subunit Of The First 70s
          Ribosome, With Hygromycin B Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|197107351|pdb|3DF3|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Hygromycin B. This
          File Contains The 30s Subunit Of The Second 70s
          Ribosome, With Hygromycin B Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|256032365|pdb|3E1A|Q Chain Q, Structure Of The 30s Subunit And The Trnas Of E. Coli
          Ribosome In Pre-Accommodation State
 gi|256032422|pdb|3E1C|Q Chain Q, Structure Of The 30s Subunit And The Trnas Of E. Coli
          Ribosome In Post-Accommodation State
 gi|257097342|pdb|3I1M|U Chain U, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097394|pdb|3I1O|U Chain U, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097446|pdb|3I1Q|U Chain U, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097500|pdb|3I1S|U Chain U, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097554|pdb|3I1Z|U Chain U, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|257097609|pdb|3I21|U Chain U, Crystal Structure Of The E. Coli 70s Ribosome In An
          Intermediate State Of Ratcheting
 gi|290560327|pdb|3KC4|U Chain U, Ribosome-Secy Complex. This Entry 3kc4 Contains 30s
          Ribosomal Subnit. The 50s Ribosomal Subunit Can Be
          Found In Pdb Entry 3kcr
 gi|308198707|pdb|3OR9|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 30s Subunit Of The
          First 70s Ribosome.
 gi|308198728|pdb|3ORA|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
          Cem-101. This File Contains The 30s Subunit Of The
          Second 70s Ribosome.
 gi|326634299|pdb|3IZV|Y Chain Y, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding. This Entry Contains The
          Small Subunit Of A Ribosome Programmed With A
          Near-Cognate Codon, AT-Site Trna, P-Site Trna, Mrna And
          Ef-Tu
 gi|326634324|pdb|3IZW|Y Chain Y, Structural Insights Into Cognate Vs. Near-Cognate
          Discrimination During Decoding.This Entry Contains The
          Small Subunit Of A Ribosome Programmed With A Cognate
          Codon, AT-Site Trna, P-Site Trna, Mrna And Ef-Tu
 gi|12517644|gb|AAG58199.1|AE005535_11 30S ribosomal subunit protein S21 [Escherichia coli O157:H7 str.
          EDL933]
 gi|21960498|gb|AAM87083.1|AE013956_8 30S ribosomal subunit protein S21 [Yersinia pestis KIM 10]
 gi|26110075|gb|AAN82261.1|AE016767_21 30S ribosomal protein S21 [Escherichia coli CFT073]
 gi|42868|emb|CAA23635.1| unnamed protein product [Escherichia coli]
 gi|147754|gb|AAA24599.1| ribosomal protein S21 [Escherichia coli]
 gi|154404|gb|AAA27240.1| rpsU protein [Salmonella enterica subsp. enterica serovar
          Typhimurium]
 gi|882588|gb|AAA89145.1| 30S ribosomal subunit protein S21 [Escherichia coli str. K-12
          substr. MG1655]
 gi|1789446|gb|AAC76101.1| 30S ribosomal subunit protein S21 [Escherichia coli str. K-12
          substr. MG1655]
 gi|13363421|dbj|BAB37371.1| 30S ribosomal subunit protein S21 [Escherichia coli O157:H7 str.
          Sakai]
 gi|16421766|gb|AAL22083.1| 30S ribosomal subunit protein S21 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. LT2]
 gi|16504286|emb|CAD07734.1| 30S ribosomal subunit protein S21 [Salmonella enterica subsp.
          enterica serovar Typhi]
 gi|24053529|gb|AAN44582.1| 30S ribosomal subunit protein S21 [Shigella flexneri 2a str. 301]
 gi|29139104|gb|AAO70672.1| 30S ribosomal subunit protein S21 [Salmonella enterica subsp.
          enterica serovar Typhi str. Ty2]
 gi|30042670|gb|AAP18394.1| 30S ribosomal subunit protein S21 [Shigella flexneri 2a str.
          2457T]
 gi|36787268|emb|CAE16349.1| 30S ribosomal subunit protein S21 [Photorhabdus luminescens
          subsp. laumondii TTO1]
 gi|45437589|gb|AAS63139.1| 30S ribosomal protein S21 [Yersinia pestis biovar Microtus str.
          91001]
 gi|49610156|emb|CAG73596.1| 30S ribosomal subunit protein S21 [Pectobacterium atrosepticum
          SCRI1043]
 gi|51590996|emb|CAH22654.1| 30S ribosomal protein S21 [Yersinia pseudotuberculosis IP 32953]
 gi|56129406|gb|AAV78912.1| 30S ribosomal subunit protein S21 [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. ATCC 9150]
 gi|62129359|gb|AAX67062.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. SC-B67]
 gi|73857077|gb|AAZ89784.1| 30S ribosomal subunit protein S21 [Shigella sonnei Ss046]
 gi|81242543|gb|ABB63253.1| 30S ribosomal subunit protein S21 [Shigella dysenteriae Sd197]
 gi|81246731|gb|ABB67439.1| 30S ribosomal subunit protein S21 [Shigella boydii Sb227]
 gi|84778751|dbj|BAE73528.1| 30S ribosomal protein S21 [Sodalis glossinidius str. 'morsitans']
 gi|85675866|dbj|BAE77116.1| 30S ribosomal subunit protein S21 [Escherichia coli str. K12
          substr. W3110]
 gi|91074068|gb|ABE08949.1| 30S ribosomal subunit protein S21 [Escherichia coli UTI89]
 gi|108774318|gb|ABG16837.1| SSU ribosomal protein S21P [Yersinia pestis Nepal516]
 gi|108781049|gb|ABG15107.1| SSU ribosomal protein S21P [Yersinia pestis Antiqua]
 gi|110344901|gb|ABG71138.1| 30S ribosomal protein S21 [Escherichia coli 536]
 gi|110616500|gb|ABF05167.1| 30S ribosomal subunit protein S21 [Shigella flexneri 5 str. 8401]
 gi|115346449|emb|CAL19322.1| 30S ribosomal protein S21 [Yersinia pestis CO92]
 gi|122090827|emb|CAL13709.1| 30S ribosomal protein S21 [Yersinia enterocolitica subsp.
          enterocolitica 8081]
 gi|145209435|gb|ABP38842.1| 30S ribosomal protein S21 [Yersinia pestis Pestoides F]
 gi|145319983|gb|ABP62130.1| SSU ribosomal protein S21P [Enterobacter sp. 638]
 gi|149289731|gb|EDM39808.1| 30S ribosomal protein S21 [Yersinia pestis CA88-4125]
 gi|150956838|gb|ABR78868.1| 30S ribosomal protein S21 [Klebsiella pneumoniae subsp.
          pneumoniae MGH 78578]
 gi|152961166|gb|ABS48627.1| ribosomal protein S21 [Yersinia pseudotuberculosis IP 31758]
 gi|157068221|gb|ABV07476.1| ribosomal protein S21 [Escherichia coli HS]
 gi|157078181|gb|ABV17889.1| ribosomal protein S21 [Escherichia coli E24377A]
 gi|157085840|gb|ABV15518.1| hypothetical protein CKO_04462 [Citrobacter koseri ATCC BAA-895]
 gi|157324295|gb|ABV43392.1| ribosomal protein S21 [Serratia proteamaculans 568]
 gi|160867574|gb|ABX24197.1| hypothetical protein SARI_04420 [Salmonella enterica subsp.
          arizonae serovar 62:z4,z23:--]
 gi|161365566|gb|ABX69334.1| hypothetical protein SPAB_04005 [Salmonella enterica subsp.
          enterica serovar Paratyphi B str. SPB7]
 gi|162353206|gb|ABX87154.1| ribosomal protein S21 [Yersinia pestis Angola]
 gi|165923333|gb|EDR40484.1| ribosomal protein S21 [Yersinia pestis biovar Orientalis str.
          F1991016]
 gi|165992334|gb|EDR44635.1| ribosomal protein S21 [Yersinia pestis biovar Antiqua str.
          E1979001]
 gi|166206713|gb|EDR51193.1| ribosomal protein S21 [Yersinia pestis biovar Antiqua str.
          B42003004]
 gi|166963230|gb|EDR59251.1| ribosomal protein S21 [Yersinia pestis biovar Orientalis str.
          MG05-1020]
 gi|167051892|gb|EDR63300.1| ribosomal protein S21 [Yersinia pestis biovar Antiqua str.
          UG05-0454]
 gi|167055945|gb|EDR65726.1| ribosomal protein S21 [Yersinia pestis biovar Mediaevalis str.
          K1973002]
 gi|169749421|gb|ACA66939.1| ribosomal protein S21 [Yersinia pseudotuberculosis YPIII]
 gi|169753611|gb|ACA76310.1| ribosomal protein S21 [Escherichia coli ATCC 8739]
 gi|169890443|gb|ACB04150.1| 30S ribosomal subunit protein S21 [Escherichia coli str. K-12
          substr. DH10B]
 gi|170125052|gb|EDS93983.1| ribosomal protein S21 [Escherichia albertii TW07627]
 gi|170517921|gb|ACB16099.1| ribosomal protein S21 [Escherichia coli SMS-3-5]
 gi|186699884|gb|ACC90513.1| ribosomal protein S21 [Yersinia pseudotuberculosis PB1/+]
 gi|187428577|gb|ACD07851.1| ribosomal protein S21 [Shigella boydii CDC 3083-94]
 gi|187770952|gb|EDU34796.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4196]
 gi|188022639|gb|EDU60679.1| hypothetical protein PROSTU_01213 [Providencia stuartii ATCC
          25827]
 gi|188027613|emb|CAO95463.1| 30S ribosomal protein S21 [Erwinia tasmaniensis Et1/99]
 gi|188488749|gb|EDU63852.1| ribosomal protein S21 [Escherichia coli 53638]
 gi|189358427|gb|EDU76846.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4401]
 gi|189361495|gb|EDU79914.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4486]
 gi|189373782|gb|EDU92198.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC869]
 gi|189379802|gb|EDU98218.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC508]
 gi|192932339|gb|EDV84937.1| ribosomal protein S21 [Escherichia coli E22]
 gi|192959314|gb|EDV89749.1| ribosomal protein S21 [Escherichia coli E110019]
 gi|194402788|gb|ACF63010.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Newport str. SL254]
 gi|194406466|gb|ACF66685.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL476]
 gi|194420171|gb|EDX36249.1| ribosomal protein S21 [Shigella dysenteriae 1012]
 gi|194458250|gb|EDX47089.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CVM29188]
 gi|194683703|emb|CAR44682.1| 30S ribosomal subunit protein S21 [Proteus mirabilis HI4320]
 gi|194710969|gb|ACF90190.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Schwarzengrund str. CVM19633]
 gi|195633734|gb|EDX52148.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Newport str. SL317]
 gi|197095556|emb|CAR61121.1| 30S ribosomal subunit protein S21 [Salmonella enterica subsp.
          enterica serovar Paratyphi A str. AKU_12601]
 gi|197214567|gb|ACH51964.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Agona str. SL483]
 gi|197243316|gb|EDY25936.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA23]
 gi|197938002|gb|ACH75335.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Dublin str. CT_02021853]
 gi|199605651|gb|EDZ04196.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Virchow str. SL491]
 gi|204322315|gb|EDZ07512.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Javiana str. GA_MM04042433]
 gi|205273905|emb|CAR38907.1| 30S ribosomal subunit protein S21 [Salmonella enterica subsp.
          enterica serovar Gallinarum str. 287/91]
 gi|205323339|gb|EDZ11178.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Saintpaul str. SARA29]
 gi|205331260|gb|EDZ18024.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar 4,[5],12:i:- str. CVM23701]
 gi|205333734|gb|EDZ20498.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Kentucky str. CDC 191]
 gi|205337748|gb|EDZ24512.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Heidelberg str. SL486]
 gi|205343519|gb|EDZ30283.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. HI_N05-537]
 gi|205348382|gb|EDZ35013.1| ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Hadar str. RI_05P066]
 gi|206565919|gb|ACI07695.1| ribosomal protein S21 [Klebsiella pneumoniae 342]
 gi|206710270|emb|CAR34628.1| 30S ribosomal subunit protein S21 [Salmonella enterica subsp.
          enterica serovar Enteritidis str. P125109]
 gi|208726566|gb|EDZ76167.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4206]
 gi|208733330|gb|EDZ82017.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4045]
 gi|208739083|gb|EDZ86765.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4042]
 gi|209157568|gb|ACI35001.1| ribosomal protein S21 [Escherichia coli O157:H7 str. EC4115]
 gi|209759248|gb|ACI77936.1| 30S ribosomal subunit protein S21 [Escherichia coli]
 gi|209759250|gb|ACI77937.1| 30S ribosomal subunit protein S21 [Escherichia coli]
 gi|209759252|gb|ACI77938.1| 30S ribosomal subunit protein S21 [Escherichia coli]
 gi|209759254|gb|ACI77939.1| 30S ribosomal subunit protein S21 [Escherichia coli]
 gi|209759256|gb|ACI77940.1| 30S ribosomal subunit protein S21 [Escherichia coli]
 gi|209913796|dbj|BAG78870.1| 30S ribosomal protein S21 [Escherichia coli SE11]
 gi|212686337|gb|EEB45865.1| hypothetical protein PROVALCAL_02241 [Providencia alcalifaciens
          DSM 30120]
 gi|215266468|emb|CAS10906.1| 30S ribosomal subunit protein S21 [Escherichia coli O127:H6 str.
          E2348/69]
 gi|217319217|gb|EEC27642.1| ribosomal protein S21 [Escherichia coli O157:H7 str. TW14588]
 gi|218353502|emb|CAU99619.1| 30S ribosomal subunit protein S21 [Escherichia coli 55989]
 gi|218357855|emb|CAQ90499.1| 30S ribosomal subunit protein S21 [Escherichia fergusonii ATCC
          35469]
 gi|218362403|emb|CAR00027.1| 30S ribosomal subunit protein S21 [Escherichia coli IAI1]
 gi|218366921|emb|CAR04692.1| 30S ribosomal subunit protein S21 [Escherichia coli S88]
 gi|218371822|emb|CAR19677.1| 30S ribosomal subunit protein S21 [Escherichia coli IAI39]
 gi|218428934|emb|CAR09883.2| 30S ribosomal subunit protein S21 [Escherichia coli ED1a]
 gi|218433787|emb|CAR14704.1| 30S ribosomal subunit protein S21 [Escherichia coli UMN026]
 gi|222034797|emb|CAP77539.1| 30S ribosomal protein S21 [Escherichia coli LF82]
 gi|224469540|gb|ACN47370.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Paratyphi C strain RKS4594]
 gi|224962724|emb|CAX54179.1| 30S ribosomal protein S21 [Erwinia pyrifoliae Ep1/96]
 gi|226839858|gb|EEH71879.1| ribosomal protein S21 [Escherichia sp. 1_1_43]
 gi|226899213|gb|EEH85472.1| ribosomal protein S21 [Escherichia sp. 3_2_53FAA]
 gi|226908599|gb|EEH94517.1| ribosomal protein S21 [Citrobacter sp. 30_2]
 gi|227162595|gb|EEI47584.1| 30S ribosomal protein S21 [Proteus mirabilis ATCC 29906]
 gi|227835185|gb|EEJ45651.1| 30S ribosomal protein S21 [Escherichia coli 83972]
 gi|229682202|gb|EEO78294.1| 30S ribosomal subunit protein S21 [Yersinia pestis Nepal516]
 gi|229696901|gb|EEO86948.1| 30S ribosomal subunit protein S21 [Yersinia pestis biovar
          Orientalis str. PEXU2]
 gi|229705446|gb|EEO91456.1| 30S ribosomal subunit protein S21 [Yersinia pestis Pestoides A]
 gi|238548894|dbj|BAH65245.1| 30S ribosomal protein S21 [Klebsiella pneumoniae subsp.
          pneumoniae NTUH-K2044]
 gi|238701742|gb|EEP94308.1| 30S ribosomal protein S21 [Yersinia aldovae ATCC 35236]
 gi|238705162|gb|EEP97584.1| 30S ribosomal protein S21 [Yersinia ruckeri ATCC 29473]
 gi|238710861|gb|EEQ03082.1| 30S ribosomal protein S21 [Yersinia rohdei ATCC 43380]
 gi|238716261|gb|EEQ08244.1| 30S ribosomal protein S21 [Yersinia bercovieri ATCC 43970]
 gi|238719208|gb|EEQ11020.1| 30S ribosomal protein S21 [Yersinia mollaretii ATCC 43969]
 gi|238722727|gb|EEQ14379.1| 30S ribosomal protein S21 [Yersinia frederiksenii ATCC 33641]
 gi|238726317|gb|EEQ17859.1| 30S ribosomal protein S21 [Yersinia intermedia ATCC 29909]
 gi|238859796|gb|ACR61794.1| 30S ribosomal subunit protein S21 [Escherichia coli BW2952]
 gi|242132828|gb|ACS87130.1| ribosomal protein S21 [Dickeya dadantii Ech703]
 gi|242378615|emb|CAQ33402.1| 30S ribosomal subunit protein S21, subunit of 30S ribosomal
          subunit and ribosome [Escherichia coli BL21(DE3)]
 gi|247539677|gb|ACT08298.1| ribosomal protein S21 [Dickeya zeae Ech1591]
 gi|251753529|gb|ACT11605.1| ribosomal protein S21 [Pectobacterium carotovorum subsp.
          carotovorum PC1]
 gi|253323143|gb|ACT27745.1| ribosomal protein S21 [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253782481|emb|CAQ85645.1| 30s ribosomal subunit protein s21 [Photorhabdus asymbiotica]
 gi|253974913|gb|ACT40584.1| 30S ribosomal protein S21 [Escherichia coli B str. REL606]
 gi|253979069|gb|ACT44739.1| 30S ribosomal protein S21 [Escherichia coli BL21(DE3)]
 gi|254594416|gb|ACT73777.1| 30S ribosomal subunit protein S21 [Escherichia coli O157:H7 str.
          TW14359]
 gi|257755844|dbj|BAI27346.1| 30S ribosomal subunit protein S21 [Escherichia coli O26:H11 str.
          11368]
 gi|257760966|dbj|BAI32463.1| 30S ribosomal subunit protein S21 [Escherichia coli O103:H2 str.
          12009]
 gi|257766173|dbj|BAI37668.1| 30S ribosomal subunit protein S21 [Escherichia coli O111:H- str.
          11128]
 gi|259040329|gb|EEW41435.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
          rhinoscleromatis ATCC 13884]
 gi|260218499|emb|CBA33675.1| 30S ribosomal protein S21 [Cronobacter turicensis z3032]
 gi|260447900|gb|ACX38322.1| ribosomal protein S21 [Escherichia coli DH1]
 gi|261248339|emb|CBG26176.1| 30S ribosomal subunit protein S21 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. D23580]
 gi|261604118|gb|ACX86604.1| ribosomal protein S21 [Pectobacterium wasabiae WPP163]
 gi|267995404|gb|ACY90289.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 14028S]
 gi|270042865|gb|EFA15959.1| 30S ribosomal protein S21 [Serratia odorifera 4Rx13]
 gi|270336265|gb|EFA47042.1| ribosomal protein S21 [Yersinia pestis KIM D27]
 gi|270342707|gb|ACZ75472.1| ribosomal protein S21 [Dickeya dadantii Ech586]
 gi|281180119|dbj|BAI56449.1| 30S ribosomal protein S21 [Escherichia coli SE15]
 gi|281602454|gb|ADA75438.1| 30S ribosomal protein S21 [Shigella flexneri 2002017]
 gi|282567257|gb|EFB72792.1| ribosomal protein S21 [Providencia rustigianii DSM 4541]
 gi|282950655|emb|CBG90327.1| 30S ribosomal subunit protein S21 [Citrobacter rodentium ICC168]
 gi|283476903|emb|CAY72761.1| 30S ribosomal protein S21 [Erwinia pyrifoliae DSM 12163]
 gi|284923093|emb|CBG36186.1| 30S ribosomal subunit protein S21 [Escherichia coli 042]
 gi|288315134|gb|EFC54072.1| ribosomal protein S21 [Enterobacter cancerogenus ATCC 35316]
 gi|288888234|gb|ADC56552.1| ribosomal protein S21 [Klebsiella variicola At-22]
 gi|289174171|emb|CBJ80958.1| 30S ribosomal subunit protein S21 [Xenorhabdus bovienii SS-2004]
 gi|289776429|gb|EFD84428.1| 30S ribosomal protein S21 [Klebsiella sp. 1_1_55]
 gi|290764317|gb|ADD58278.1| Ribosomal protein S21 [Escherichia coli O55:H7 str. CB9615]
 gi|291067773|gb|EFE05882.1| ribosomal protein S21 [Citrobacter youngae ATCC 29220]
 gi|291153971|gb|ADD78555.1| RpsU [Pantoea ananatis LMG 20103]
 gi|291200548|emb|CBJ47677.1| 30S ribosomal subunit protein S21 [Erwinia amylovora ATCC 49946]
 gi|291313997|gb|EFE54450.1| ribosomal protein S21 [Providencia rettgeri DSM 1131]
 gi|291322493|gb|EFE61922.1| 30S ribosomal protein S21 [Escherichia coli B088]
 gi|291423273|gb|EFE96502.1| 30S ribosomal protein S21 [Serratia odorifera DSM 4582]
 gi|291426684|gb|EFE99716.1| rpsU [Escherichia coli FVEC1412]
 gi|291431860|gb|EFF04843.1| 30S ribosomal protein S21 [Escherichia coli B185]
 gi|291469213|gb|EFF11704.1| 30S ribosomal protein S21 [Escherichia coli B354]
 gi|291552322|emb|CBA19367.1| 30S ribosomal protein S21 [Erwinia amylovora CFBP1430]
 gi|294491364|gb|ADE90120.1| ribosomal protein S21 [Escherichia coli IHE3034]
 gi|295059188|gb|ADF63926.1| 30S ribosomal protein S21 [Enterobacter cloacae subsp. cloacae
          ATCC 13047]
 gi|295097579|emb|CBK86669.1| SSU ribosomal protein S21P [Enterobacter cloacae subsp. cloacae
          NCTC 9394]
 gi|297631421|emb|CBJ92118.1| 30S ribosomal subunit protein S21 [Xenorhabdus nematophila ATCC
          19061]
 gi|298277559|gb|EFI19075.1| small subunit ribosomal protein S21 [Escherichia coli FVEC1302]
 gi|299064289|emb|CAX61409.1| 30S ribosomal protein S21 [Erwinia billingiae Eb661]
 gi|299881587|gb|EFI89798.1| ribosomal protein S21 [Escherichia coli MS 196-1]
 gi|300300018|gb|EFJ56403.1| ribosomal protein S21 [Escherichia coli MS 185-1]
 gi|300308322|gb|EFJ62842.1| ribosomal protein S21 [Escherichia coli MS 200-1]
 gi|300314893|gb|EFJ64677.1| ribosomal protein S21 [Escherichia coli MS 175-1]
 gi|300355149|gb|EFJ71019.1| ribosomal protein S21 [Escherichia coli MS 198-1]
 gi|300397873|gb|EFJ81411.1| ribosomal protein S21 [Escherichia coli MS 69-1]
 gi|300402393|gb|EFJ85931.1| ribosomal protein S21 [Escherichia coli MS 84-1]
 gi|300410814|gb|EFJ94352.1| ribosomal protein S21 [Escherichia coli MS 45-1]
 gi|300415353|gb|EFJ98663.1| ribosomal protein S21 [Escherichia coli MS 115-1]
 gi|300419997|gb|EFK03308.1| ribosomal protein S21 [Escherichia coli MS 182-1]
 gi|300449962|gb|EFK13582.1| ribosomal protein S21 [Escherichia coli MS 116-1]
 gi|300457486|gb|EFK20979.1| ribosomal protein S21 [Escherichia coli MS 21-1]
 gi|300460374|gb|EFK23867.1| ribosomal protein S21 [Escherichia coli MS 187-1]
 gi|300525798|gb|EFK46867.1| ribosomal protein S21 [Escherichia coli MS 119-7]
 gi|300528617|gb|EFK49679.1| ribosomal protein S21 [Escherichia coli MS 107-1]
 gi|300842874|gb|EFK70634.1| ribosomal protein S21 [Escherichia coli MS 124-1]
 gi|300847632|gb|EFK75392.1| ribosomal protein S21 [Escherichia coli MS 78-1]
 gi|301076915|gb|EFK91721.1| ribosomal protein S21 [Escherichia coli MS 146-1]
 gi|301159762|emb|CBW19281.1| 30S ribosomal subunit protein S21 [Salmonella enterica subsp.
          enterica serovar Typhimurium str. SL1344]
 gi|304355661|gb|EFM20028.1| ribosomal protein S21 [Pantoea sp. aB]
 gi|305850146|gb|EFM50605.1| 30S ribosomal protein S21 [Escherichia coli NC101]
 gi|306526891|gb|ADM96821.1| 30S ribosomal subunit protein S21 [Dickeya dadantii 3937]
 gi|306909205|gb|EFN39700.1| ribosomal protein S21 [Escherichia coli W]
 gi|307555172|gb|ADN47947.1| 30S ribosomal protein S21 [Escherichia coli ABU 83972]
 gi|307625320|gb|ADN69624.1| 30S ribosomal protein S21 [Escherichia coli UM146]
 gi|308058654|gb|ADO10826.1| 30S ribosomal protein S21 [Pantoea vagans C9-1]
 gi|308122587|gb|EFO59849.1| ribosomal protein S21 [Escherichia coli MS 145-7]
 gi|308747221|gb|ADO46973.1| ribosomal protein S21 [Enterobacter cloacae SCF1]
 gi|308926494|gb|EFP71970.1| ribosomal protein S21 [Shigella dysenteriae 1617]
 gi|309703496|emb|CBJ02836.1| 30S ribosomal subunit protein S21 [Escherichia coli ETEC H10407]
 gi|310332612|gb|EFP99825.1| ribosomal protein S21 [Escherichia coli 1827-70]
 gi|310766303|gb|ADP11253.1| 30S ribosomal protein S21 [Erwinia sp. Ejp617]
 gi|312170975|emb|CBX79234.1| 30S ribosomal protein S21 [Erwinia amylovora ATCC BAA-2158]
 gi|312286810|gb|EFR14721.1| ribosomal protein S21 [Escherichia coli 2362-75]
 gi|312914237|dbj|BAJ38211.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. T000240]
 gi|312947636|gb|ADR28463.1| ribosomal protein S21 [Escherichia coli O83:H1 str. NRG 857C]
 gi|313648181|gb|EFS12627.1| ribosomal protein S21 [Shigella flexneri 2a str. 2457T]
 gi|315062373|gb|ADT76700.1| 30S ribosomal subunit protein S21 [Escherichia coli W]
 gi|315137658|dbj|BAJ44817.1| 30S ribosomal protein S21 [Escherichia coli DH1]
 gi|315256978|gb|EFU36946.1| ribosomal protein S21 [Escherichia coli MS 85-1]
 gi|315288822|gb|EFU48220.1| ribosomal protein S21 [Escherichia coli MS 110-3]
 gi|315295032|gb|EFU54369.1| ribosomal protein S21 [Escherichia coli MS 153-1]
 gi|315297748|gb|EFU57025.1| ribosomal protein S21 [Escherichia coli MS 16-3]
 gi|315617138|gb|EFU97747.1| ribosomal protein S21 [Escherichia coli 3431]
 gi|316918045|gb|EFV39387.1| ribosomal protein S21 [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316951218|gb|ADU70693.1| ribosomal protein S21 [Pantoea sp. At-9b]
 gi|318604176|emb|CBY25674.1| SSU ribosomal protein S21p [Yersinia enterocolitica subsp.
          palearctica Y11]
 gi|320016796|gb|ADW00368.1| 30S ribosomal subunit protein S21 [Yersinia pestis biovar
          Medievalis str. Harbin 35]
 gi|320030087|gb|EFW12107.1| 30S ribosomal subunit protein S21 [Serratia symbiotica str.
          Tucson]
 gi|320087663|emb|CBY97427.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Weltevreden str. 2007-60-3289-1]
 gi|320176468|gb|EFW51518.1| SSU ribosomal protein S21p [Shigella dysenteriae CDC 74-1112]
 gi|320179312|gb|EFW54270.1| SSU ribosomal protein S21p [Shigella boydii ATCC 9905]
 gi|320182890|gb|EFW57764.1| SSU ribosomal protein S21p [Shigella flexneri CDC 796-83]
 gi|320189416|gb|EFW64075.1| SSU ribosomal protein S21p [Escherichia coli O157:H7 str. EC1212]
 gi|320195227|gb|EFW69856.1| SSU ribosomal protein S21p [Escherichia coli WV_060327]
 gi|320201975|gb|EFW76550.1| SSU ribosomal protein S21p [Escherichia coli EC4100B]
 gi|320640139|gb|EFX09711.1| 30S ribosomal protein S21 [Escherichia coli O157:H7 str. G5101]
 gi|320645437|gb|EFX14446.1| 30S ribosomal protein S21 [Escherichia coli O157:H- str. 493-89]
 gi|320650748|gb|EFX19205.1| 30S ribosomal protein S21 [Escherichia coli O157:H- str. H 2687]
 gi|320656126|gb|EFX24038.1| 30S ribosomal protein S21 [Escherichia coli O55:H7 str. 3256-97
          TW 07815]
 gi|320661816|gb|EFX29224.1| 30S ribosomal protein S21 [Escherichia coli O55:H7 str. USDA
          5905]
 gi|320666967|gb|EFX33943.1| 30S ribosomal protein S21 [Escherichia coli O157:H7 str. LSU-61]
 gi|321166542|gb|ADW72241.1| ribosomal protein S21 [Rahnella sp. Y9602]
 gi|321225892|gb|EFX50946.1| SSU ribosomal protein S21p [Salmonella enterica subsp. enterica
          serovar Typhimurium str. TN061786]
 gi|322613613|gb|EFY10554.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 315996572]
 gi|322621206|gb|EFY18064.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-1]
 gi|322624269|gb|EFY21103.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-3]
 gi|322627993|gb|EFY24782.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 495297-4]
 gi|322633111|gb|EFY29853.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 515920-1]
 gi|322636312|gb|EFY33020.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 515920-2]
 gi|322643486|gb|EFY40048.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 531954]
 gi|322644795|gb|EFY41330.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. NC_MB110209-0054]
 gi|322648604|gb|EFY45051.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. OH_2009072675]
 gi|322653656|gb|EFY49982.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. CASC_09SCPH15965]
 gi|322657764|gb|EFY54032.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 19N]
 gi|322663865|gb|EFY60064.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 81038-01]
 gi|322669124|gb|EFY65275.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MD_MDA09249507]
 gi|322672883|gb|EFY68990.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 414877]
 gi|322678127|gb|EFY74190.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 366867]
 gi|322681303|gb|EFY77336.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 413180]
 gi|322687767|gb|EFY83734.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 446600]
 gi|322716212|gb|EFZ07783.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Choleraesuis str. A50]
 gi|323131570|gb|ADX19000.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. 4/74]
 gi|323154521|gb|EFZ40721.1| ribosomal protein S21 [Escherichia coli EPECa14]
 gi|323168090|gb|EFZ53777.1| ribosomal protein S21 [Shigella sonnei 53G]
 gi|323173690|gb|EFZ59319.1| ribosomal protein S21 [Escherichia coli LT-68]
 gi|323178771|gb|EFZ64347.1| ribosomal protein S21 [Escherichia coli 1180]
 gi|323183648|gb|EFZ69045.1| ribosomal protein S21 [Escherichia coli 1357]
 gi|323188491|gb|EFZ73776.1| ribosomal protein S21 [Escherichia coli RN587/1]
 gi|323195579|gb|EFZ80756.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 609458-1]
 gi|323199740|gb|EFZ84830.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 556150-1]
 gi|323202512|gb|EFZ87552.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 609460]
 gi|323208000|gb|EFZ92946.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 507440-20]
 gi|323212448|gb|EFZ97265.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 556152]
 gi|323215070|gb|EFZ99818.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB101509-0077]
 gi|323222800|gb|EGA07165.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB102109-0047]
 gi|323224119|gb|EGA08412.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB110209-0055]
 gi|323230443|gb|EGA14561.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. MB111609-0052]
 gi|323235205|gb|EGA19291.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 2009083312]
 gi|323239246|gb|EGA23296.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 2009085258]
 gi|323244396|gb|EGA28402.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. 315731156]
 gi|323247013|gb|EGA30979.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2009159199]
 gi|323253505|gb|EGA37334.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008282]
 gi|323256189|gb|EGA39925.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008283]
 gi|323262635|gb|EGA46191.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008284]
 gi|323267269|gb|EGA50753.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008285]
 gi|323269329|gb|EGA52784.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Montevideo str. IA_2010008287]
 gi|323377039|gb|ADX49307.1| ribosomal protein S21 [Escherichia coli KO11]
 gi|323935933|gb|EGB32228.1| ribosomal protein S21 [Escherichia coli E1520]
 gi|323941837|gb|EGB38016.1| ribosomal protein S21 [Escherichia coli E482]
 gi|323946865|gb|EGB42883.1| ribosomal protein S21 [Escherichia coli H120]
 gi|323951401|gb|EGB47276.1| ribosomal protein S21 [Escherichia coli H252]
 gi|323957774|gb|EGB53488.1| ribosomal protein S21 [Escherichia coli H263]
 gi|323961000|gb|EGB56617.1| ribosomal protein S21 [Escherichia coli H489]
 gi|323966594|gb|EGB62027.1| ribosomal protein S21 [Escherichia coli M863]
 gi|323971812|gb|EGB67037.1| ribosomal protein S21 [Escherichia coli TA007]
 gi|323978861|gb|EGB73941.1| ribosomal protein S21 [Escherichia coli TW10509]
 gi|324008868|gb|EGB78087.1| ribosomal protein S21 [Escherichia coli MS 57-2]
 gi|324011987|gb|EGB81206.1| ribosomal protein S21 [Escherichia coli MS 60-1]
 gi|324018217|gb|EGB87436.1| ribosomal protein S21 [Escherichia coli MS 117-3]
 gi|324115356|gb|EGC09320.1| ribosomal protein S21 [Escherichia fergusonii B253]
 gi|324119673|gb|EGC13554.1| ribosomal protein S21 [Escherichia coli E1167]
 gi|325498618|gb|EGC96477.1| 30S ribosomal protein S21 [Escherichia fergusonii ECD227]
 gi|325667229|gb|ADZ43873.1| 30S ribosomal protein S21 [Yersinia enterocolitica subsp.
          palearctica 105.5R(r)]
 gi|326337768|gb|EGD61602.1| SSU ribosomal protein S21p [Escherichia coli O157:H7 str. 1125]
 gi|326347333|gb|EGD71058.1| SSU ribosomal protein S21p [Escherichia coli O157:H7 str. 1044]
 gi|326624966|gb|EGE31311.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Dublin str. 3246]
 gi|326629243|gb|EGE35586.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Gallinarum str. 9]
 gi|327251851|gb|EGE63537.1| ribosomal protein S21 [Escherichia coli STEC_7v]
 gi|327395291|dbj|BAK12713.1| 30S ribosomal protein S21 RpsU [Pantoea ananatis AJ13355]
 gi|330862246|emb|CBX72407.1| 30S ribosomal protein S21 [Yersinia enterocolitica W22703]
 gi|330909131|gb|EGH37645.1| SSU ribosomal protein S21p [Escherichia coli AA86]
 gi|331037234|gb|EGI09458.1| ribosomal protein S21 [Escherichia coli H736]
 gi|331042613|gb|EGI14755.1| ribosomal protein S21 [Escherichia coli M605]
 gi|331048046|gb|EGI20123.1| ribosomal protein S21 [Escherichia coli M718]
 gi|331053938|gb|EGI25967.1| ribosomal protein S21 [Escherichia coli TA206]
 gi|331058609|gb|EGI30590.1| ribosomal protein S21 [Escherichia coli TA143]
 gi|331062824|gb|EGI34738.1| ribosomal protein S21 [Escherichia coli TA271]
 gi|331068698|gb|EGI40093.1| ribosomal protein S21 [Escherichia coli TA280]
 gi|331073206|gb|EGI44529.1| ribosomal protein S21 [Escherichia coli H591]
 gi|331078332|gb|EGI49538.1| ribosomal protein S21 [Escherichia coli H299]
 gi|332086724|gb|EGI91864.1| ribosomal protein S21 [Shigella boydii 5216-82]
 gi|332086774|gb|EGI91911.1| ribosomal protein S21 [Shigella dysenteriae 155-74]
 gi|332086942|gb|EGI92077.1| ribosomal protein S21 [Shigella dysenteriae 155-74]
 gi|332091896|gb|EGI96974.1| ribosomal protein S21 [Shigella boydii 3594-74]
 gi|332102470|gb|EGJ05816.1| 30S ribosomal subunit protein S21 [Shigella sp. D9]
 gi|332345019|gb|AEE58353.1| ribosomal protein RpsU [Escherichia coli UMNK88]
 gi|332752738|gb|EGJ83123.1| ribosomal protein S21 [Shigella flexneri K-671]
 gi|332753122|gb|EGJ83506.1| ribosomal protein S21 [Shigella flexneri 4343-70]
 gi|332754745|gb|EGJ85111.1| ribosomal protein S21 [Shigella flexneri 2747-71]
 gi|332765314|gb|EGJ95538.1| ribosomal protein S21 [Shigella flexneri 2930-71]
 gi|332990075|gb|AEF09058.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhimurium str. UK-1]
 gi|332998668|gb|EGK18264.1| ribosomal protein S21 [Shigella flexneri VA-6]
 gi|332999825|gb|EGK19409.1| ribosomal protein S21 [Shigella flexneri K-272]
 gi|333000162|gb|EGK19745.1| ribosomal protein S21 [Shigella flexneri K-218]
 gi|333014840|gb|EGK34185.1| ribosomal protein S21 [Shigella flexneri K-304]
 gi|333015693|gb|EGK35032.1| ribosomal protein S21 [Shigella flexneri K-227]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  GVL E++ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|187478821|ref|YP_786845.1| 30S ribosomal protein S21 [Bordetella avium 197N]
 gi|119367238|sp|Q2KYB0|RS21_BORA1 RecName: Full=30S ribosomal protein S21
 gi|115423407|emb|CAJ49941.1| 30S ribosomal protein S21 [Bordetella avium 197N]
          Length = 70

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +++N   E ALR  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPIVRLKENEPFEAALRRFKRTIEKTGLLTELRSREFYEKPTAERKRKHAAAVKRHYKRI 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|110834921|ref|YP_693780.1| 30S ribosomal protein S21 [Alcanivorax borkumensis SK2]
 gi|254427169|ref|ZP_05040876.1| ribosomal protein S21 [Alcanivorax sp. DG881]
 gi|119367232|sp|Q0VMU0|RS21_ALCBS RecName: Full=30S ribosomal protein S21
 gi|110648032|emb|CAL17508.1| 30S ribosomal protein S21 [Alcanivorax borkumensis SK2]
 gi|196193338|gb|EDX88297.1| ribosomal protein S21 [Alcanivorax sp. DG881]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 20/71 (28%), Positives = 37/71 (52%), Gaps = 1/71 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++    + ALR  K+  +  G+L E++ R  YEKP+Q+R R ++ A++R  K +
Sbjct: 1  MPQVKVKEGEPFDVALRRFKRGCEKAGILSEVRRREQYEKPTQERKRKRAAAVKRHLKKL 60

Query: 78 RKIAQREGAPV 88
          ++         
Sbjct: 61 QREQLARKRLY 71


>gi|224029431|gb|ACN33791.1| unknown [Zea mays]
          Length = 432

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 4/76 (5%)

Query: 13 EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHY-EKPSQKRVRLKSEAIR 71
          + ++   + V VRD N+E AL ++++KM+  G  R ++       K S+ R+    E ++
Sbjct: 8  QVQQARGIVVQVRDGNLEPALSIMERKMRSSGTERLIRAHTLLDIKDSENRLLALKELMQ 67

Query: 72 RSRK---LMRKIAQRE 84
          R R    ++RKI  ++
Sbjct: 68 RVRSQELMLRKIVIKQ 83


>gi|149910041|ref|ZP_01898689.1| 30S ribosomal protein S21 [Moritella sp. PE36]
 gi|149806909|gb|EDM66870.1| 30S ribosomal protein S21 [Moritella sp. PE36]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R HYEKP+  R R K+ A +R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGILSEVRRREHYEKPTTVRKRAKAAASKRLAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|120436727|ref|YP_862413.1| 30S ribosomal protein S21 [Gramella forsetii KT0803]
 gi|117578877|emb|CAL67346.1| 30S ribosomal protein S21 [Gramella forsetii KT0803]
          Length = 80

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 12 SEGREISAVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRV 63
           +G + + + + V+D  N+++AL+  K+K    G +R+L+ R H+ KPS +R 
Sbjct: 10 KKGGDDTMLIIPVKDGENIDRALKRFKRKFDKTGTMRQLRDRQHFTKPSVERR 62


>gi|21672347|ref|NP_660414.1| 30S ribosomal protein S21 [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
 gi|25009185|sp|Q8KA57|RS21_BUCAP RecName: Full=30S ribosomal protein S21
 gi|21622950|gb|AAM67625.1| 30S ribosomal protein S21 [Buchnera aphidicola str. Sg
          (Schizaphis graminum)]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+ +R R K+ AI+R  K +
Sbjct: 1  MPIIKVRENEPFDVALRRFKRSCEKAGILAEIRRREFYEKPTTERKRAKASAIKRLAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 TRENARR 67


>gi|330891184|gb|EGH23845.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. mori str.
          301020]
          Length = 67

 Score = 44.5 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+  +  GVL E++ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTSERKRKAAAAVKRHAKKV 60

Query: 78 RKIAQR 83
          ++  +R
Sbjct: 61 QREQRR 66


>gi|83648908|ref|YP_437343.1| 30S ribosomal protein S21 [Hahella chejuensis KCTC 2396]
 gi|119367262|sp|Q2S8V6|RS21_HAHCH RecName: Full=30S ribosomal protein S21
 gi|83636951|gb|ABC32918.1| ribosomal protein S21 [Hahella chejuensis KCTC 2396]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +++N   + ALR  K+  +  G+L E++ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPSVKIKENEPFDVALRRFKRSCEKAGILSEVRRREFYEKPTSERKRKLAAAVKRHAKKV 60

Query: 78 RKIAQR 83
          ++  +R
Sbjct: 61 QREQRR 66


>gi|28867767|ref|NP_790386.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. tomato str.
          DC3000]
 gi|66047866|ref|YP_237707.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. syringae
          B728a]
 gi|70732949|ref|YP_262720.1| 30S ribosomal protein S21 [Pseudomonas fluorescens Pf-5]
 gi|71736532|ref|YP_272920.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. phaseolicola
          1448A]
 gi|77461368|ref|YP_350875.1| 30S ribosomal protein S21 [Pseudomonas fluorescens Pf0-1]
 gi|213967687|ref|ZP_03395834.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. tomato T1]
 gi|237803345|ref|ZP_04590930.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. oryzae str.
          1_6]
 gi|257483094|ref|ZP_05637135.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. tabaci ATCC
          11528]
 gi|289627700|ref|ZP_06460654.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. aesculi str.
          NCPPB3681]
 gi|289649019|ref|ZP_06480362.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. aesculi str.
          2250]
 gi|289676148|ref|ZP_06497038.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. syringae FF5]
 gi|298485288|ref|ZP_07003380.1| SSU ribosomal protein S21p [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
 gi|301382747|ref|ZP_07231165.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. tomato Max13]
 gi|302064030|ref|ZP_07255571.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. tomato K40]
 gi|302130710|ref|ZP_07256700.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. tomato NCPPB
          1108]
 gi|302185955|ref|ZP_07262628.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. syringae 642]
 gi|312963432|ref|ZP_07777914.1| 30S ribosomal protein S21 [Pseudomonas fluorescens WH6]
 gi|330812144|ref|YP_004356606.1| 30S ribosomal protein S21 [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|33516951|sp|Q88A58|RS21_PSESM RecName: Full=30S ribosomal protein S21
 gi|81307846|sp|Q4ZMF3|RS21_PSEU2 RecName: Full=30S ribosomal protein S21
 gi|119367290|sp|Q48NU9|RS21_PSE14 RecName: Full=30S ribosomal protein S21
 gi|119367292|sp|Q4K4W3|RS21_PSEF5 RecName: Full=30S ribosomal protein S21
 gi|119367294|sp|Q3K5S0|RS21_PSEPF RecName: Full=30S ribosomal protein S21
 gi|28851002|gb|AAO54081.1| ribosomal protein S21 [Pseudomonas syringae pv. tomato str.
          DC3000]
 gi|63258573|gb|AAY39669.1| Ribosomal protein S21 [Pseudomonas syringae pv. syringae B728a]
 gi|68347248|gb|AAY94854.1| ribosomal protein S21 [Pseudomonas fluorescens Pf-5]
 gi|71557085|gb|AAZ36296.1| ribosomal protein S21 [Pseudomonas syringae pv. phaseolicola
          1448A]
 gi|77385371|gb|ABA76884.1| 30S ribosomal subunit protein S21 [Pseudomonas fluorescens Pf0-1]
 gi|213927463|gb|EEB61011.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. tomato T1]
 gi|298160138|gb|EFI01167.1| SSU ribosomal protein S21p [Pseudomonas savastanoi pv. savastanoi
          NCPPB 3335]
 gi|311282238|gb|EFQ60837.1| 30S ribosomal protein S21 [Pseudomonas fluorescens WH6]
 gi|320325997|gb|EFW82055.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. glycinea str.
          B076]
 gi|320332068|gb|EFW88004.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. glycinea str.
          race 4]
 gi|327380252|gb|AEA71602.1| 30S ribosomal protein S21 [Pseudomonas brassicacearum subsp.
          brassicacearum NFM421]
 gi|330868479|gb|EGH03188.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. aesculi str.
          0893_23]
 gi|330878417|gb|EGH12566.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. morsprunorum
          str. M302280PT]
 gi|330881703|gb|EGH15852.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. glycinea str.
          race 4]
 gi|330898883|gb|EGH30302.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. japonica str.
          M301072PT]
 gi|330938476|gb|EGH42079.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. pisi str.
          1704B]
 gi|330955104|gb|EGH55364.1| 30S ribosomal protein S21 [Pseudomonas syringae Cit 7]
 gi|330961074|gb|EGH61334.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. maculicola
          str. ES4326]
 gi|330963833|gb|EGH64093.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. actinidiae
          str. M302091]
 gi|330970854|gb|EGH70920.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. aceris str.
          M302273PT]
 gi|330980976|gb|EGH79079.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. aptata str.
          DSM 50252]
 gi|330985808|gb|EGH83911.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. lachrymans
          str. M301315]
 gi|331011672|gb|EGH91728.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. tabaci ATCC
          11528]
 gi|331017643|gb|EGH97699.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. lachrymans
          str. M302278PT]
 gi|331025326|gb|EGI05382.1| 30S ribosomal protein S21 [Pseudomonas syringae pv. oryzae str.
          1_6]
          Length = 71

 Score = 44.5 bits (104), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+  +  GVL E++ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTSERKRKAAAAVKRHAKKV 60

Query: 78 RKIAQR 83
          ++  +R
Sbjct: 61 QREQRR 66


>gi|187921410|ref|YP_001890442.1| 30S ribosomal protein S21 [Burkholderia phytofirmans PsJN]
 gi|187719848|gb|ACD21071.1| ribosomal protein S21 [Burkholderia phytofirmans PsJN]
          Length = 70

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V+DN   E A+R  K+ M+  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKDNEPFEVAMRRFKRTMEKSGLLTELRAREFYEKPTTERKRKKASAVKRHFKRL 60

Query: 78 RKIAQREG 85
          R     + 
Sbjct: 61 RSQMLPKK 68


>gi|258545968|ref|ZP_05706202.1| conserved domain protein [Cardiobacterium hominis ATCC 15826]
 gi|258518773|gb|EEV87632.1| conserved domain protein [Cardiobacterium hominis ATCC 15826]
          Length = 71

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VRDN   + ALR  K+ ++  GVL E++ R  YEKP+Q+R R  + A++R+ + +
Sbjct: 1  MPSVKVRDNEPFDIALRRFKRSVEKAGVLAEVRSREFYEKPTQERKRKLAAAVKRNTRRL 60

Query: 78 RKIAQR 83
          +K   R
Sbjct: 61 KKERSR 66


>gi|226499178|ref|NP_001151791.1| PIF-like orf1 [Zea mays]
 gi|195649705|gb|ACG44320.1| PIF-like orf1 [Zea mays]
          Length = 466

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/76 (27%), Positives = 41/76 (53%), Gaps = 4/76 (5%)

Query: 13  EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHY-EKPSQKRVRLKSEAIR 71
           + ++   + V VRD N+E AL ++++KM+  G  R ++       K S+ R+    E ++
Sbjct: 42  QVQQARGIVVQVRDGNLEPALSIMERKMRSSGTERLIRAHTLLDIKDSENRLLALKELMQ 101

Query: 72  RSRK---LMRKIAQRE 84
           R R    ++RKI  ++
Sbjct: 102 RVRSQELMLRKIVIKQ 117


>gi|218131355|ref|ZP_03460159.1| hypothetical protein BACEGG_02970 [Bacteroides eggerthii DSM
          20697]
 gi|217986287|gb|EEC52624.1| hypothetical protein BACEGG_02970 [Bacteroides eggerthii DSM
          20697]
          Length = 95

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 15 REISAVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
          +    + V V++  N+E+AL+  K+K +  G+++EL+ R  ++KPS  +   K  A+
Sbjct: 29 KNKKMIVVPVKEGENIEKALKKFKRKFEKTGIVKELRSRQQFDKPSVTKRLKKERAV 85


>gi|332284641|ref|YP_004416552.1| 30S ribosomal protein S21 [Pusillimonas sp. T7-7]
 gi|330428594|gb|AEC19928.1| 30S ribosomal protein S21 [Pusillimonas sp. T7-7]
          Length = 70

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 36/61 (59%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +++N   E ALR  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPIVRLKENEPFEAALRRFKRTIEKIGLLTELRSREFYEKPTAERKRKHAAAVKRHYKRI 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|253578838|ref|ZP_04856109.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39B_FAA]
 gi|251849781|gb|EES77740.1| conserved hypothetical protein [Ruminococcus sp. 5_1_39BFAA]
          Length = 82

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 9  GIFSEGREISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKS 67
            + E R  S   V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +   
Sbjct: 15 YNWREVRCESMSNVIVKENETLDSALRRFKRSCAKAGIQQEIRKREHYEKPSVRRKKKSE 74

Query: 68 EAIRR 72
           A +R
Sbjct: 75 AARKR 79


>gi|158520485|ref|YP_001528355.1| ribosomal protein S21 [Desulfococcus oleovorans Hxd3]
 gi|158509311|gb|ABW66278.1| ribosomal protein S21 [Desulfococcus oleovorans Hxd3]
          Length = 68

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 27/65 (41%), Positives = 43/65 (66%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V V DN++E+A+R+LKKK+Q +G+ + L++R  YEKPS+ + R + EA RR R    K
Sbjct: 4  IEVRVIDNDLEKAMRILKKKIQNDGLFKRLRLRKTYEKPSEFKRRKEREAQRRLRIAEIK 63

Query: 80 IAQRE 84
            +  
Sbjct: 64 RRRFR 68


>gi|118138073|pdb|2I2P|U Chain U, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|118138144|pdb|2I2U|U Chain U, Crystal Structure Of Ribosome With Messenger Rna And The
          Anticodon Stem-Loop Of P-Site Trna. This File Contains
          The 30s Subunit Of One 70s Ribosome. The Entire Crystal
          Structure Contains Two 70s Ribosomes And Is Described
          In Remark 400.
 gi|157836042|pdb|2QOU|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 30s Subunit Of The First 70s
          Ribosome, With Spectinomycin Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|157836087|pdb|2QOW|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin. This
          File Contains The 30s Subunit Of The Second 70s
          Ribosome, With Spectinomycin Bound. The Entire Crystal
          Structure Contains Two 70s Ribosomes.
 gi|157836146|pdb|2QOY|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 30s Subunit Of The
          First 70s Ribosome, With Spectinomycin And Neomycin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|157836191|pdb|2QP0|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Spectinomycin And
          Neomycin. This File Contains The 30s Subunit Of The
          Second 70s Ribosome, With Spectinomycin And Neomycin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes.
 gi|158429719|pdb|2QAL|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 30s Subunit Of The First 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429771|pdb|2QAN|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Neomycin. This File
          Contains The 30s Subunit Of The Second 70s Ribosome,
          With Neomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429829|pdb|2QB9|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 30s Subunit Of The First 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429881|pdb|2QBB|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin. This File
          Contains The 30s Subunit Of The Second 70s Ribosome,
          With Gentamicin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429933|pdb|2QBD|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 30s Subunit Of The
          First 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158429986|pdb|2QBF|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Ribosome Recycling
          Factor (Rrf). This File Contains The 30s Subunit Of The
          Second 70s Ribosome. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|158430039|pdb|2QBH|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The First 70s Ribosome, With Gentamicin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes And Is Described In Remark 400.
 gi|158430092|pdb|2QBJ|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Gentamicin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The Second 70s Ribosome, With Gentamicin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes And Is Described In Remark 400.
 gi|158431392|pdb|2Z4K|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The First 70s Ribosome, With Paromomycin
          Bound. The Entire Crystal Structure Contains Two 70s
          Ribosomes And Is Described In Remark 400.
 gi|158431445|pdb|2Z4M|U Chain U, Crystal Structure Of The Bacterial Ribosome From
          Escherichia Coli In Complex With Paromomycin And
          Ribosome Recycling Factor (Rrf). This File Contains The
          30s Subunit Of The Second 70s Ribosome, With
          Paromomycin Bound. The Entire Crystal Structure
          Contains Two 70s Ribosomes And Is Described In Remark
          400.
 gi|329666012|pdb|3J00|U Chain U, Structure Of The Ribosome-Secye Complex In The Membrane
          Environment
 gi|229549|prf||754244A protein S21
          Length = 70

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 1/64 (1%)

Query: 22 VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
          + VR+N   + ALR  K+  +  GVL E++ R  YEKP+ +R R K+ A++R  K + + 
Sbjct: 3  IKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARE 62

Query: 81 AQRE 84
            R 
Sbjct: 63 NARR 66


>gi|28273406|gb|AAO38492.1| hypothetical protein [Oryza sativa Japonica Group]
 gi|125587563|gb|EAZ28227.1| hypothetical protein OsJ_12197 [Oryza sativa Japonica Group]
          Length = 137

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 15 REISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRG---HYEKPSQKRVRLKSEAIR 71
          ++   + V V+D N+E+AL V+ +KM+  G+ R ++ R    H+ K S+KRV  +   ++
Sbjct: 24 QQARGIVVHVKDGNLERALGVMARKMRSSGIERLIRARSQIHHHVKDSEKRVLARKALMQ 83

Query: 72 RSRKLMRKIAQRE 84
          R R        R+
Sbjct: 84 RVRSQELGKKLRD 96


>gi|27904562|ref|NP_777688.1| 30S ribosomal protein S21 [Buchnera aphidicola str. Bp (Baizongia
          pistaciae)]
 gi|31076934|sp|Q89B08|RS21_BUCBP RecName: Full=30S ribosomal protein S21
 gi|27903959|gb|AAO26793.1| 30S ribosomal protein S21 [Buchnera aphidicola str. Bp (Baizongia
          pistaciae)]
          Length = 71

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VRDN   + ALR  K+  +  G+L E++ R  YEKP+ +R R K+ AI+R  K +
Sbjct: 1  MPIIKVRDNEPFDVALRRFKRSCEKAGILSEIRRREFYEKPTTERKRAKASAIKRLTKKL 60

Query: 78 RKIAQRE 84
           +   + 
Sbjct: 61 SRENLKR 67


>gi|15616682|ref|NP_239894.1| 30S ribosomal protein S21 [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
 gi|219681439|ref|YP_002467824.1| 30S ribosomal protein S21 [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|219681995|ref|YP_002468379.1| 30S ribosomal protein S21 [Buchnera aphidicola str. Tuc7
          (Acyrthosiphon pisum)]
 gi|257471114|ref|ZP_05635113.1| 30S ribosomal protein S21 [Buchnera aphidicola str. LSR1
          (Acyrthosiphon pisum)]
 gi|11387073|sp|P57165|RS21_BUCAI RecName: Full=30S ribosomal protein S21
 gi|254813085|sp|B8D8L5|RS21_BUCA5 RecName: Full=30S ribosomal protein S21
 gi|254813608|sp|B8D6W9|RS21_BUCAT RecName: Full=30S ribosomal protein S21
 gi|25294884|pir||D84936 30S ribosomal protein S21 [imported] - Buchnera sp. (strain APS)
 gi|10038745|dbj|BAB12780.1| 30S ribosomal protein S21 [Buchnera aphidicola str. APS
          (Acyrthosiphon pisum)]
 gi|219621728|gb|ACL29884.1| 30S ribosomal protein S21 [Buchnera aphidicola str. Tuc7
          (Acyrthosiphon pisum)]
 gi|219624282|gb|ACL30437.1| 30S ribosomal protein S21 [Buchnera aphidicola str. 5A
          (Acyrthosiphon pisum)]
 gi|311085801|gb|ADP65883.1| 30S ribosomal protein S21 [Buchnera aphidicola str. LL01
          (Acyrthosiphon pisum)]
 gi|311086376|gb|ADP66457.1| 30S ribosomal protein S21 [Buchnera aphidicola str. TLW03
          (Acyrthosiphon pisum)]
 gi|311086954|gb|ADP67034.1| 30S ribosomal protein S21 [Buchnera aphidicola str. JF99
          (Acyrthosiphon pisum)]
 gi|311087535|gb|ADP67614.1| 30S ribosomal protein S21 [Buchnera aphidicola str. JF98
          (Acyrthosiphon pisum)]
          Length = 71

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MPIIKVRENEPFDVALRRFKRSCEKAGILAEIRRREFYEKPTTERKRAKASAVKRLAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 TRENARR 67


>gi|160915018|ref|ZP_02077231.1| hypothetical protein EUBDOL_01025 [Eubacterium dolichum DSM 3991]
 gi|158432817|gb|EDP11106.1| hypothetical protein EUBDOL_01025 [Eubacterium dolichum DSM 3991]
          Length = 84

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 21/72 (29%), Positives = 33/72 (45%)

Query: 3  VFNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKR 62
          +F+    + SEGR      VL  +  ++ ALR  K+++   G L E + R  Y KP  +R
Sbjct: 11 LFSIINVLASEGRVNMPKVVLKENEVLDDALRRFKRQVSRNGTLAEARKREFYVKPGVRR 70

Query: 63 VRLKSEAIRRSR 74
                A +  R
Sbjct: 71 KLKSEAARKARR 82


>gi|126439159|ref|YP_001060863.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 668]
 gi|126454796|ref|YP_001068170.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106a]
 gi|217423845|ref|ZP_03455345.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 576]
 gi|226193082|ref|ZP_03788692.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pakistan 9]
 gi|237814261|ref|YP_002898712.1| ribosomal protein S21 [Burkholderia pseudomallei MSHR346]
 gi|242317085|ref|ZP_04816101.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106b]
 gi|254201454|ref|ZP_04907818.1| 30S ribosomal protein S21 [Burkholderia mallei FMH]
 gi|254259689|ref|ZP_04950743.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1710a]
 gi|126218652|gb|ABN82158.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 668]
 gi|126228438|gb|ABN91978.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106a]
 gi|147747348|gb|EDK54424.1| 30S ribosomal protein S21 [Burkholderia mallei FMH]
 gi|217392908|gb|EEC32930.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 576]
 gi|225934682|gb|EEH30659.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pakistan 9]
 gi|237504998|gb|ACQ97316.1| ribosomal protein S21 [Burkholderia pseudomallei MSHR346]
 gi|242140324|gb|EES26726.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106b]
 gi|254218378|gb|EET07762.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1710a]
          Length = 87

 Score = 44.1 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 20/76 (26%), Positives = 37/76 (48%)

Query: 11 FSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
            + R      +L  +   E A+R  ++ ++  G++ EL+ R  YEKP+  R R K+ A+
Sbjct: 11 IKQIRNDMTTILLKENEPFEVAIRRFRRAIEKNGLIAELRERQAYEKPTAVRKRKKAAAV 70

Query: 71 RRSRKLMRKIAQREGA 86
          +R  K +R     +  
Sbjct: 71 KRLHKRLRSQMLPKKL 86


>gi|330721844|gb|EGG99814.1| SSU ribosomal protein S21p [gamma proteobacterium IMCC2047]
          Length = 71

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +++N   + ALR  K+  +  G+L +++ R  YEKP+  R R  + A++R +K +
Sbjct: 1  MPQVKLKENEPFDVALRRFKRSCEKAGILADVRKREFYEKPTWVRKRKAAAAVKRHQKKV 60

Query: 78 RKIAQR 83
           +  +R
Sbjct: 61 SRETRR 66


>gi|291288692|ref|YP_003505508.1| 30S ribosomal protein S21 [Denitrovibrio acetiphilus DSM 12809]
 gi|290885852|gb|ADD69552.1| ribosomal protein S21 [Denitrovibrio acetiphilus DSM 12809]
          Length = 72

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 28/62 (45%), Positives = 46/62 (74%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
          V V  +NV+ AL++LKKK++ EG++RE+K   +YEKP++ R +   +A R+ +KL RKIA
Sbjct: 7  VRVDGDNVDYALKLLKKKIEREGLIREIKKYTYYEKPTEVRRKKLLKARRKQQKLQRKIA 66

Query: 82 QR 83
          ++
Sbjct: 67 EK 68


>gi|149923489|ref|ZP_01911892.1| hypothetical protein PPSIR1_41069 [Plesiocystis pacifica SIR-1]
 gi|149815680|gb|EDM75209.1| hypothetical protein PPSIR1_41069 [Plesiocystis pacifica SIR-1]
          Length = 91

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 23/46 (50%), Positives = 31/46 (67%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
          + V V +  VE+A+R L++ M  EGVLRE+K R H+EKPS K  R 
Sbjct: 26 LEVRVDERGVERAIRKLRRLMASEGVLREIKRRRHHEKPSVKSKRK 71


>gi|53802942|ref|YP_115380.1| 30S ribosomal protein S21 [Methylococcus capsulatus str. Bath]
 gi|81680737|sp|Q602S0|RS21_METCA RecName: Full=30S ribosomal protein S21
 gi|53756703|gb|AAU90994.1| ribosomal protein S21 [Methylococcus capsulatus str. Bath]
          Length = 77

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 33/57 (57%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
           +   E A+R  K+  +  GVL E++ R +YEKP+++R R  + AI+R  K + +  
Sbjct: 8  ENEPFEIAIRRFKRACEKAGVLSEVRRREYYEKPTEERKRKAAAAIKRHLKKLSRER 64


>gi|89094380|ref|ZP_01167320.1| 30S ribosomal protein S21 [Oceanospirillum sp. MED92]
 gi|89081272|gb|EAR60504.1| 30S ribosomal protein S21 [Oceanospirillum sp. MED92]
          Length = 67

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 31/60 (51%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   + ALR  K+  +  G+L E++ R  YEKP+  R R  + A++R  K + +   R 
Sbjct: 4  ENEPFDVALRRFKRSCEKAGILAEVRRREFYEKPTSVRKRKAAAAVKRHAKKVSRENARR 63


>gi|53716437|ref|YP_105143.1| 30S ribosomal protein S21 [Burkholderia mallei ATCC 23344]
 gi|53722779|ref|YP_111764.1| 30S ribosomal protein S21 [Burkholderia pseudomallei K96243]
 gi|67643218|ref|ZP_00441966.1| 30S ribosomal protein S21 [Burkholderia mallei GB8 horse 4]
 gi|76817923|ref|YP_335994.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1710b]
 gi|121596528|ref|YP_991112.1| 30S ribosomal protein S21 [Burkholderia mallei SAVP1]
 gi|126443122|ref|YP_001063522.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 668]
 gi|126445629|ref|YP_001077573.1| 30S ribosomal protein S21 [Burkholderia mallei NCTC 10247]
 gi|126456199|ref|YP_001076419.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106a]
 gi|134278696|ref|ZP_01765410.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 305]
 gi|161521352|ref|YP_001584779.1| 30S ribosomal protein S21 [Burkholderia multivorans ATCC 17616]
 gi|167000274|ref|ZP_02266093.1| 30S ribosomal protein S21 [Burkholderia mallei PRL-20]
 gi|167566506|ref|ZP_02359422.1| ribosomal protein S21 [Burkholderia oklahomensis EO147]
 gi|167573587|ref|ZP_02366461.1| ribosomal protein S21 [Burkholderia oklahomensis C6786]
 gi|167724586|ref|ZP_02407822.1| ribosomal protein S21 [Burkholderia pseudomallei DM98]
 gi|167743536|ref|ZP_02416310.1| ribosomal protein S21 [Burkholderia pseudomallei 14]
 gi|167820725|ref|ZP_02452405.1| ribosomal protein S21 [Burkholderia pseudomallei 91]
 gi|167829084|ref|ZP_02460555.1| ribosomal protein S21 [Burkholderia pseudomallei 9]
 gi|167842194|ref|ZP_02468878.1| ribosomal protein S21 [Burkholderia thailandensis MSMB43]
 gi|167850561|ref|ZP_02476069.1| ribosomal protein S21 [Burkholderia pseudomallei B7210]
 gi|167899154|ref|ZP_02486555.1| ribosomal protein S21 [Burkholderia pseudomallei 7894]
 gi|167907497|ref|ZP_02494702.1| ribosomal protein S21 [Burkholderia pseudomallei NCTC 13177]
 gi|167915836|ref|ZP_02502927.1| ribosomal protein S21 [Burkholderia pseudomallei 112]
 gi|167923675|ref|ZP_02510766.1| ribosomal protein S21 [Burkholderia pseudomallei BCC215]
 gi|189352481|ref|YP_001948108.1| 30S ribosomal protein S21 [Burkholderia multivorans ATCC 17616]
 gi|217422668|ref|ZP_03454171.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 576]
 gi|221197054|ref|ZP_03570101.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2M]
 gi|221203726|ref|ZP_03576744.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2]
 gi|221212352|ref|ZP_03585329.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD1]
 gi|226195854|ref|ZP_03791441.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pakistan 9]
 gi|237510061|ref|ZP_04522776.1| ribosomal protein S21 [Burkholderia pseudomallei MSHR346]
 gi|242312910|ref|ZP_04811927.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106b]
 gi|254177192|ref|ZP_04883848.1| 30S ribosomal protein S21 [Burkholderia mallei ATCC 10399]
 gi|254184928|ref|ZP_04891517.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1655]
 gi|254186157|ref|ZP_04892675.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pasteur
          52237]
 gi|254194250|ref|ZP_04900682.1| 30S ribosomal protein S21 [Burkholderia pseudomallei S13]
 gi|254203081|ref|ZP_04909443.1| 30S ribosomal protein S21 [Burkholderia mallei FMH]
 gi|254208414|ref|ZP_04914763.1| 30S ribosomal protein S21 [Burkholderia mallei JHU]
 gi|254253606|ref|ZP_04946923.1| Ribosomal protein S21 [Burkholderia dolosa AUO158]
 gi|254265310|ref|ZP_04956175.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1710a]
 gi|254301210|ref|ZP_04968654.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 406e]
 gi|254359400|ref|ZP_04975672.1| 30S ribosomal protein S21 [Burkholderia mallei 2002721280]
 gi|55976309|sp|Q62DT5|RS21B_BURMA RecName: Full=30S ribosomal protein S21 B
 gi|81689982|sp|Q63JF8|RS213_BURPS RecName: Full=30S ribosomal protein S21 3
 gi|119367226|sp|Q3JKA9|RS213_BURP1 RecName: Full=30S ribosomal protein S21 3
 gi|52213193|emb|CAH39233.1| 30S ribosomal protein S21 [Burkholderia pseudomallei K96243]
 gi|52422407|gb|AAU45977.1| ribosomal protein S21 [Burkholderia mallei ATCC 23344]
 gi|76582396|gb|ABA51870.1| ribosomal protein S21 [Burkholderia pseudomallei 1710b]
 gi|121224326|gb|ABM47857.1| 30S ribosomal protein S21 [Burkholderia mallei SAVP1]
 gi|124898251|gb|EAY70094.1| Ribosomal protein S21 [Burkholderia dolosa AUO158]
 gi|126222613|gb|ABN86118.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 668]
 gi|126229967|gb|ABN93380.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106a]
 gi|126238483|gb|ABO01595.1| 30S ribosomal protein S21 [Burkholderia mallei NCTC 10247]
 gi|134250480|gb|EBA50560.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 305]
 gi|147746126|gb|EDK53204.1| 30S ribosomal protein S21 [Burkholderia mallei FMH]
 gi|147751101|gb|EDK58169.1| 30S ribosomal protein S21 [Burkholderia mallei JHU]
 gi|148028587|gb|EDK86547.1| 30S ribosomal protein S21 [Burkholderia mallei 2002721280]
 gi|157811005|gb|EDO88175.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 406e]
 gi|157933843|gb|EDO89513.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pasteur
          52237]
 gi|160345402|gb|ABX18487.1| ribosomal protein S21 [Burkholderia multivorans ATCC 17616]
 gi|160698232|gb|EDP88202.1| 30S ribosomal protein S21 [Burkholderia mallei ATCC 10399]
 gi|169651001|gb|EDS83694.1| 30S ribosomal protein S21 [Burkholderia pseudomallei S13]
 gi|184215520|gb|EDU12501.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1655]
 gi|189336503|dbj|BAG45572.1| small subunit ribosomal protein S21 [Burkholderia multivorans
          ATCC 17616]
 gi|217394899|gb|EEC34918.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 576]
 gi|221167451|gb|EED99920.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD1]
 gi|221175892|gb|EEE08321.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2]
 gi|221183608|gb|EEE16008.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2M]
 gi|225932339|gb|EEH28339.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pakistan 9]
 gi|235002266|gb|EEP51690.1| ribosomal protein S21 [Burkholderia pseudomallei MSHR346]
 gi|238524503|gb|EEP87936.1| 30S ribosomal protein S21 [Burkholderia mallei GB8 horse 4]
 gi|242136149|gb|EES22552.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106b]
 gi|243063762|gb|EES45948.1| 30S ribosomal protein S21 [Burkholderia mallei PRL-20]
 gi|254216312|gb|EET05697.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1710a]
 gi|325518125|gb|EGC97911.1| 30S ribosomal protein S21 [Burkholderia sp. TJI49]
          Length = 70

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTIIRVKENEPFEVAMRRFKRTIEKNGLLTELRAREFYEKPTAERKRKKAAAVKRHYKRI 60

Query: 78 RKIAQREGA 86
          R     +  
Sbjct: 61 RSQMLPKKL 69


>gi|171058469|ref|YP_001790818.1| 30S ribosomal protein S21 [Leptothrix cholodnii SP-6]
 gi|226695023|sp|B1XZ34|RS21_LEPCP RecName: Full=30S ribosomal protein S21
 gi|170775914|gb|ACB34053.1| ribosomal protein S21 [Leptothrix cholodnii SP-6]
          Length = 70

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   + ALR  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKENEPFDVALRRFKRTIEKLGLLTELRAREFYEKPTAERKRKKAAAVKRHYKRV 60

Query: 78 RKIAQREGA 86
          R +   +  
Sbjct: 61 RSMQLPKKL 69


>gi|121609940|ref|YP_997747.1| 30S ribosomal protein S21 [Verminephrobacter eiseniae EF01-2]
 gi|241767025|ref|ZP_04764811.1| ribosomal protein S21 [Acidovorax delafieldii 2AN]
 gi|166225205|sp|A1WM72|RS21_VEREI RecName: Full=30S ribosomal protein S21
 gi|121554580|gb|ABM58729.1| SSU ribosomal protein S21P [Verminephrobacter eiseniae EF01-2]
 gi|241362448|gb|EER58384.1| ribosomal protein S21 [Acidovorax delafieldii 2AN]
          Length = 70

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 39/68 (57%), Gaps = 1/68 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   + ALR  K+ ++  G+L +L+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKENEPFDVALRRFKRTIEKLGLLTDLRAREFYEKPTAERKRKKAAAVKRHYKRV 60

Query: 78 RKIAQREG 85
          R +   + 
Sbjct: 61 RSMQLPKK 68


>gi|296113813|ref|YP_003627751.1| 30S ribosomal protein S21 [Moraxella catarrhalis RH4]
 gi|295921507|gb|ADG61858.1| 30S ribosomal protein S21 [Moraxella catarrhalis RH4]
 gi|326562157|gb|EGE12485.1| 30S ribosomal protein S21 [Moraxella catarrhalis 7169]
 gi|326564478|gb|EGE14704.1| 30S ribosomal protein S21 [Moraxella catarrhalis 46P47B1]
 gi|326565661|gb|EGE15824.1| 30S ribosomal protein S21 [Moraxella catarrhalis 12P80B1]
 gi|326566229|gb|EGE16381.1| 30S ribosomal protein S21 [Moraxella catarrhalis 103P14B1]
 gi|326567118|gb|EGE17240.1| 30S ribosomal protein S21 [Moraxella catarrhalis BC1]
 gi|326568382|gb|EGE18462.1| 30S ribosomal protein S21 [Moraxella catarrhalis BC7]
 gi|326572283|gb|EGE22278.1| 30S ribosomal protein S21 [Moraxella catarrhalis BC8]
 gi|326574297|gb|EGE24244.1| 30S ribosomal protein S21 [Moraxella catarrhalis O35E]
 gi|326574881|gb|EGE24811.1| 30S ribosomal protein S21 [Moraxella catarrhalis 101P30B1]
 gi|326576205|gb|EGE26120.1| 30S ribosomal protein S21 [Moraxella catarrhalis CO72]
          Length = 71

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 40/67 (59%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N  V+ A+R  K+  +  GVL +++ +  +EKP+Q+R R K+ A++R +K +
Sbjct: 1  MPSVKVKENEPVDIAIRRFKRACEKAGVLADVRKKEFFEKPTQERKRKKAAAVKRYKKKV 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 YREQVRH 67


>gi|237809409|ref|YP_002893849.1| 30S ribosomal protein S21 [Tolumonas auensis DSM 9187]
 gi|259494895|sp|C4LB60|RS21_TOLAT RecName: Full=30S ribosomal protein S21
 gi|237501670|gb|ACQ94263.1| ribosomal protein S21 [Tolumonas auensis DSM 9187]
          Length = 71

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  GVL +++ R  YEKP+  R R K+ A++R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGVLSDVRSREFYEKPTTIRKRAKASAVKRHMKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|50084512|ref|YP_046022.1| 30S ribosomal protein S21 [Acinetobacter sp. ADP1]
 gi|169633016|ref|YP_001706752.1| 30S ribosomal protein S21 [Acinetobacter baumannii SDF]
 gi|169795415|ref|YP_001713208.1| 30S ribosomal protein S21 [Acinetobacter baumannii AYE]
 gi|213158647|ref|YP_002319945.1| ribosomal protein S21 [Acinetobacter baumannii AB0057]
 gi|215482899|ref|YP_002325102.1| ribosomal protein S21 [Acinetobacter baumannii AB307-0294]
 gi|239502863|ref|ZP_04662173.1| 30S ribosomal protein S21 [Acinetobacter baumannii AB900]
 gi|255319475|ref|ZP_05360689.1| ribosomal protein S21 [Acinetobacter radioresistens SK82]
 gi|260550942|ref|ZP_05825148.1| ribosomal protein S21 [Acinetobacter sp. RUH2624]
 gi|260554479|ref|ZP_05826700.1| ribosomal protein S21 [Acinetobacter baumannii ATCC 19606]
 gi|262278462|ref|ZP_06056247.1| ribosomal protein S21 [Acinetobacter calcoaceticus RUH2202]
 gi|262369684|ref|ZP_06063012.1| ribosomal protein S21 [Acinetobacter johnsonii SH046]
 gi|262376287|ref|ZP_06069517.1| ribosomal protein S21 [Acinetobacter lwoffii SH145]
 gi|262378501|ref|ZP_06071658.1| ribosomal protein S21 [Acinetobacter radioresistens SH164]
 gi|293609532|ref|ZP_06691834.1| 30S ribosomal protein S21 [Acinetobacter sp. SH024]
 gi|299769407|ref|YP_003731433.1| 30S ribosomal protein S21 [Acinetobacter sp. DR1]
 gi|301346319|ref|ZP_07227060.1| 30S ribosomal protein S21 [Acinetobacter baumannii AB056]
 gi|301510789|ref|ZP_07236026.1| 30S ribosomal protein S21 [Acinetobacter baumannii AB058]
 gi|301597729|ref|ZP_07242737.1| 30S ribosomal protein S21 [Acinetobacter baumannii AB059]
 gi|332850477|ref|ZP_08432797.1| ribosomal protein S21 [Acinetobacter baumannii 6013150]
 gi|332871929|ref|ZP_08440341.1| ribosomal protein S21 [Acinetobacter baumannii 6013113]
 gi|332875135|ref|ZP_08442968.1| ribosomal protein S21 [Acinetobacter baumannii 6014059]
 gi|61215918|sp|Q6FCL0|RS21_ACIAD RecName: Full=30S ribosomal protein S21
 gi|226694962|sp|B0V810|RS21_ACIBY RecName: Full=30S ribosomal protein S21
 gi|226695447|sp|B7H0A6|RS21_ACIB3 RecName: Full=30S ribosomal protein S21
 gi|226695448|sp|B7I2K7|RS21_ACIB5 RecName: Full=30S ribosomal protein S21
 gi|226695449|sp|B0VKC6|RS21_ACIBS RecName: Full=30S ribosomal protein S21
 gi|226695450|sp|A3M6X4|RS21_ACIBT RecName: Full=30S ribosomal protein S21
 gi|49530488|emb|CAG68200.1| 30S ribosomal protein S21 [Acinetobacter sp. ADP1]
 gi|169148342|emb|CAM86207.1| 30S ribosomal protein S21 [Acinetobacter baumannii AYE]
 gi|169151808|emb|CAP00629.1| 30S ribosomal protein S21 [Acinetobacter baumannii]
 gi|193077796|gb|ABO12668.2| 30S ribosomal protein S21 [Acinetobacter baumannii ATCC 17978]
 gi|213057807|gb|ACJ42709.1| ribosomal protein S21 [Acinetobacter baumannii AB0057]
 gi|213989025|gb|ACJ59324.1| ribosomal protein S21 [Acinetobacter baumannii AB307-0294]
 gi|255303415|gb|EET82618.1| ribosomal protein S21 [Acinetobacter radioresistens SK82]
 gi|260406069|gb|EEW99555.1| ribosomal protein S21 [Acinetobacter sp. RUH2624]
 gi|260411021|gb|EEX04318.1| ribosomal protein S21 [Acinetobacter baumannii ATCC 19606]
 gi|262258813|gb|EEY77546.1| ribosomal protein S21 [Acinetobacter calcoaceticus RUH2202]
 gi|262299786|gb|EEY87698.1| ribosomal protein S21 [Acinetobacter radioresistens SH164]
 gi|262308888|gb|EEY90021.1| ribosomal protein S21 [Acinetobacter lwoffii SH145]
 gi|262315752|gb|EEY96791.1| ribosomal protein S21 [Acinetobacter johnsonii SH046]
 gi|292827984|gb|EFF86347.1| 30S ribosomal protein S21 [Acinetobacter sp. SH024]
 gi|298699495|gb|ADI90060.1| 30S ribosomal protein S21 [Acinetobacter sp. DR1]
 gi|322507421|gb|ADX02875.1| rpsU [Acinetobacter baumannii 1656-2]
 gi|323518681|gb|ADX93062.1| 30S ribosomal protein S21 [Acinetobacter baumannii TCDC-AB0715]
 gi|325122801|gb|ADY82324.1| 30S ribosomal protein S21 [Acinetobacter calcoaceticus PHEA-2]
 gi|332730748|gb|EGJ62059.1| ribosomal protein S21 [Acinetobacter baumannii 6013150]
 gi|332731143|gb|EGJ62444.1| ribosomal protein S21 [Acinetobacter baumannii 6013113]
 gi|332736579|gb|EGJ67573.1| ribosomal protein S21 [Acinetobacter baumannii 6014059]
          Length = 71

 Score = 44.1 bits (103), Expect = 0.007,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +++   V+ A+R  K+  +  GVL +++ R  YEKP+Q+R R K+ A++R +K +
Sbjct: 1  MPQVKLKEGEPVDVAIRRFKRSCEKAGVLADVRKREFYEKPTQERKRKKAAAVKRYQKKL 60

Query: 78 RKIAQR 83
           + + R
Sbjct: 61 ARESVR 66


>gi|296136716|ref|YP_003643958.1| ribosomal protein S21 [Thiomonas intermedia K12]
 gi|294340872|emb|CAZ89267.1| 30S ribosomal protein S21 [Thiomonas sp. 3As]
 gi|295796838|gb|ADG31628.1| ribosomal protein S21 [Thiomonas intermedia K12]
          Length = 70

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   + ALR  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKENEPFDVALRRFKRTIEKLGLLTELRAREFYEKPTAERKRKKAAAVKRHYKRI 60

Query: 78 RKIAQRE 84
          R     E
Sbjct: 61 RSQTLPE 67


>gi|312795730|ref|YP_004028652.1| SSU ribosomal protein S21P [Burkholderia rhizoxinica HKI 454]
 gi|312167505|emb|CBW74508.1| SSU ribosomal protein S21P [Burkholderia rhizoxinica HKI 454]
          Length = 70

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKENEPFEVAMRRFKRTIEKNGLLTELRAREFYEKPTAERKRKKAAAVKRHFKRL 60

Query: 78 RKIAQREGA 86
          R     +  
Sbjct: 61 RSQMLPKKL 69


>gi|319944406|ref|ZP_08018680.1| 30S ribosomal protein S21 [Lautropia mirabilis ATCC 51599]
 gi|319742367|gb|EFV94780.1| 30S ribosomal protein S21 [Lautropia mirabilis ATCC 51599]
          Length = 70

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 1/68 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+ ++  G+L EL+ R  YEKP+ +R R KS A++R  K +
Sbjct: 1  MPLVRVKENEPFDVALRRFKRTIEKTGLLTELRAREFYEKPTAERKRKKSAAVKRHHKRL 60

Query: 78 RKIAQREG 85
          R     + 
Sbjct: 61 RSQMLPKK 68


>gi|301169246|emb|CBW28843.1| 30S ribosomal subunit protein S21 [Haemophilus influenzae 10810]
          Length = 71

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R  +   +R  K  
Sbjct: 1  MPVIKVRENESFDVALRRFKRSCEKAGILAEIRAREFYEKPTTIRKRENATLAKRHAKRN 60

Query: 78 RKIAQR 83
           +   R
Sbjct: 61 ARENAR 66


>gi|332528739|ref|ZP_08404716.1| 30S ribosomal protein S21 [Hylemonella gracilis ATCC 19624]
 gi|260223164|emb|CBA33452.1| 30S ribosomal protein S21 [Curvibacter putative symbiont of Hydra
          magnipapillata]
 gi|332041805|gb|EGI78154.1| 30S ribosomal protein S21 [Hylemonella gracilis ATCC 19624]
          Length = 70

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 40/69 (57%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   + ALR  K+ ++  G+L +L+ R  YEKP+ +R R K+ A++R+ K +
Sbjct: 1  MTTIRVKENEPFDVALRRFKRTIEKLGLLTDLRAREFYEKPTAERKRKKAAAVKRNYKRI 60

Query: 78 RKIAQREGA 86
          R +   +  
Sbjct: 61 RSMQLPKKL 69


>gi|316967378|gb|EFV51808.1| putative ribosomal protein S21 [Trichinella spiralis]
          Length = 357

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 12/66 (18%)

Query: 6   AFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
            FRGI    +      VLV+DNNVE+AL++L             K   +YEKP Q+R + 
Sbjct: 277 LFRGITRAHQRFINKTVLVKDNNVEEALKILN------------KRTRYYEKPYQQRNQY 324

Query: 66  KSEAIR 71
             E  +
Sbjct: 325 SYEICK 330


>gi|33519538|ref|NP_878370.1| 30S ribosomal subunit protein S21 [Candidatus Blochmannia
          floridanus]
 gi|61216023|sp|Q7VQR0|RS21_BLOFL RecName: Full=30S ribosomal protein S21
 gi|33517201|emb|CAD83583.1| 30S ribosomal subunit protein S21 [Candidatus Blochmannia
          floridanus]
          Length = 71

 Score = 43.7 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+ +R R K+ AI+R  K +
Sbjct: 1  MPIIKVRENEPFDVALRRFKRSCEKAGILSEVRRREFYEKPTTERKRAKASAIKRHIKKI 60

Query: 78 RKIAQRE 84
           +   ++
Sbjct: 61 NREQLKK 67


>gi|126642286|ref|YP_001085270.1| 30S ribosomal protein S21 [Acinetobacter baumannii ATCC 17978]
 gi|184158766|ref|YP_001847105.1| 30S ribosomal protein S21 [Acinetobacter baumannii ACICU]
 gi|183210360|gb|ACC57758.1| 30S ribosomal protein S21 [Acinetobacter baumannii ACICU]
          Length = 66

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 36/55 (65%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQR 83
          V+ A+R  K+  +  GVL +++ R  YEKP+Q+R R K+ A++R +K + + + R
Sbjct: 7  VDVAIRRFKRSCEKAGVLADVRKREFYEKPTQERKRKKAAAVKRYQKKLARESVR 61


>gi|159899178|ref|YP_001545425.1| 30S ribosomal protein S21 [Herpetosiphon aurantiacus ATCC 23779]
 gi|226695017|sp|A9B119|RS21_HERA2 RecName: Full=30S ribosomal protein S21
 gi|159892217|gb|ABX05297.1| ribosomal protein S21 [Herpetosiphon aurantiacus ATCC 23779]
          Length = 65

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 36/53 (67%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
          + ++++ALR   K +Q +G+L E + R HYEKPS KR R ++  +R+ +K+ R
Sbjct: 9  NESIDKALRRFNKAVQADGILTEARRREHYEKPSVKRKRKEAARLRKLQKMAR 61


>gi|283851057|ref|ZP_06368341.1| ribosomal protein S21 [Desulfovibrio sp. FW1012B]
 gi|303245328|ref|ZP_07331612.1| ribosomal protein S21 [Desulfovibrio fructosovorans JJ]
 gi|283573453|gb|EFC21429.1| ribosomal protein S21 [Desulfovibrio sp. FW1012B]
 gi|302493177|gb|EFL53039.1| ribosomal protein S21 [Desulfovibrio fructosovorans JJ]
          Length = 66

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 36/54 (66%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
          +N + ALR  KK+++  G+L ELK R H+EKPS  R + K+ A +R  K MRKI
Sbjct: 10 DNFDVALRRFKKQVEKSGILSELKKRQHFEKPSVMRKKKKAAARKRLLKKMRKI 63


>gi|78063054|ref|YP_372962.1| 30S ribosomal protein S21 [Burkholderia sp. 383]
 gi|107026826|ref|YP_624337.1| 30S ribosomal protein S21 [Burkholderia cenocepacia AU 1054]
 gi|116691980|ref|YP_837513.1| 30S ribosomal protein S21 [Burkholderia cenocepacia HI2424]
 gi|134292970|ref|YP_001116706.1| 30S ribosomal protein S21 [Burkholderia vietnamiensis G4]
 gi|170736026|ref|YP_001777286.1| ribosomal protein S21 [Burkholderia cenocepacia MC0-3]
 gi|206562770|ref|YP_002233533.1| 30S ribosomal protein S21 [Burkholderia cenocepacia J2315]
 gi|254248775|ref|ZP_04942095.1| 30S ribosomal protein S21 [Burkholderia cenocepacia PC184]
 gi|330821207|ref|YP_004350069.1| 30S ribosomal protein S21 [Burkholderia gladioli BSR3]
 gi|119367202|sp|Q1BLZ1|RS211_BURCA RecName: Full=30S ribosomal protein S21 1
 gi|119367241|sp|Q393P8|RS21_BURS3 RecName: Full=30S ribosomal protein S21
 gi|77970939|gb|ABB12318.1| SSU ribosomal protein S21P [Burkholderia sp. 383]
 gi|105896200|gb|ABF79364.1| SSU ribosomal protein S21P [Burkholderia cenocepacia AU 1054]
 gi|116649980|gb|ABK10620.1| SSU ribosomal protein S21P [Burkholderia cenocepacia HI2424]
 gi|124875276|gb|EAY65266.1| 30S ribosomal protein S21 [Burkholderia cenocepacia PC184]
 gi|134136127|gb|ABO57241.1| SSU ribosomal protein S21P [Burkholderia vietnamiensis G4]
 gi|169818214|gb|ACA92796.1| ribosomal protein S21 [Burkholderia cenocepacia MC0-3]
 gi|198038810|emb|CAR54772.1| 30S ribosomal protein S21 2 [Burkholderia cenocepacia J2315]
 gi|327373202|gb|AEA64557.1| 30S ribosomal protein S21 [Burkholderia gladioli BSR3]
          Length = 70

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTIIRVKENEPFEVAMRRFKRTIEKNGLLTELRAREFYEKPTAERKRKKAAAVKRHYKRI 60

Query: 78 RKIAQREGA 86
          R     +  
Sbjct: 61 RSQTLPKKL 69


>gi|262372996|ref|ZP_06066275.1| ribosomal protein S21 [Acinetobacter junii SH205]
 gi|262313021|gb|EEY94106.1| ribosomal protein S21 [Acinetobacter junii SH205]
          Length = 71

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 40/66 (60%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +++   V+ A+R  K+  +  GVL +++ R  YEKP+Q+R R K+ A++R +K +
Sbjct: 1  MPQVKLKEGEPVDVAIRRFKRSCEKAGVLADVRKREFYEKPTQERKRKKAAAVKRYQKKL 60

Query: 78 RKIAQR 83
           + + R
Sbjct: 61 TRESVR 66


>gi|32491219|ref|NP_871473.1| hypothetical protein WGLp470 [Wigglesworthia glossinidia
          endosymbiont of Glossina brevipalpis]
 gi|31340409|sp|Q8D284|RS21_WIGBR RecName: Full=30S ribosomal protein S21
 gi|25166426|dbj|BAC24616.1| rpsU [Wigglesworthia glossinidia endosymbiont of Glossina
          brevipalpis]
          Length = 71

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 34/60 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   + ALR  K+  +  G+L E++ R  YEKP+ +R R K+ AI+R  K M +   ++
Sbjct: 8  ENEPFDVALRRFKRSCEKAGILSEVRRREFYEKPTTERKRAKASAIKRHAKKMARENLKK 67


>gi|332526718|ref|ZP_08402820.1| 30S ribosomal protein S21 [Rubrivivax benzoatilyticus JA2]
 gi|332111121|gb|EGJ11153.1| 30S ribosomal protein S21 [Rubrivivax benzoatilyticus JA2]
          Length = 70

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   + ALR  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKENEPFDVALRRFKRTIEKIGLLTELRAREFYEKPTAERKRKKAAAVKRHFKRV 60

Query: 78 RKIAQREGA 86
          R +   +  
Sbjct: 61 RSMQLPKKL 69


>gi|83716896|ref|YP_438818.1| 30S ribosomal protein S21 [Burkholderia thailandensis E264]
 gi|167577169|ref|ZP_02370043.1| 30S ribosomal protein S21 [Burkholderia thailandensis TXDOH]
 gi|167615339|ref|ZP_02383974.1| 30S ribosomal protein S21 [Burkholderia thailandensis Bt4]
 gi|257141902|ref|ZP_05590164.1| 30S ribosomal protein S21 [Burkholderia thailandensis E264]
 gi|119367216|sp|Q2T7N1|RS212_BURTA RecName: Full=30S ribosomal protein S21 2
 gi|83650721|gb|ABC34785.1| ribosomal protein S21 [Burkholderia thailandensis E264]
          Length = 70

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTIIRVKENEPFEVAMRRFKRTIEKNGLLTELRAREFYEKPTAERKRKKAAAVKRHYKRI 60

Query: 78 RKIAQREGA 86
          R     +  
Sbjct: 61 RGQMLPKKL 69


>gi|258406018|ref|YP_003198760.1| 30S ribosomal protein S21 [Desulfohalobium retbaense DSM 5692]
 gi|257798245|gb|ACV69182.1| ribosomal protein S21 [Desulfohalobium retbaense DSM 5692]
          Length = 66

 Score = 43.7 bits (102), Expect = 0.009,   Method: Composition-based stats.
 Identities = 25/56 (44%), Positives = 37/56 (66%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
           +N E +LR  KK+++  G+L ELK R HYEKPS +R + ++ A +R  K MRK+ 
Sbjct: 9  HDNFEASLRKFKKQVEKAGILSELKKRQHYEKPSIQRKKKEAAARKRLLKKMRKMR 64


>gi|297519521|ref|ZP_06937907.1| 30S ribosomal protein S21 [Escherichia coli OP50]
          Length = 61

 Score = 43.3 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
             + VR+N   + ALR  K+  +  GVL E++ R  YEKP+ +R R K+ A++R  K 
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKK 59


>gi|16272475|ref|NP_438689.1| 30S ribosomal protein S21 [Haemophilus influenzae Rd KW20]
 gi|68249128|ref|YP_248240.1| 30S ribosomal protein S21 [Haemophilus influenzae 86-028NP]
 gi|145628915|ref|ZP_01784715.1| O-sialoglycoprotein endopeptidase [Haemophilus influenzae
          22.1-21]
 gi|145630291|ref|ZP_01786072.1| DNA primase [Haemophilus influenzae R3021]
 gi|145633517|ref|ZP_01789246.1| DNA primase [Haemophilus influenzae 3655]
 gi|145635388|ref|ZP_01791090.1| DNA primase [Haemophilus influenzae PittAA]
 gi|145637428|ref|ZP_01793087.1| DNA primase [Haemophilus influenzae PittHH]
 gi|145638553|ref|ZP_01794162.1| DNA primase [Haemophilus influenzae PittII]
 gi|145640509|ref|ZP_01796093.1| O-sialoglycoprotein endopeptidase [Haemophilus influenzae R3021]
 gi|148825195|ref|YP_001289948.1| 30S ribosomal protein S21 [Haemophilus influenzae PittEE]
 gi|148827722|ref|YP_001292475.1| 30S ribosomal protein S21 [Haemophilus influenzae PittGG]
 gi|229844310|ref|ZP_04464450.1| 30S ribosomal protein S21 [Haemophilus influenzae 6P18H1]
 gi|229846614|ref|ZP_04466722.1| 30S ribosomal protein S21 [Haemophilus influenzae 7P49H1]
 gi|260580978|ref|ZP_05848801.1| ribosomal protein S21 [Haemophilus influenzae RdAW]
 gi|260582765|ref|ZP_05850552.1| ribosomal protein S21 [Haemophilus influenzae NT127]
 gi|319775548|ref|YP_004138036.1| 30S ribosomal protein S21 [Haemophilus influenzae F3047]
 gi|319897952|ref|YP_004136149.1| 30S ribosomal protein s21 [Haemophilus influenzae F3031]
 gi|329122409|ref|ZP_08250996.1| 30S ribosomal protein S21 [Haemophilus aegyptius ATCC 11116]
 gi|1173233|sp|P44386|RS21_HAEIN RecName: Full=30S ribosomal protein S21
 gi|81336466|sp|Q4QN17|RS21_HAEI8 RecName: Full=30S ribosomal protein S21
 gi|166224031|sp|A5U9W4|RS21_HAEIE RecName: Full=30S ribosomal protein S21
 gi|166224032|sp|A5UH36|RS21_HAEIG RecName: Full=30S ribosomal protein S21
 gi|1573515|gb|AAC22188.1| ribosomal protein S21 (rpS21) [Haemophilus influenzae Rd KW20]
 gi|68057327|gb|AAX87580.1| 30S ribosomal protein S21 [Haemophilus influenzae 86-028NP]
 gi|144979385|gb|EDJ89071.1| O-sialoglycoprotein endopeptidase [Haemophilus influenzae
          22.1-21]
 gi|144984026|gb|EDJ91463.1| DNA primase [Haemophilus influenzae R3021]
 gi|144985886|gb|EDJ92494.1| DNA primase [Haemophilus influenzae 3655]
 gi|145267394|gb|EDK07396.1| DNA primase [Haemophilus influenzae PittAA]
 gi|145269374|gb|EDK09318.1| DNA primase [Haemophilus influenzae PittHH]
 gi|145272148|gb|EDK12056.1| DNA primase [Haemophilus influenzae PittII]
 gi|145275095|gb|EDK14957.1| O-sialoglycoprotein endopeptidase [Haemophilus influenzae
          22.4-21]
 gi|148715355|gb|ABQ97565.1| 30S ribosomal protein S21 [Haemophilus influenzae PittEE]
 gi|148718964|gb|ABR00092.1| 30S ribosomal protein S21 [Haemophilus influenzae PittGG]
 gi|229810707|gb|EEP46425.1| 30S ribosomal protein S21 [Haemophilus influenzae 7P49H1]
 gi|229812559|gb|EEP48248.1| 30S ribosomal protein S21 [Haemophilus influenzae 6P18H1]
 gi|260092337|gb|EEW76277.1| ribosomal protein S21 [Haemophilus influenzae RdAW]
 gi|260094215|gb|EEW78116.1| ribosomal protein S21 [Haemophilus influenzae NT127]
 gi|309750058|gb|ADO80042.1| 30S ribosomal subunit protein S21 [Haemophilus influenzae R2866]
 gi|309972318|gb|ADO95519.1| 30S ribosomal subunit protein S21 [Haemophilus influenzae R2846]
 gi|317433458|emb|CBY81841.1| 30S ribosomal protein S21 [Haemophilus influenzae F3031]
 gi|317450139|emb|CBY86353.1| 30S ribosomal protein S21 [Haemophilus influenzae F3047]
 gi|327473691|gb|EGF19110.1| 30S ribosomal protein S21 [Haemophilus aegyptius ATCC 11116]
          Length = 71

 Score = 43.3 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 32/66 (48%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R  +   +R  K  
Sbjct: 1  MPVIKVRENESFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIRKRENATLAKRHAKRN 60

Query: 78 RKIAQR 83
           +   R
Sbjct: 61 ARENAR 66


>gi|212696306|ref|ZP_03304434.1| hypothetical protein ANHYDRO_00843 [Anaerococcus hydrogenalis DSM
          7454]
 gi|212676935|gb|EEB36542.1| hypothetical protein ANHYDRO_00843 [Anaerococcus hydrogenalis DSM
          7454]
          Length = 71

 Score = 43.3 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 18/47 (38%), Positives = 27/47 (57%), Gaps = 1/47 (2%)

Query: 17 ISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKR 62
          I    + V +N  ++ A++  K++    GVL E + R HYEKPS KR
Sbjct: 8  IEMTEIRVGENESIDSAIKRFKRQCARSGVLTEYRKREHYEKPSLKR 54


>gi|238897853|ref|YP_002923532.1| 30S ribosomal subunit protein S21 [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
 gi|259494889|sp|C4K491|RS21_HAMD5 RecName: Full=30S ribosomal protein S21
 gi|229465610|gb|ACQ67384.1| 30S ribosomal subunit protein S21 [Candidatus Hamiltonella
          defensa 5AT (Acyrthosiphon pisum)]
          Length = 71

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+ +R R ++ AI+R  K +
Sbjct: 1  MPIIKVRENEPFDVALRRFKRSCEKAGILAEVRRRESYEKPTTERKRARASAIKRHAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|94266575|ref|ZP_01290259.1| Ribosomal protein S21 [delta proteobacterium MLMS-1]
 gi|94266673|ref|ZP_01290349.1| Ribosomal protein S21 [delta proteobacterium MLMS-1]
 gi|93452690|gb|EAT03244.1| Ribosomal protein S21 [delta proteobacterium MLMS-1]
 gi|93452793|gb|EAT03325.1| Ribosomal protein S21 [delta proteobacterium MLMS-1]
          Length = 64

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 30/64 (46%), Positives = 44/64 (68%), Gaps = 1/64 (1%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + V VR  +VE A+R+LKKK+Q +G+ +ELK R  YEKPS KR R  +E+ R+ RKL  
Sbjct: 1  MIEVEVR-GDVEHAIRILKKKVQLDGMKKELKRRESYEKPSAKRRRKAAESRRKLRKLQF 59

Query: 79 KIAQ 82
          ++ +
Sbjct: 60 RMER 63


>gi|15595776|ref|NP_249270.1| 30S ribosomal protein S21 [Pseudomonas aeruginosa PAO1]
 gi|107099565|ref|ZP_01363483.1| hypothetical protein PaerPA_01000578 [Pseudomonas aeruginosa
          PACS2]
 gi|116054307|ref|YP_788752.1| 30S ribosomal protein S21 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|152985127|ref|YP_001346117.1| 30S ribosomal protein S21 [Pseudomonas aeruginosa PA7]
 gi|218889320|ref|YP_002438184.1| 30S ribosomal protein S21 [Pseudomonas aeruginosa LESB58]
 gi|226946705|ref|YP_002801778.1| 30S ribosomal protein S21 [Azotobacter vinelandii DJ]
 gi|254237205|ref|ZP_04930528.1| 30S ribosomal protein S21 [Pseudomonas aeruginosa C3719]
 gi|254243673|ref|ZP_04936995.1| 30S ribosomal protein S21 [Pseudomonas aeruginosa 2192]
 gi|296387085|ref|ZP_06876584.1| 30S ribosomal protein S21 [Pseudomonas aeruginosa PAb1]
 gi|313111776|ref|ZP_07797569.1| 30S ribosomal protein S21 [Pseudomonas aeruginosa 39016]
 gi|13959517|sp|Q9I5V8|RS21_PSEAE RecName: Full=30S ribosomal protein S21
 gi|122261550|sp|Q02TI4|RS21_PSEAB RecName: Full=30S ribosomal protein S21
 gi|166224055|sp|A6UZ82|RS21_PSEA7 RecName: Full=30S ribosomal protein S21
 gi|226695038|sp|B7V4G5|RS21_PSEA8 RecName: Full=30S ribosomal protein S21
 gi|259494878|sp|C1DIY4|RS21_AZOVD RecName: Full=30S ribosomal protein S21
 gi|9946450|gb|AAG03968.1|AE004494_4 30S ribosomal protein S21 [Pseudomonas aeruginosa PAO1]
 gi|115589528|gb|ABJ15543.1| 30S ribosomal protein S21 [Pseudomonas aeruginosa UCBPP-PA14]
 gi|126169136|gb|EAZ54647.1| 30S ribosomal protein S21 [Pseudomonas aeruginosa C3719]
 gi|126197051|gb|EAZ61114.1| 30S ribosomal protein S21 [Pseudomonas aeruginosa 2192]
 gi|150960285|gb|ABR82310.1| ribosomal protein S21 [Pseudomonas aeruginosa PA7]
 gi|218769543|emb|CAW25303.1| 30S ribosomal protein S21 [Pseudomonas aeruginosa LESB58]
 gi|226721632|gb|ACO80803.1| ribosomal protein S21 [Azotobacter vinelandii DJ]
 gi|310884071|gb|EFQ42665.1| 30S ribosomal protein S21 [Pseudomonas aeruginosa 39016]
          Length = 71

 Score = 43.3 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
             V V++N   + ALR  K+  +  GVL E++ R  YEKP+ +R R  + A++R  K 
Sbjct: 1  MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAERKRKAAAAVKRHAKK 59


>gi|226227300|ref|YP_002761406.1| 30S ribosomal protein S21 [Gemmatimonas aurantiaca T-27]
 gi|259494886|sp|C1A4B1|RS21_GEMAT RecName: Full=30S ribosomal protein S21
 gi|226090491|dbj|BAH38936.1| 30S ribosomal protein S21 [Gemmatimonas aurantiaca T-27]
          Length = 62

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 35/53 (66%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           D N E+AL+  KKK +  G+L +L+   HYEKPS++R R  + A+R++R+  
Sbjct: 8  EDENFERALKRFKKKCEKAGILSDLRKHRHYEKPSERRKRKMNAAVRKNRRTR 60


>gi|189424082|ref|YP_001951259.1| 30S ribosomal protein S21 [Geobacter lovleyi SZ]
 gi|226695013|sp|B3E615|RS21_GEOLS RecName: Full=30S ribosomal protein S21
 gi|189420341|gb|ACD94739.1| ribosomal protein S21 [Geobacter lovleyi SZ]
          Length = 65

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 24/62 (38%), Positives = 37/62 (59%), Gaps = 1/62 (1%)

Query: 22 VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
          V +R+N   + AL+  KK+ +  G+L E++ R HYEKPS KR +    A +R+ K  RK+
Sbjct: 4  VRIRENEPFDLALKKFKKQCEKAGILSEVRKREHYEKPSIKRKKKAIAARKRALKKQRKM 63

Query: 81 AQ 82
            
Sbjct: 64 MD 65


>gi|119474862|ref|ZP_01615215.1| ribosomal protein S21 [marine gamma proteobacterium HTCC2143]
 gi|119451065|gb|EAW32298.1| ribosomal protein S21 [marine gamma proteobacterium HTCC2143]
          Length = 71

 Score = 43.3 bits (101), Expect = 0.012,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V ++DN   + ALR  K+  +  GVL E++ R  YEKP+  R R  + A++R  K +
Sbjct: 1  MPSVKLKDNEPFDIALRRFKRSCEKAGVLAEVRRREFYEKPTSVRKRKAAAAVKRHAKKV 60

Query: 78 RKIAQRE 84
           +  ++ 
Sbjct: 61 SRETRKH 67


>gi|126666518|ref|ZP_01737496.1| 30S ribosomal protein S21 [Marinobacter sp. ELB17]
 gi|126628906|gb|EAZ99525.1| 30S ribosomal protein S21 [Marinobacter sp. ELB17]
          Length = 71

 Score = 43.3 bits (101), Expect = 0.013,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 34/59 (57%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQR 83
           +   + ALR  K+  +  GVL E++ R HYEKP+  R R  + A++R  K +++  ++
Sbjct: 8  ENEPFDVALRRFKRSCEKAGVLSEVRRREHYEKPTSVRKRKAAAAVKRHLKKLQREQRK 66


>gi|160872171|ref|ZP_02062303.1| ribosomal protein S21 [Rickettsiella grylli]
 gi|159120970|gb|EDP46308.1| ribosomal protein S21 [Rickettsiella grylli]
          Length = 75

 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 32/51 (62%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          +E A+R  K+  +  G+  E++ R +YEKP++ R R  + A++R RK + +
Sbjct: 12 LESAIRRYKRACEKSGIFAEVRRREYYEKPTEARKRRFAAAVKRCRKRLMR 62


>gi|221065837|ref|ZP_03541942.1| ribosomal protein S21 [Comamonas testosteroni KF-1]
 gi|264679597|ref|YP_003279504.1| ribosomal protein S21 [Comamonas testosteroni CNB-2]
 gi|299533311|ref|ZP_07046695.1| 30S ribosomal protein S21 [Comamonas testosteroni S44]
 gi|220710860|gb|EED66228.1| ribosomal protein S21 [Comamonas testosteroni KF-1]
 gi|262210110|gb|ACY34208.1| ribosomal protein S21 [Comamonas testosteroni CNB-2]
 gi|298718841|gb|EFI59814.1| 30S ribosomal protein S21 [Comamonas testosteroni S44]
          Length = 70

 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNNV-EQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E ALR  K+ ++  G+L +L+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKENEPYEVALRRFKRTIEKLGLLTDLRAREFYEKPTAERKRKKAAAVKRHYKRV 60

Query: 78 RKIAQREGA 86
          R +   +  
Sbjct: 61 RSMQLPKKL 69


>gi|326488671|dbj|BAJ97947.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gi|326522332|dbj|BAK07628.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 195

 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 15/58 (25%), Positives = 26/58 (44%), Gaps = 2/58 (3%)

Query: 21  YVLVRDNNVEQA--LRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
            V   D +V+    LR   +++   GV+ E++ R  +E    KR R   +A  R  + 
Sbjct: 66  KVDAGDEDVDGGDLLRQFTREVGRAGVMHEVRRRRWHEDARDKRKRKSRDAAWRLSRR 123


>gi|15594601|ref|NP_212390.1| 30S ribosomal protein S21 [Borrelia burgdorferi B31]
 gi|51598516|ref|YP_072704.1| 30S ribosomal protein S21 [Borrelia garinii PBi]
 gi|111115081|ref|YP_709699.1| 30S ribosomal protein S21 [Borrelia afzelii PKo]
 gi|195941390|ref|ZP_03086772.1| 30S ribosomal protein S21 [Borrelia burgdorferi 80a]
 gi|216263972|ref|ZP_03435966.1| ribosomal protein S21 [Borrelia afzelii ACA-1]
 gi|216264802|ref|ZP_03436794.1| ribosomal protein S21 [Borrelia burgdorferi 156a]
 gi|218249567|ref|YP_002374779.1| ribosomal protein S21 [Borrelia burgdorferi ZS7]
 gi|219684557|ref|ZP_03539500.1| ribosomal protein S21 [Borrelia garinii PBr]
 gi|219685859|ref|ZP_03540666.1| ribosomal protein S21 [Borrelia garinii Far04]
 gi|221217676|ref|ZP_03589144.1| ribosomal protein S21 [Borrelia burgdorferi 72a]
 gi|223888919|ref|ZP_03623510.1| ribosomal protein S21 [Borrelia burgdorferi 64b]
 gi|224532272|ref|ZP_03672904.1| ribosomal protein S21 [Borrelia valaisiana VS116]
 gi|224533230|ref|ZP_03673830.1| ribosomal protein S21 [Borrelia burgdorferi WI91-23]
 gi|224533746|ref|ZP_03674334.1| ribosomal protein S21 [Borrelia burgdorferi CA-11.2a]
 gi|224534354|ref|ZP_03674932.1| ribosomal protein S21 [Borrelia spielmanii A14S]
 gi|225549123|ref|ZP_03770098.1| ribosomal protein S21 [Borrelia burgdorferi 94a]
 gi|225550175|ref|ZP_03771135.1| ribosomal protein S21 [Borrelia burgdorferi 118a]
 gi|225552300|ref|ZP_03773240.1| ribosomal protein S21 [Borrelia sp. SV1]
 gi|226320556|ref|ZP_03796116.1| ribosomal protein S21 [Borrelia burgdorferi 29805]
 gi|226321574|ref|ZP_03797100.1| ribosomal protein S21 [Borrelia burgdorferi Bol26]
 gi|3914885|sp|O51271|RS21_BORBU RecName: Full=30S ribosomal protein S21
 gi|61215874|sp|Q662A9|RS21_BORGA RecName: Full=30S ribosomal protein S21
 gi|119367239|sp|Q0SNQ5|RS21_BORAP RecName: Full=30S ribosomal protein S21
 gi|226694978|sp|B7J1I4|RS21_BORBZ RecName: Full=30S ribosomal protein S21
 gi|2688155|gb|AAC66638.1| ribosomal protein S21 (rpsU) [Borrelia burgdorferi B31]
 gi|51573087|gb|AAU07112.1| ribosomal protein S21 [Borrelia garinii PBi]
 gi|110890355|gb|ABH01523.1| ribosomal protein S21 [Borrelia afzelii PKo]
 gi|215980016|gb|EEC20838.1| ribosomal protein S21 [Borrelia afzelii ACA-1]
 gi|215981275|gb|EEC22082.1| ribosomal protein S21 [Borrelia burgdorferi 156a]
 gi|218164755|gb|ACK74816.1| ribosomal protein S21 [Borrelia burgdorferi ZS7]
 gi|219671919|gb|EED28973.1| ribosomal protein S21 [Borrelia garinii PBr]
 gi|219672589|gb|EED29621.1| ribosomal protein S21 [Borrelia garinii Far04]
 gi|221192353|gb|EEE18572.1| ribosomal protein S21 [Borrelia burgdorferi 72a]
 gi|223885735|gb|EEF56834.1| ribosomal protein S21 [Borrelia burgdorferi 64b]
 gi|224511737|gb|EEF82143.1| ribosomal protein S21 [Borrelia valaisiana VS116]
 gi|224511957|gb|EEF82358.1| ribosomal protein S21 [Borrelia burgdorferi WI91-23]
 gi|224513039|gb|EEF83402.1| ribosomal protein S21 [Borrelia burgdorferi CA-11.2a]
 gi|224514456|gb|EEF84772.1| ribosomal protein S21 [Borrelia spielmanii A14S]
 gi|225369287|gb|EEG98740.1| ribosomal protein S21 [Borrelia burgdorferi 118a]
 gi|225370349|gb|EEG99787.1| ribosomal protein S21 [Borrelia burgdorferi 94a]
 gi|225371298|gb|EEH00728.1| ribosomal protein S21 [Borrelia sp. SV1]
 gi|226232763|gb|EEH31516.1| ribosomal protein S21 [Borrelia burgdorferi Bol26]
 gi|226233975|gb|EEH32696.1| ribosomal protein S21 [Borrelia burgdorferi 29805]
 gi|312147966|gb|ADQ30625.1| ribosomal protein S21 [Borrelia burgdorferi JD1]
 gi|312148989|gb|ADQ29060.1| ribosomal protein S21 [Borrelia burgdorferi N40]
          Length = 69

 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 22/59 (37%), Positives = 39/59 (66%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQR 83
          ++ N+E+AL+  K+ ++ E ++RE K R +YEKPS  RV+ +    R+  K +RK+ Q+
Sbjct: 8  KNENLEKALKRFKRMIEKEAIIREWKRREYYEKPSTIRVKKEKAFKRKQAKKVRKLKQK 66


>gi|322389213|ref|ZP_08062774.1| 30S ribosomal protein S21 [Streptococcus parasanguinis ATCC 903]
 gi|321144118|gb|EFX39535.1| 30S ribosomal protein S21 [Streptococcus parasanguinis ATCC 903]
          Length = 79

 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 35/62 (56%)

Query: 13 EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          +G +  +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A +R
Sbjct: 17 KGVKNMSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKRKSEAARKR 76

Query: 73 SR 74
           +
Sbjct: 77 KK 78


>gi|296876773|ref|ZP_06900821.1| 30S ribosomal protein S21 [Streptococcus parasanguinis ATCC
          15912]
 gi|296432275|gb|EFH18074.1| 30S ribosomal protein S21 [Streptococcus parasanguinis ATCC
          15912]
          Length = 79

 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 35/62 (56%)

Query: 13 EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          +G +  +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A +R
Sbjct: 17 KGVKNMSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKRKSEAARKR 76

Query: 73 SR 74
           +
Sbjct: 77 KK 78


>gi|262282859|ref|ZP_06060626.1| ribosomal protein S21 [Streptococcus sp. 2_1_36FAA]
 gi|262261111|gb|EEY79810.1| ribosomal protein S21 [Streptococcus sp. 2_1_36FAA]
          Length = 66

 Score = 43.0 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 35/62 (56%)

Query: 13 EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          +G +  +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A +R
Sbjct: 4  KGVKNMSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKRKSEAARKR 63

Query: 73 SR 74
           +
Sbjct: 64 KK 65


>gi|319760205|ref|YP_004124143.1| 30S ribosomal protein S21 [Candidatus Blochmannia vafer str.
          BVAF]
 gi|318038919|gb|ADV33469.1| 30S ribosomal protein S21 [Candidatus Blochmannia vafer str.
          BVAF]
          Length = 71

 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 33/60 (55%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   + ALR  K+  +  G+L E++ R  YEKP+ +R R K+ AI+R  K + +   + 
Sbjct: 8  ENEPFDVALRRFKRSCEKAGILSEVRRREFYEKPTTERKRAKASAIKRHIKKITRENSKR 67


>gi|226327182|ref|ZP_03802700.1| hypothetical protein PROPEN_01047 [Proteus penneri ATCC 35198]
 gi|225204400|gb|EEG86754.1| hypothetical protein PROPEN_01047 [Proteus penneri ATCC 35198]
          Length = 76

 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 2/75 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS-RKL 76
             + VR+N   + ALR  K+  +  GVL E++ R  YEKP+ +R R K+ A++R  +K 
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKR 60

Query: 77 MRKIAQREGAPVSRL 91
            K   RE A  +RL
Sbjct: 61 HAKKLARENARRTRL 75


>gi|56752327|ref|YP_173028.1| 30S ribosomal protein S21 [Synechococcus elongatus PCC 6301]
 gi|81300583|ref|YP_400791.1| 30S ribosomal protein S21 [Synechococcus elongatus PCC 7942]
 gi|61215785|sp|Q5MZL2|RS21_SYNP6 RecName: Full=30S ribosomal protein S21
 gi|119367332|sp|Q31MB5|RS21_SYNE7 RecName: Full=30S ribosomal protein S21
 gi|56687286|dbj|BAD80508.1| 30S ribosomal protein S21 [Synechococcus elongatus PCC 6301]
 gi|81169464|gb|ABB57804.1| SSU ribosomal protein S21P [Synechococcus elongatus PCC 7942]
          Length = 57

 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 24/50 (48%), Positives = 32/50 (64%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           +  +E ALR  KKK+Q  G+L E++ R HYEKPSQ+R R    + RR R
Sbjct: 8  ENETIESALRRFKKKIQKAGILPEVRRREHYEKPSQRRKRKLEASRRRRR 57


>gi|186472771|ref|YP_001860113.1| ribosomal protein S21 [Burkholderia phymatum STM815]
 gi|184195103|gb|ACC73067.1| ribosomal protein S21 [Burkholderia phymatum STM815]
          Length = 70

 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKENEPFEVAMRRFKRTIEKNGLLTELRAREFYEKPTSERKRKKAAAVKRHFKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|28199521|ref|NP_779835.1| 30S ribosomal protein S21 [Xylella fastidiosa Temecula1]
 gi|182682254|ref|YP_001830414.1| 30S ribosomal protein S21 [Xylella fastidiosa M23]
 gi|32130000|sp|Q87B16|RS21_XYLFT RecName: Full=30S ribosomal protein S21
 gi|226732165|sp|B2I7X5|RS21_XYLF2 RecName: Full=30S ribosomal protein S21
 gi|28057636|gb|AAO29484.1| 30S ribosomal protein S21 [Xylella fastidiosa Temecula1]
 gi|182632364|gb|ACB93140.1| ribosomal protein S21 [Xylella fastidiosa M23]
 gi|307578528|gb|ADN62497.1| 30S ribosomal protein S21 [Xylella fastidiosa subsp. fastidiosa
          GB514]
          Length = 71

 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   E ALR  K+  +  G+L E + R  YEKP+Q+R R  + A++R+ +  
Sbjct: 1  MPSVKVRENEPFEFALRRFKRICEKAGILAETRKREFYEKPTQERKRKAAAAVKRNIRRT 60

Query: 78 RKIAQREGAPV 88
           +   +     
Sbjct: 61 SRDVTKRKRLY 71


>gi|90407546|ref|ZP_01215728.1| putative ribosomal protein S21 [Psychromonas sp. CNPT3]
 gi|90311356|gb|EAS39459.1| putative ribosomal protein S21 [Psychromonas sp. CNPT3]
          Length = 71

 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 32/60 (53%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   + ALR  K+  +  G+L E + R ++EKP+  R R K+ A++R  K + +   R 
Sbjct: 8  ENEPFDVALRRFKRSCEKAGILAETRKREYFEKPTTVRKRAKAAAVKRHLKKLSRENARR 67


>gi|88770672|gb|ABD51939.1| chloroplast 30S ribosomal protein 21 [Guillardia theta]
          Length = 108

 Score = 43.0 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 1/62 (1%)

Query: 20  VYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + V V++   +E A+R  K  +   G L ELK R  +E  ++K++R   EA R+  ++ R
Sbjct: 45  IKVQVKEGEPIEGAMRRFKIAVSKSGHLMELKRRRRFESNNEKKIRKDKEAKRKRSQMRR 104

Query: 79  KI 80
           + 
Sbjct: 105 QR 106


>gi|115358005|ref|YP_775143.1| 30S ribosomal protein S21 [Burkholderia ambifaria AMMD]
 gi|170699444|ref|ZP_02890488.1| ribosomal protein S21 [Burkholderia ambifaria IOP40-10]
 gi|171320197|ref|ZP_02909257.1| ribosomal protein S21 [Burkholderia ambifaria MEX-5]
 gi|172062812|ref|YP_001810463.1| ribosomal protein S21 [Burkholderia ambifaria MC40-6]
 gi|115283293|gb|ABI88809.1| SSU ribosomal protein S21P [Burkholderia ambifaria AMMD]
 gi|170135644|gb|EDT03928.1| ribosomal protein S21 [Burkholderia ambifaria IOP40-10]
 gi|171094549|gb|EDT39603.1| ribosomal protein S21 [Burkholderia ambifaria MEX-5]
 gi|171995329|gb|ACB66247.1| ribosomal protein S21 [Burkholderia ambifaria MC40-6]
          Length = 70

 Score = 43.0 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  +EKP+ +R R K+ A++R  K +
Sbjct: 1  MTIIRVKENEPFEVAMRRFKRTIEKNGLLTELRAREFFEKPTAERKRKKAAAVKRHYKRI 60

Query: 78 RKIAQREGA 86
          R     +  
Sbjct: 61 RSQTLPKKL 69


>gi|300310200|ref|YP_003774292.1| 30S ribosomal protein S21 [Herbaspirillum seropedicae SmR1]
 gi|300072985|gb|ADJ62384.1| 30S ribosomal subunit S21 protein [Herbaspirillum seropedicae
          SmR1]
          Length = 70

 Score = 43.0 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MTTIRVKENEPFEVAMRRFKRTIEKTGLLTELRAREFYEKPTAERKRKLAAAVKRHYKRI 60

Query: 78 RKIAQREGA 86
          R     +  
Sbjct: 61 RSQQLPKKL 69


>gi|322385454|ref|ZP_08059098.1| 30S ribosomal protein S21 [Streptococcus cristatus ATCC 51100]
 gi|323352415|ref|ZP_08087550.1| 30S ribosomal protein S21 [Streptococcus sanguinis VMC66]
 gi|321270192|gb|EFX53108.1| 30S ribosomal protein S21 [Streptococcus cristatus ATCC 51100]
 gi|322121847|gb|EFX93588.1| 30S ribosomal protein S21 [Streptococcus sanguinis VMC66]
 gi|324990505|gb|EGC22441.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK353]
 gi|324993243|gb|EGC25163.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK405]
 gi|324995455|gb|EGC27367.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK678]
 gi|325688383|gb|EGD30402.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK72]
 gi|325690019|gb|EGD32023.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK115]
 gi|325696734|gb|EGD38622.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK160]
 gi|327458600|gb|EGF04948.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK1057]
 gi|327461512|gb|EGF07843.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK1]
 gi|327468860|gb|EGF14332.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK330]
 gi|327473236|gb|EGF18656.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK408]
 gi|327489368|gb|EGF21161.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK1058]
 gi|328945885|gb|EGG40035.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK1087]
 gi|332361597|gb|EGJ39401.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK1056]
 gi|332362693|gb|EGJ40491.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK49]
 gi|332363113|gb|EGJ40900.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK355]
 gi|332365904|gb|EGJ43660.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK1059]
          Length = 66

 Score = 43.0 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 35/62 (56%)

Query: 13 EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          +G +  +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A +R
Sbjct: 4  KGVKKMSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKRKSEAARKR 63

Query: 73 SR 74
           +
Sbjct: 64 KK 65


>gi|270292457|ref|ZP_06198668.1| conserved domain protein [Streptococcus sp. M143]
 gi|315613442|ref|ZP_07888350.1| 30S ribosomal protein S21 [Streptococcus sanguinis ATCC 49296]
 gi|270278436|gb|EFA24282.1| conserved domain protein [Streptococcus sp. M143]
 gi|315314438|gb|EFU62482.1| 30S ribosomal protein S21 [Streptococcus sanguinis ATCC 49296]
          Length = 66

 Score = 43.0 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 35/62 (56%)

Query: 13 EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          +G +  +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A +R
Sbjct: 4  KGVKKMSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKRKSEAARKR 63

Query: 73 SR 74
           +
Sbjct: 64 KK 65


>gi|89901656|ref|YP_524127.1| 30S ribosomal protein S21 [Rhodoferax ferrireducens T118]
 gi|119367298|sp|Q21UF7|RS21_RHOFD RecName: Full=30S ribosomal protein S21
 gi|89346393|gb|ABD70596.1| SSU ribosomal protein S21P [Rhodoferax ferrireducens T118]
          Length = 70

 Score = 43.0 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 21/68 (30%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   + ALR  K+ ++  G+L +L+ R  YEKP+ +R R K+ A++R+ K +
Sbjct: 1  MTTIRVKENEPFDVALRRFKRTIEKLGLLTDLRAREFYEKPTAERKRKKAAAVKRNYKRI 60

Query: 78 RKIAQREG 85
          R +   + 
Sbjct: 61 RAMQLPKK 68


>gi|319785812|ref|YP_004145287.1| ribosomal protein S21 [Pseudoxanthomonas suwonensis 11-1]
 gi|317464324|gb|ADV26056.1| ribosomal protein S21 [Pseudoxanthomonas suwonensis 11-1]
          Length = 71

 Score = 43.0 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   E ALR  K+  +  GVL E + R +YEKP+Q+R R  + A++R  + M
Sbjct: 1  MPSVKVRENEPFEFALRRFKRTCEKAGVLAETRKREYYEKPTQERKRKAAAAVKRQLRRM 60

Query: 78 RKIAQRE 84
           +   + 
Sbjct: 61 SRDVTKR 67


>gi|306827616|ref|ZP_07460896.1| 30S ribosomal protein S21 [Streptococcus pyogenes ATCC 10782]
 gi|304430179|gb|EFM33208.1| 30S ribosomal protein S21 [Streptococcus pyogenes ATCC 10782]
          Length = 72

 Score = 43.0 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 36/69 (52%)

Query: 11 FSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
          + E  +  +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A 
Sbjct: 4  YLEEVKHMSKTVVRKNESLDDALRRFKRSVTKAGTLQESRKREFYEKPSVKRKRKSEAAR 63

Query: 71 RRSRKLMRK 79
          +R     +K
Sbjct: 64 KRKNSNGKK 72


>gi|15837036|ref|NP_297724.1| 30S ribosomal protein S21 [Xylella fastidiosa 9a5c]
 gi|71274627|ref|ZP_00650915.1| Ribosomal protein S21 [Xylella fastidiosa Dixon]
 gi|71899297|ref|ZP_00681458.1| Ribosomal protein S21 [Xylella fastidiosa Ann-1]
 gi|170730892|ref|YP_001776325.1| 30S ribosomal protein S21 [Xylella fastidiosa M12]
 gi|13959521|sp|Q9PG68|RS21_XYLFA RecName: Full=30S ribosomal protein S21
 gi|226732166|sp|B0U4B6|RS21_XYLFM RecName: Full=30S ribosomal protein S21
 gi|9105276|gb|AAF83244.1|AE003894_9 30S ribosomal protein S21 [Xylella fastidiosa 9a5c]
 gi|71164359|gb|EAO14073.1| Ribosomal protein S21 [Xylella fastidiosa Dixon]
 gi|71730923|gb|EAO32993.1| Ribosomal protein S21 [Xylella fastidiosa Ann-1]
 gi|167965685|gb|ACA12695.1| 30S ribosomal protein S21 [Xylella fastidiosa M12]
          Length = 71

 Score = 43.0 bits (100), Expect = 0.015,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 35/71 (49%), Gaps = 1/71 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   E ALR  K+  +  G+L E + R  YEKP+Q+R R  + A++R  +  
Sbjct: 1  MPSVKVRENEPFEFALRRFKRICEKAGILAETRKREFYEKPTQERKRKAAAAVKRQMRRT 60

Query: 78 RKIAQREGAPV 88
           +   +     
Sbjct: 61 SRDVTKRKRLY 71


>gi|160897804|ref|YP_001563386.1| 30S ribosomal protein S21 [Delftia acidovorans SPH-1]
 gi|226694995|sp|A9BTN3|RS21_DELAS RecName: Full=30S ribosomal protein S21
 gi|160363388|gb|ABX35001.1| ribosomal protein S21 [Delftia acidovorans SPH-1]
          Length = 70

 Score = 43.0 bits (100), Expect = 0.016,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 39/69 (56%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNNV-EQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E ALR  K+ ++  G+L +L+ R  YEKP+ +R R K+ A++R  K +
Sbjct: 1  MTTIRVKENEPYEVALRRFKRTIEKLGLLTDLRAREFYEKPTSERKRKKAAAVKRHYKRV 60

Query: 78 RKIAQREGA 86
          R +   +  
Sbjct: 61 RSMQLPKKL 69


>gi|119944098|ref|YP_941778.1| ribosomal protein S21 [Psychromonas ingrahamii 37]
 gi|166224060|sp|A1SRR4|RS21_PSYIN RecName: Full=30S ribosomal protein S21
 gi|119862702|gb|ABM02179.1| SSU ribosomal protein S21P [Psychromonas ingrahamii 37]
          Length = 71

 Score = 43.0 bits (100), Expect = 0.016,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 31/60 (51%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   + ALR  K+  +  G+L E + R  +EKP+  R R K+ A++R  K + +   R 
Sbjct: 8  ENEPFDVALRRFKRSCEKAGILAETRKREFFEKPTTVRKRAKAAAVKRHLKKLSRENARR 67


>gi|39998183|ref|NP_954134.1| 30S ribosomal protein S21 [Geobacter sulfurreducens PCA]
 gi|81701127|sp|Q748B4|RS212_GEOSL RecName: Full=30S ribosomal protein S21 2
 gi|39985129|gb|AAR36484.1| ribosomal protein S21 [Geobacter sulfurreducens PCA]
 gi|298507121|gb|ADI85844.1| ribosomal protein S21 [Geobacter sulfurreducens KN400]
          Length = 65

 Score = 43.0 bits (100), Expect = 0.016,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 32/54 (59%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQ 82
           E AL+  KK+ +  G+L E++ R HYEKPS KR +    A +R+ K  RK+  
Sbjct: 12 FELALKKFKKQCEKAGILSEVRKREHYEKPSIKRKKKAIAARKRAMKKQRKMMD 65


>gi|116514981|ref|YP_802610.1| 30S ribosomal protein S21 [Buchnera aphidicola str. Cc (Cinara
          cedri)]
 gi|122285623|sp|Q058D2|RS21_BUCCC RecName: Full=30S ribosomal protein S21
 gi|116256835|gb|ABJ90517.1| 30S ribosomal protein S21 [Buchnera aphidicola str. Cc (Cinara
          cedri)]
          Length = 71

 Score = 42.6 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + +RDN   + ALR  K+  +  G+L E++ R  YEKP+ +R R K+ AI+R  K +
Sbjct: 1  MPIIKIRDNEPFDVALRRFKRSCEKAGILSEIRRREFYEKPTTERKRAKASAIKRLSKKL 60

Query: 78 RKIAQRE 84
           +   + 
Sbjct: 61 ARENLKR 67


>gi|17540080|ref|NP_500608.1| hypothetical protein F29B9.10 [Caenorhabditis elegans]
 gi|9802915|gb|AAF99924.1| Hypothetical protein F29B9.10 [Caenorhabditis elegans]
          Length = 78

 Score = 42.6 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 29/47 (61%)

Query: 23 LVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
          +V++N+V+ A  +L + M  EG+L+ ++    Y+KP  +R  L  EA
Sbjct: 1  MVQNNDVDGAFGLLNRLMDSEGMLKIIRRTQFYQKPYMQRKTLSMEA 47


>gi|223041544|ref|ZP_03611745.1| 30S ribosomal protein S21 [Actinobacillus minor 202]
 gi|240948935|ref|ZP_04753291.1| 30S ribosomal protein S21 [Actinobacillus minor NM305]
 gi|223017639|gb|EEF16049.1| 30S ribosomal protein S21 [Actinobacillus minor 202]
 gi|240296750|gb|EER47361.1| 30S ribosomal protein S21 [Actinobacillus minor NM305]
          Length = 71

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R K+   +R  K  
Sbjct: 1  MPVIKVRENESFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIRKREKASLAKRHAKRN 60

Query: 78 RKIAQR 83
           +   R
Sbjct: 61 ARENAR 66


>gi|87301350|ref|ZP_01084191.1| 30S Ribosomal protein S21 [Synechococcus sp. WH 5701]
 gi|254431394|ref|ZP_05045097.1| ribosomal protein S21 [Cyanobium sp. PCC 7001]
 gi|87284318|gb|EAQ76271.1| 30S Ribosomal protein S21 [Synechococcus sp. WH 5701]
 gi|197625847|gb|EDY38406.1| ribosomal protein S21 [Cyanobium sp. PCC 7001]
          Length = 56

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQK 61
             V V +N  +E ALR  K+++   G+  +LK   H+E P++K
Sbjct: 1  MTQVTVGENEGIESALRRFKRQVSKAGIFADLKRLRHHETPTEK 44


>gi|239906702|ref|YP_002953443.1| 30S ribosomal protein S21 [Desulfovibrio magneticus RS-1]
 gi|259494881|sp|C4XS35|RS21_DESMR RecName: Full=30S ribosomal protein S21
 gi|239796568|dbj|BAH75557.1| 30S ribosomal protein S21 [Desulfovibrio magneticus RS-1]
          Length = 66

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 26/54 (48%), Positives = 36/54 (66%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
          +N + ALR  KK+++  G+L ELK R H+EKPS  R + K+ A +R  K MRKI
Sbjct: 10 DNFDVALRRFKKQVEKSGILSELKKRQHFEKPSVMRKKKKAAARKRLLKKMRKI 63


>gi|90020366|ref|YP_526193.1| 30S ribosomal protein S21 [Saccharophagus degradans 2-40]
 gi|119367305|sp|Q21MU8|RS21_SACD2 RecName: Full=30S ribosomal protein S21
 gi|89949966|gb|ABD79981.1| SSU ribosomal protein S21P [Saccharophagus degradans 2-40]
          Length = 71

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 33/59 (55%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQR 83
           +   + ALR  K+  +  GVL E++ R  YEKP+  R R  + A++R  K +++  ++
Sbjct: 8  ENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTSVRKRKAAAAVKRHAKKVQRENRK 66


>gi|297180106|gb|ADI16329.1| hypothetical protein [uncultured bacterium HF130_01F24]
          Length = 71

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 19/66 (28%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +++N   + A+R  K+  +  GVL E++ R  YEKP+  R R  + A++R  K +
Sbjct: 1  MPQVKLKENEPFDIAIRRFKRACEKAGVLAEVRRREFYEKPTSVRKRKAAAAVKRHLKKL 60

Query: 78 RKIAQR 83
          ++  ++
Sbjct: 61 QRENRK 66


>gi|302343352|ref|YP_003807881.1| ribosomal protein S21 [Desulfarculus baarsii DSM 2075]
 gi|301639965|gb|ADK85287.1| ribosomal protein S21 [Desulfarculus baarsii DSM 2075]
          Length = 71

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 21/42 (50%), Positives = 30/42 (71%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQK 61
          + V V DNNVE+A++ LK+K+  EGV R+LK +  +EKPS  
Sbjct: 1  MQVQVMDNNVEKAIKALKRKLTKEGVFRQLKEKRWHEKPSDM 42


>gi|265767525|ref|ZP_06095191.1| ribosomal protein S21 [Bacteroides sp. 2_1_16]
 gi|263252830|gb|EEZ24342.1| ribosomal protein S21 [Bacteroides sp. 2_1_16]
          Length = 82

 Score = 42.6 bits (99), Expect = 0.018,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 15 REISAVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
               + V V++  N+E+AL+  K+K +  G+++EL+ R  ++KPS  +   K  A+
Sbjct: 16 NNNKMIVVPVKEGENIEKALKKFKRKFEKTGIVKELRSRQQFDKPSVTKRLKKERAV 72


>gi|307106693|gb|EFN54938.1| hypothetical protein CHLNCDRAFT_134681 [Chlorella variabilis]
          Length = 78

 Score = 42.6 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 35/64 (54%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V V + NV++A R L++K++ E  +   + R +Y KPS++R    S + +R R    K
Sbjct: 5  ISVEVPNGNVDKAWRTLQRKLREEHYMEAAQAREYYVKPSERRKLQASASAKRFRDQEFK 64

Query: 80 IAQR 83
             +
Sbjct: 65 EMLQ 68


>gi|312867704|ref|ZP_07727910.1| ribosomal protein S21 [Streptococcus parasanguinis F0405]
 gi|311096767|gb|EFQ55005.1| ribosomal protein S21 [Streptococcus parasanguinis F0405]
          Length = 71

 Score = 42.6 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 34/60 (56%)

Query: 13 EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          +G +  +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A +R
Sbjct: 8  KGVKNMSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKRKSEAARKR 67


>gi|261492897|ref|ZP_05989443.1| 30S ribosomal protein S21 [Mannheimia haemolytica serotype A2
          str. BOVINE]
 gi|261496753|ref|ZP_05993128.1| 30S ribosomal protein S21 [Mannheimia haemolytica serotype A2
          str. OVINE]
 gi|261307592|gb|EEY08920.1| 30S ribosomal protein S21 [Mannheimia haemolytica serotype A2
          str. OVINE]
 gi|261311438|gb|EEY12595.1| 30S ribosomal protein S21 [Mannheimia haemolytica serotype A2
          str. BOVINE]
          Length = 71

 Score = 42.6 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R K+   +R  K  
Sbjct: 1  MPVIKVRENESFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIRKREKASLAKRHAKRN 60

Query: 78 RKIAQR 83
           +   R
Sbjct: 61 FRENAR 66


>gi|71898166|ref|ZP_00680352.1| Ribosomal protein S21 [Xylella fastidiosa Ann-1]
 gi|71732140|gb|EAO34196.1| Ribosomal protein S21 [Xylella fastidiosa Ann-1]
          Length = 71

 Score = 42.6 bits (99), Expect = 0.019,   Method: Composition-based stats.
 Identities = 22/71 (30%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   E ALR  K+  +  G+L E + R  YEKP+Q+R R  + A++R+ +  
Sbjct: 1  MPSVKVRENEPFEFALRRFKRICEKAGILAETRKREFYEKPTQERKRKAAAAVKRNMRRT 60

Query: 78 RKIAQREGAPV 88
           +   +     
Sbjct: 61 SQDVTKRKRLY 71


>gi|322516344|ref|ZP_08069270.1| 30S ribosomal protein S21 [Streptococcus vestibularis ATCC 49124]
 gi|322125182|gb|EFX96571.1| 30S ribosomal protein S21 [Streptococcus vestibularis ATCC 49124]
          Length = 68

 Score = 42.6 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 21/64 (32%), Positives = 35/64 (54%)

Query: 11 FSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
          + E     +  V+ ++ +++ ALR  K+ +   G L+E + R HYEKPS KR R    A 
Sbjct: 4  YLEEVNSMSKTVVRKNESLDDALRRFKRSVTKAGTLQEARKREHYEKPSVKRKRKSEAAR 63

Query: 71 RRSR 74
          +R +
Sbjct: 64 KRKK 67


>gi|325576585|ref|ZP_08147303.1| 30S ribosomal protein S21 [Haemophilus parainfluenzae ATCC 33392]
 gi|301155440|emb|CBW14906.1| 30S ribosomal subunit protein S21 [Haemophilus parainfluenzae
          T3T1]
 gi|325161148|gb|EGC73263.1| 30S ribosomal protein S21 [Haemophilus parainfluenzae ATCC 33392]
          Length = 71

 Score = 42.6 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R K+   +R  K  
Sbjct: 1  MPVIKVRENESFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIRKREKATLAKRHAKRN 60

Query: 78 RKIAQR 83
           +   R
Sbjct: 61 ARENAR 66


>gi|319745367|gb|EFV97678.1| 30S ribosomal protein S21 [Streptococcus agalactiae ATCC 13813]
          Length = 72

 Score = 42.6 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 35/64 (54%)

Query: 11 FSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
          + E  +  +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A 
Sbjct: 8  YLEEVKHMSKTVVRKNESLDDALRRFKRSVTKAGTLQESRKREFYEKPSVKRKRKSEAAR 67

Query: 71 RRSR 74
          +R +
Sbjct: 68 KRKK 71


>gi|195977960|ref|YP_002123204.1| 30S ribosomal protein S21 [Streptococcus equi subsp.
          zooepidemicus MGCS10565]
 gi|306831673|ref|ZP_07464830.1| 30S ribosomal protein S21 [Streptococcus gallolyticus subsp.
          gallolyticus TX20005]
 gi|306833814|ref|ZP_07466939.1| 30S ribosomal protein S21 [Streptococcus bovis ATCC 700338]
 gi|325978612|ref|YP_004288328.1| 30S ribosomal protein S21 [Streptococcus gallolyticus subsp.
          gallolyticus ATCC BAA-2069]
 gi|71853192|gb|AAZ51215.1| SSU ribosomal protein S21P [Streptococcus pyogenes MGAS5005]
 gi|195974665|gb|ACG62191.1| 30S ribosomal protein S21 RpsU [Streptococcus equi subsp.
          zooepidemicus MGCS10565]
 gi|304424008|gb|EFM27149.1| 30S ribosomal protein S21 [Streptococcus bovis ATCC 700338]
 gi|304426098|gb|EFM29213.1| 30S ribosomal protein S21 [Streptococcus gallolyticus subsp.
          gallolyticus TX20005]
 gi|325178540|emb|CBZ48584.1| 30S ribosomal protein S21 [Streptococcus gallolyticus subsp.
          gallolyticus ATCC BAA-2069]
          Length = 68

 Score = 42.6 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 35/64 (54%)

Query: 11 FSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
          + E  +  +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A 
Sbjct: 4  YLEEVKHMSKTVVRKNESLDDALRRFKRSVTKAGTLQESRKREFYEKPSVKRKRKSEAAR 63

Query: 71 RRSR 74
          +R +
Sbjct: 64 KRKK 67


>gi|225868708|ref|YP_002744656.1| 30S ribosomal protein S21 [Streptococcus equi subsp.
          zooepidemicus]
 gi|225870336|ref|YP_002746283.1| 30S ribosomal protein S21 [Streptococcus equi subsp. equi 4047]
 gi|50903034|gb|AAT86749.1| SSU ribosomal protein S21P [Streptococcus pyogenes MGAS10394]
 gi|71802337|gb|AAX71690.1| SSU ribosomal protein S21P [Streptococcus pyogenes MGAS6180]
 gi|94541790|gb|ABF31839.1| SSU ribosomal protein S21P [Streptococcus pyogenes MGAS9429]
 gi|94543669|gb|ABF33717.1| SSU ribosomal protein S21P [Streptococcus pyogenes MGAS10270]
 gi|94545666|gb|ABF35713.1| SSU ribosomal protein S21P [Streptococcus pyogenes MGAS2096]
 gi|94547586|gb|ABF37632.1| SSU ribosomal protein S21P [Streptococcus pyogenes MGAS10750]
 gi|225699740|emb|CAW93500.1| 30S ribosomal protein S21 [Streptococcus equi subsp. equi 4047]
 gi|225701984|emb|CAW99546.1| 30S ribosomal protein S21 [Streptococcus equi subsp.
          zooepidemicus]
          Length = 70

 Score = 42.6 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 35/64 (54%)

Query: 11 FSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
          + E  +  +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A 
Sbjct: 6  YLEEVKHMSKTVVRKNESLDDALRRFKRSVTKAGTLQESRKREFYEKPSVKRKRKSEAAR 65

Query: 71 RRSR 74
          +R +
Sbjct: 66 KRKK 69


>gi|268552355|ref|XP_002634160.1| Hypothetical protein CBG01725 [Caenorhabditis briggsae]
 gi|187037990|emb|CAP22907.1| hypothetical protein CBG_01725 [Caenorhabditis briggsae AF16]
          Length = 78

 Score = 42.6 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 29/47 (61%)

Query: 23 LVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
          +V++N+V+ A  +L + M  EG+L+ ++    Y+KP  +R  L  EA
Sbjct: 1  MVQNNDVDGAFGLLNRLMDSEGMLKIIRRTQFYQKPYMQRKALSMEA 47


>gi|295698768|ref|YP_003603423.1| ribosomal protein S21 [Candidatus Riesia pediculicola USDA]
 gi|295698781|ref|YP_003603436.1| ribosomal protein S21 [Candidatus Riesia pediculicola USDA]
 gi|291156978|gb|ADD79423.1| ribosomal protein S21 [Candidatus Riesia pediculicola USDA]
 gi|291157450|gb|ADD79895.1| ribosomal protein S21 [Candidatus Riesia pediculicola USDA]
          Length = 81

 Score = 42.6 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   + A R  K+  +  GVL E++ R  YEKP+  R R K+ +I+R  K +
Sbjct: 1  MPIIKVKENEPFDLAFRRFKRSCEKAGVLAEVRRREFYEKPTTVRKREKASSIKRHAKKI 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENSRR 67


>gi|116792593|gb|ABK26425.1| unknown [Picea sitchensis]
          Length = 143

 Score = 42.6 bits (99), Expect = 0.020,   Method: Composition-based stats.
 Identities = 12/69 (17%), Positives = 32/69 (46%), Gaps = 1/69 (1%)

Query: 5   NAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVR 64
           ++ + IFS G   + ++V   ++  +  +R  ++++    V  E + R  +E     + R
Sbjct: 42  SSVKPIFSRGGYNAQIFVGENESE-DSVVRRFRREVFKANVFEECRRRRFFESKQDIKKR 100

Query: 65  LKSEAIRRS 73
                ++R+
Sbjct: 101 KSRSPVKRN 109


>gi|171779917|ref|ZP_02920821.1| hypothetical protein STRINF_01704 [Streptococcus infantarius
          subsp. infantarius ATCC BAA-102]
 gi|320547040|ref|ZP_08041339.1| 30S ribosomal protein S21 [Streptococcus equinus ATCC 9812]
 gi|171281265|gb|EDT46700.1| hypothetical protein STRINF_01704 [Streptococcus infantarius
          subsp. infantarius ATCC BAA-102]
 gi|320448325|gb|EFW89069.1| 30S ribosomal protein S21 [Streptococcus equinus ATCC 9812]
          Length = 68

 Score = 42.6 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 33/59 (55%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          +  +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A +R +
Sbjct: 9  KHMSKTVVRKNESLDDALRRFKRSVTKAGTLQESRKREFYEKPSVKRKRKSEAARKRKK 67


>gi|90416501|ref|ZP_01224432.1| ribosomal protein S21 [marine gamma proteobacterium HTCC2207]
 gi|90331700|gb|EAS46928.1| ribosomal protein S21 [marine gamma proteobacterium HTCC2207]
          Length = 71

 Score = 42.6 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 17/66 (25%), Positives = 39/66 (59%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +++N   + ALR  K+  +  G+L +++    YEKP+ +R R  + A++R++K +
Sbjct: 1  MPSVRLKENEPFDVALRRFKRSCEKAGILAKVRSCEFYEKPTWERKRKAAAAVKRNQKKV 60

Query: 78 RKIAQR 83
           + +++
Sbjct: 61 SRESRK 66


>gi|331006391|ref|ZP_08329700.1| SSU ribosomal protein S21p [gamma proteobacterium IMCC1989]
 gi|330419815|gb|EGG94172.1| SSU ribosomal protein S21p [gamma proteobacterium IMCC1989]
          Length = 71

 Score = 42.6 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 35/59 (59%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQR 83
           +   + ALR  K+  +  GVL E++ R HYEKP+  R R  + A++R  K +++ +++
Sbjct: 8  ENEPFDIALRRFKRSCEKAGVLAEVRRREHYEKPTTVRKRQAAAAVKRHAKKVQRESKK 66


>gi|121534807|ref|ZP_01666627.1| ribosomal protein S21 [Thermosinus carboxydivorans Nor1]
 gi|121306602|gb|EAX47524.1| ribosomal protein S21 [Thermosinus carboxydivorans Nor1]
          Length = 59

 Score = 42.6 bits (99), Expect = 0.021,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 30/51 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          ++  ++ ALR  K+  Q  GVL E++ R HYEKPS KR +    A +R  K
Sbjct: 8  KNETLDSALRRFKRSCQKAGVLSEVRKREHYEKPSVKRKKKSEAARKRKHK 58


>gi|118602240|ref|YP_903455.1| 30S ribosomal protein S21 [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
 gi|166224066|sp|A1AVM7|RS21_RUTMC RecName: Full=30S ribosomal protein S21
 gi|118567179|gb|ABL01984.1| SSU ribosomal protein S21P [Candidatus Ruthia magnifica str. Cm
          (Calyptogena magnifica)]
          Length = 71

 Score = 42.2 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  ++     GV+ +++ +  YEKP+    R+K+ A++R+ K M
Sbjct: 1  MPSIKVRENEPFDIALRRFRRTCDRAGVITDVRKKEFYEKPTWVNKRMKAAAVKRTHKEM 60

Query: 78 RK 79
           K
Sbjct: 61 AK 62


>gi|254787100|ref|YP_003074529.1| 30S ribosomal protein S21 [Teredinibacter turnerae T7901]
 gi|259494894|sp|C5BPR2|RS21_TERTT RecName: Full=30S ribosomal protein S21
 gi|237683926|gb|ACR11190.1| ribosomal protein S21 [Teredinibacter turnerae T7901]
          Length = 71

 Score = 42.2 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 33/59 (55%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQR 83
           +   + ALR  K+  +  GVL E++ R  YEKP+  R R  + A++R  K +++  ++
Sbjct: 8  ENEPFDFALRRFKRSCEKAGVLAEVRRREFYEKPTSVRKRKAAAAVKRHAKKVQRENRK 66


>gi|183220951|ref|YP_001838947.1| 30S ribosomal protein S21 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
 gi|189911046|ref|YP_001962601.1| 30S ribosomal protein S21 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Ames)']
 gi|167775722|gb|ABZ94023.1| 30S Ribosomal protein S21 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Ames)']
 gi|167779373|gb|ABZ97671.1| 30S ribosomal protein S21 [Leptospira biflexa serovar Patoc
          strain 'Patoc 1 (Paris)']
          Length = 72

 Score = 42.2 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 15/53 (28%), Positives = 28/53 (52%), Gaps = 1/53 (1%)

Query: 18 SAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
            V + +++   +E ALR  K+     G++ E+K R ++EKPS  + +    A
Sbjct: 3  PQVGIYLKEGESIEAALRRFKRDCANAGIMSEIKRREYFEKPSVIKKKAVEAA 55


>gi|323697930|ref|ZP_08109842.1| ribosomal protein S21 [Desulfovibrio sp. ND132]
 gi|323457862|gb|EGB13727.1| ribosomal protein S21 [Desulfovibrio desulfuricans ND132]
          Length = 66

 Score = 42.2 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 25/57 (43%), Positives = 38/57 (66%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
           ++N + +LR  KK+++  G+L ELK R HYEKPS ++ + K+ A +R  K MRKI 
Sbjct: 8  ENDNFDVSLRRFKKQVEKAGILSELKKRQHYEKPSVQKKKKKAAAKKRLAKKMRKIR 64


>gi|116491014|ref|YP_810558.1| SSU ribosomal protein S21P [Oenococcus oeni PSU-1]
 gi|118586858|ref|ZP_01544292.1| 30S ribosomal protein S21 [Oenococcus oeni ATCC BAA-1163]
 gi|290890495|ref|ZP_06553570.1| hypothetical protein AWRIB429_0960 [Oenococcus oeni AWRIB429]
 gi|122276804|sp|Q04F79|RS21_OENOB RecName: Full=30S ribosomal protein S21
 gi|116091739|gb|ABJ56893.1| SSU ribosomal protein S21P [Oenococcus oeni PSU-1]
 gi|118432690|gb|EAV39422.1| 30S ribosomal protein S21 [Oenococcus oeni ATCC BAA-1163]
 gi|290479891|gb|EFD88540.1| hypothetical protein AWRIB429_0960 [Oenococcus oeni AWRIB429]
          Length = 64

 Score = 42.2 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 32/61 (52%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           A  ++  + + + ALR  K+ +  +G L+E++ R  Y KPS  R      A +R+RK  
Sbjct: 1  MASIIVRHNESFDDALRRFKRGVAKDGTLQEVRKREFYVKPSVARKLKSEAAQKRARKRA 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|229824782|ref|ZP_04450851.1| hypothetical protein GCWU000182_00131 [Abiotrophia defectiva ATCC
          49176]
 gi|229791111|gb|EEP27225.1| hypothetical protein GCWU000182_00131 [Abiotrophia defectiva ATCC
          49176]
          Length = 80

 Score = 42.2 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 18 SAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
              V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R  K
Sbjct: 22 RMSNVIVKENETLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKRKFK 80


>gi|228477194|ref|ZP_04061832.1| ribosomal protein S21 [Streptococcus salivarius SK126]
 gi|312863679|ref|ZP_07723917.1| ribosomal protein S21 [Streptococcus vestibularis F0396]
 gi|322373399|ref|ZP_08047935.1| ribosomal protein S21 [Streptococcus sp. C150]
 gi|228251213|gb|EEK10384.1| ribosomal protein S21 [Streptococcus salivarius SK126]
 gi|311101215|gb|EFQ59420.1| ribosomal protein S21 [Streptococcus vestibularis F0396]
 gi|321278441|gb|EFX55510.1| ribosomal protein S21 [Streptococcus sp. C150]
          Length = 58

 Score = 42.2 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 33/57 (57%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           +  V+ ++ +++ ALR  K+ +   G L+E + R HYEKPS KR R    A +R +
Sbjct: 1  MSKTVVRKNESLDDALRRFKRSVTKAGTLQEARKREHYEKPSVKRKRKSEAARKRKK 57


>gi|163814105|ref|ZP_02205497.1| hypothetical protein COPEUT_00258 [Coprococcus eutactus ATCC
          27759]
 gi|158450554|gb|EDP27549.1| hypothetical protein COPEUT_00258 [Coprococcus eutactus ATCC
          27759]
 gi|295094822|emb|CBK83913.1| SSU ribosomal protein S21P [Coprococcus sp. ART55/1]
          Length = 58

 Score = 42.2 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + N++ ALR  K+     G+ +E++ R HYEKPS KR +    A +R  K
Sbjct: 8  ENENLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVKRKKKSEAARKRKYK 58


>gi|312866016|ref|ZP_07726237.1| ribosomal protein S21 [Streptococcus downei F0415]
 gi|311098420|gb|EFQ56643.1| ribosomal protein S21 [Streptococcus downei F0415]
          Length = 58

 Score = 42.2 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 33/57 (57%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           A  V+ ++ +++ ALR  K+ +   G L+E + R HYEKPS KR R    A +R +
Sbjct: 1  MAKTVVRKNESLDDALRRFKRSVTKAGTLQEARKREHYEKPSVKRKRKSEAARKRKK 57


>gi|187918130|ref|YP_001883693.1| 30S ribosomal protein S21 [Borrelia hermsii DAH]
 gi|203284177|ref|YP_002221917.1| 30S ribosomal protein S21 [Borrelia duttonii Ly]
 gi|203287713|ref|YP_002222728.1| 30S ribosomal protein S21 [Borrelia recurrentis A1]
 gi|203287716|ref|YP_002222731.1| 30S ribosomal protein S21 [Borrelia recurrentis A1]
 gi|226694979|sp|B5RL82|RS21_BORDL RecName: Full=30S ribosomal protein S21
 gi|226694980|sp|B2RZW7|RS21_BORHD RecName: Full=30S ribosomal protein S21
 gi|119860978|gb|AAX16773.1| SSU ribosomal protein S21P [Borrelia hermsii DAH]
 gi|201083620|gb|ACH93211.1| 30S ribosomal protein S21 [Borrelia duttonii Ly]
 gi|201084933|gb|ACH94507.1| 30S ribosomal protein S21 [Borrelia recurrentis A1]
 gi|201084936|gb|ACH94510.1| 30S ribosomal protein S21 [Borrelia recurrentis A1]
          Length = 69

 Score = 42.2 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 26/68 (38%), Positives = 41/68 (60%), Gaps = 1/68 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           V V V  N  +E+AL+  K+ ++ E ++RE K R +YEKPS  RV+ +    R+  K +
Sbjct: 1  MVTVNVDKNEGLEKALKRFKRMIEKEAIIREWKRREYYEKPSTIRVKKEKAFKRKQAKKV 60

Query: 78 RKIAQREG 85
          RK+ Q+ G
Sbjct: 61 RKLKQKIG 68


>gi|118581456|ref|YP_902706.1| 30S ribosomal protein S21 [Pelobacter propionicus DSM 2379]
 gi|166224048|sp|A1ATH8|RS21_PELPD RecName: Full=30S ribosomal protein S21
 gi|118504166|gb|ABL00649.1| SSU ribosomal protein S21P [Pelobacter propionicus DSM 2379]
          Length = 65

 Score = 42.2 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 32/54 (59%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQ 82
           E AL+  KK+ +  G+L E++ R H+EKPS KR +    A +R+ K  RK+  
Sbjct: 12 FELALKKFKKQCEKAGILSEVRKREHFEKPSIKRKKKAIAARKRALKKQRKMMD 65


>gi|55737452|gb|AAV61094.1| 30S ribosomal protein S21 [Streptococcus thermophilus LMG 18311]
 gi|55739380|gb|AAV63021.1| 30S ribosomal protein S21 [Streptococcus thermophilus CNRZ1066]
          Length = 68

 Score = 42.2 bits (98), Expect = 0.024,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 36/65 (55%)

Query: 10 IFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
          ++ E     +  V+ ++ +++ ALR  K+ +   G L+E + R HYEKPS KR R    A
Sbjct: 3  LYLEEVNSMSKIVVRKNESLDDALRRFKRSVTKAGTLQEARKREHYEKPSVKRKRKSEAA 62

Query: 70 IRRSR 74
           +R +
Sbjct: 63 RKRKK 67


>gi|332799057|ref|YP_004460556.1| 30S ribosomal protein S21 [Tepidanaerobacter sp. Re1]
 gi|332696792|gb|AEE91249.1| 30S ribosomal protein S21 [Tepidanaerobacter sp. Re1]
          Length = 60

 Score = 42.2 bits (98), Expect = 0.024,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 31/52 (59%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
           + +++ ALR  K+K Q  GVL E++ R HYEKPS KR +    A +R  + 
Sbjct: 8  ENESLDNALRRFKRKCQRSGVLSEVRKREHYEKPSVKRKKKSEAARKRKSRK 59


>gi|32034493|ref|ZP_00134665.1| COG0828: Ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|126208937|ref|YP_001054162.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae L20]
 gi|165976901|ref|YP_001652494.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|190150750|ref|YP_001969275.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|303250975|ref|ZP_07337164.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|303252481|ref|ZP_07338645.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|307246388|ref|ZP_07528464.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|307248516|ref|ZP_07530534.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 2 str. S1536]
 gi|307250747|ref|ZP_07532680.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 4 str. M62]
 gi|307253122|ref|ZP_07535003.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|307255374|ref|ZP_07537184.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 9 str. CVJ13261]
 gi|307257542|ref|ZP_07539306.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 10 str. D13039]
 gi|307259824|ref|ZP_07541542.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 11 str. 56153]
 gi|307261953|ref|ZP_07543611.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 12 str. 1096]
 gi|307264152|ref|ZP_07545746.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 13 str. N273]
 gi|322513556|ref|ZP_08066656.1| 30S ribosomal protein S21 [Actinobacillus ureae ATCC 25976]
 gi|166224005|sp|A3N2C1|RS21_ACTP2 RecName: Full=30S ribosomal protein S21
 gi|226694965|sp|B3H2A8|RS21_ACTP7 RecName: Full=30S ribosomal protein S21
 gi|226694966|sp|B0BR65|RS21_ACTPJ RecName: Full=30S ribosomal protein S21
 gi|126097729|gb|ABN74557.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 5b str. L20]
 gi|165877002|gb|ABY70050.1| 30S ribosomal protein s21 [Actinobacillus pleuropneumoniae
          serovar 3 str. JL03]
 gi|189915881|gb|ACE62133.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 7 str. AP76]
 gi|302648682|gb|EFL78874.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 2 str. 4226]
 gi|302650192|gb|EFL80359.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306852721|gb|EFM84950.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 1 str. 4074]
 gi|306854992|gb|EFM87177.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 2 str. S1536]
 gi|306857215|gb|EFM89338.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 4 str. M62]
 gi|306859416|gb|EFM91448.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 6 str. Femo]
 gi|306861683|gb|EFM93667.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 9 str. CVJ13261]
 gi|306863978|gb|EFM95897.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 10 str. D13039]
 gi|306866122|gb|EFM97992.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 11 str. 56153]
 gi|306868364|gb|EFN00183.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 12 str. 1096]
 gi|306870526|gb|EFN02276.1| 30S ribosomal protein S21 [Actinobacillus pleuropneumoniae
          serovar 13 str. N273]
 gi|322120627|gb|EFX92521.1| 30S ribosomal protein S21 [Actinobacillus ureae ATCC 25976]
          Length = 71

 Score = 42.2 bits (98), Expect = 0.024,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R K+   +R  K  
Sbjct: 1  MPVIKVRENESFDVALRRFKRSCEKAGLLAEVRAREFYEKPTTIRKREKASLAKRHAKRN 60

Query: 78 RKIAQR 83
           +   R
Sbjct: 61 ARENAR 66


>gi|15677780|ref|NP_274944.1| 30S ribosomal protein S21 [Neisseria meningitidis MC58]
 gi|59802431|ref|YP_209143.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae FA 1090]
 gi|121635605|ref|YP_975850.1| 30S ribosomal protein S21 [Neisseria meningitidis FAM18]
 gi|161869261|ref|YP_001598428.1| 30S ribosomal protein S21 [Neisseria meningitidis 053442]
 gi|194100093|ref|YP_002003233.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae NCCP11945]
 gi|218767479|ref|YP_002341991.1| 30S ribosomal protein S21 [Neisseria meningitidis Z2491]
 gi|239998082|ref|ZP_04718006.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae 35/02]
 gi|240013264|ref|ZP_04720177.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae DGI18]
 gi|240015712|ref|ZP_04722252.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae FA6140]
 gi|240079847|ref|ZP_04724390.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae FA19]
 gi|240112055|ref|ZP_04726545.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae MS11]
 gi|240114801|ref|ZP_04728863.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae PID18]
 gi|240117004|ref|ZP_04731066.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae PID1]
 gi|240120336|ref|ZP_04733298.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae PID24-1]
 gi|240122641|ref|ZP_04735597.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae PID332]
 gi|240124827|ref|ZP_04737713.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae SK-92-679]
 gi|240127343|ref|ZP_04740004.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae SK-93-1035]
 gi|254492865|ref|ZP_05106036.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae 1291]
 gi|254804236|ref|YP_003082457.1| 30S ribosomal protein S21 [Neisseria meningitidis alpha14]
 gi|255067923|ref|ZP_05319778.1| ribosomal protein S21 [Neisseria sicca ATCC 29256]
 gi|260441385|ref|ZP_05795201.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae DGI2]
 gi|261365917|ref|ZP_05978800.1| ribosomal protein S21 [Neisseria mucosa ATCC 25996]
 gi|261378144|ref|ZP_05982717.1| ribosomal protein S21 [Neisseria cinerea ATCC 14685]
 gi|261401695|ref|ZP_05987820.1| ribosomal protein S21 [Neisseria lactamica ATCC 23970]
 gi|268593935|ref|ZP_06128102.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae 35/02]
 gi|268595992|ref|ZP_06130159.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae FA19]
 gi|268598114|ref|ZP_06132281.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae MS11]
 gi|268600456|ref|ZP_06134623.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae PID18]
 gi|268602687|ref|ZP_06136854.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae PID1]
 gi|268681238|ref|ZP_06148100.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae PID332]
 gi|268683407|ref|ZP_06150269.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae SK-92-679]
 gi|268685715|ref|ZP_06152577.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae SK-93-1035]
 gi|291044744|ref|ZP_06570453.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae DGI2]
 gi|293397840|ref|ZP_06642046.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae F62]
 gi|296313921|ref|ZP_06863862.1| ribosomal protein S21 [Neisseria polysaccharea ATCC 43768]
 gi|298369311|ref|ZP_06980629.1| ribosomal protein S21 [Neisseria sp. oral taxon 014 str. F0314]
 gi|304388503|ref|ZP_07370606.1| 30S ribosomal protein S21 [Neisseria meningitidis ATCC 13091]
 gi|313669167|ref|YP_004049451.1| 30S ribosomal protein S21 [Neisseria lactamica ST-640]
 gi|54039478|sp|P66519|RS21_NEIMB RecName: Full=30S ribosomal protein S21
 gi|54042169|sp|P66518|RS21_NEIMA RecName: Full=30S ribosomal protein S21
 gi|75507267|sp|Q5F506|RS21_NEIG1 RecName: Full=30S ribosomal protein S21
 gi|166224042|sp|A1KW26|RS21_NEIMF RecName: Full=30S ribosomal protein S21
 gi|189044907|sp|A9M105|RS21_NEIM0 RecName: Full=30S ribosomal protein S21
 gi|226695029|sp|B4RRF0|RS21_NEIG2 RecName: Full=30S ribosomal protein S21
 gi|7227209|gb|AAF42279.1| 30S ribosomal protein S21 [Neisseria meningitidis MC58]
 gi|59719326|gb|AAW90731.1| putative 30S ribosomal protein S21 [Neisseria gonorrhoeae FA
          1090]
 gi|120867311|emb|CAM11082.1| 30S ribosomal protein S21 [Neisseria meningitidis FAM18]
 gi|121051487|emb|CAM07780.1| 30S ribosomal protein S21 [Neisseria meningitidis Z2491]
 gi|161594814|gb|ABX72474.1| 30S ribosomal protein S21 [Neisseria meningitidis 053442]
 gi|193935383|gb|ACF31207.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae NCCP11945]
 gi|226511905|gb|EEH61250.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae 1291]
 gi|254667778|emb|CBA03725.1| 30S ribosomal protein S21 [Neisseria meningitidis alpha14]
 gi|254669461|emb|CBA03337.1| 30S ribosomal protein S21 [Neisseria meningitidis alpha153]
 gi|254674234|emb|CBA10018.1| 30S ribosomal protein S21 [Neisseria meningitidis alpha275]
 gi|255047805|gb|EET43269.1| ribosomal protein S21 [Neisseria sicca ATCC 29256]
 gi|268547324|gb|EEZ42742.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae 35/02]
 gi|268549780|gb|EEZ44799.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae FA19]
 gi|268582245|gb|EEZ46921.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae MS11]
 gi|268584587|gb|EEZ49263.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae PID18]
 gi|268586818|gb|EEZ51494.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae PID1]
 gi|268621522|gb|EEZ53922.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae PID332]
 gi|268623691|gb|EEZ56091.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae SK-92-679]
 gi|268625999|gb|EEZ58399.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae SK-93-1035]
 gi|269145607|gb|EEZ72025.1| ribosomal protein S21 [Neisseria cinerea ATCC 14685]
 gi|269208224|gb|EEZ74679.1| ribosomal protein S21 [Neisseria lactamica ATCC 23970]
 gi|288565495|gb|EFC87055.1| ribosomal protein S21 [Neisseria mucosa ATCC 25996]
 gi|291011638|gb|EFE03634.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae DGI2]
 gi|291611786|gb|EFF40855.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae F62]
 gi|296839456|gb|EFH23394.1| ribosomal protein S21 [Neisseria polysaccharea ATCC 43768]
 gi|298283314|gb|EFI24801.1| ribosomal protein S21 [Neisseria sp. oral taxon 014 str. F0314]
 gi|304337500|gb|EFM03666.1| 30S ribosomal protein S21 [Neisseria meningitidis ATCC 13091]
 gi|308390048|gb|ADO32368.1| 30S ribosomal protein S21 [Neisseria meningitidis alpha710]
 gi|309379558|emb|CBX21924.1| 30S ribosomal protein S21 [Neisseria lactamica Y92-1009]
 gi|313006629|emb|CBN88095.1| 30S ribosomal protein S21 [Neisseria lactamica 020-06]
 gi|316985576|gb|EFV64523.1| ribosomal protein S21 [Neisseria meningitidis H44/76]
 gi|317165527|gb|ADV09068.1| 30S ribosomal protein S21 [Neisseria gonorrhoeae TCDC-NG08107]
 gi|319409741|emb|CBY90047.1| 30S ribosomal protein S21 [Neisseria meningitidis WUE 2594]
 gi|325127414|gb|EGC50345.1| ribosomal protein S21 [Neisseria meningitidis N1568]
 gi|325131435|gb|EGC54143.1| ribosomal protein S21 [Neisseria meningitidis M6190]
 gi|325133409|gb|EGC56073.1| ribosomal protein S21 [Neisseria meningitidis M13399]
 gi|325135542|gb|EGC58160.1| ribosomal protein S21 [Neisseria meningitidis M0579]
 gi|325137506|gb|EGC60090.1| ribosomal protein S21 [Neisseria meningitidis ES14902]
 gi|325139601|gb|EGC62141.1| ribosomal protein S21 [Neisseria meningitidis CU385]
 gi|325141500|gb|EGC63972.1| ribosomal protein S21 [Neisseria meningitidis 961-5945]
 gi|325143660|gb|EGC65979.1| ribosomal protein S21 [Neisseria meningitidis M01-240013]
 gi|325199040|gb|ADY94496.1| ribosomal protein S21 [Neisseria meningitidis G2136]
 gi|325200999|gb|ADY96454.1| ribosomal protein S21 [Neisseria meningitidis H44/76]
 gi|325201412|gb|ADY96866.1| ribosomal protein S21 [Neisseria meningitidis M01-240149]
 gi|325204901|gb|ADZ00355.1| ribosomal protein S21 [Neisseria meningitidis M01-240355]
 gi|325206856|gb|ADZ02309.1| ribosomal protein S21 [Neisseria meningitidis M04-240196]
 gi|325207393|gb|ADZ02845.1| ribosomal protein S21 [Neisseria meningitidis NZ-05/33]
          Length = 70

 Score = 42.2 bits (98), Expect = 0.025,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R +K +
Sbjct: 1  MPAIRVKENEPFEVAMRRFKRAVEKTGLLTELRAREAYEKPTTERKRKKAAAVKRLQKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|22297582|ref|NP_680829.1| 30S ribosomal protein S21 [Thermosynechococcus elongatus BP-1]
 gi|33516952|sp|Q8DMS3|RS21_THEEB RecName: Full=30S ribosomal protein S21
 gi|22293759|dbj|BAC07591.1| 30S ribosomal protein S21 [Thermosynechococcus elongatus BP-1]
          Length = 57

 Score = 42.2 bits (98), Expect = 0.025,   Method: Composition-based stats.
 Identities = 23/50 (46%), Positives = 33/50 (66%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           + ++E ALR  KKK+Q  G+L E+K R  YEKPS +R R +  A +R+R
Sbjct: 8  ENESIESALRRFKKKIQKAGILSEVKRRERYEKPSLRRKRKQEAARKRNR 57


>gi|33151866|ref|NP_873219.1| 30S ribosomal protein S21 [Haemophilus ducreyi 35000HP]
 gi|13959524|sp|Q9RGX2|RS21_HAEDU RecName: Full=30S ribosomal protein S21
 gi|6677603|gb|AAF23242.1| S21 ribosomal protein [Haemophilus ducreyi]
 gi|33148087|gb|AAP95608.1| 30S ribosomal protein s21 [Haemophilus ducreyi 35000HP]
          Length = 71

 Score = 42.2 bits (98), Expect = 0.025,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R K+   +R  K  
Sbjct: 1  MPVIKVRENESFDVALRRFKRSCEKAGLLAEVRAREFYEKPTTVRKREKASLAKRHAKRN 60

Query: 78 RKIAQR 83
           +   R
Sbjct: 61 ARENAR 66


>gi|148244356|ref|YP_001219050.1| 30S ribosomal protein S21 [Candidatus Vesicomyosocius okutanii
          HA]
 gi|166225206|sp|A5CXJ1|RS21_VESOH RecName: Full=30S ribosomal protein S21
 gi|146326183|dbj|BAF61326.1| 30S ribosomal protein S21 [Candidatus Vesicomyosocius okutanii
          HA]
          Length = 71

 Score = 42.2 bits (98), Expect = 0.025,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 35/62 (56%), Gaps = 1/62 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  ++     GV+ +++ +  +EKP+    R+K+ A++R+ K M
Sbjct: 1  MPSIKVRENEPFDIALRRFRRICDRAGVITDVRKKEFFEKPTWVSKRMKAAAVKRTHKEM 60

Query: 78 RK 79
           K
Sbjct: 61 AK 62


>gi|134093710|ref|YP_001098785.1| 30S ribosomal protein S21 [Herminiimonas arsenicoxydans]
 gi|152983162|ref|YP_001352180.1| 30S ribosomal protein S21 [Janthinobacterium sp. Marseille]
 gi|166224034|sp|A4G2B9|RS21_HERAR RecName: Full=30S ribosomal protein S21
 gi|166224035|sp|A6SV83|RS21_JANMA RecName: Full=30S ribosomal protein S21
 gi|133737613|emb|CAL60656.1| 30S ribosomal subunit protein S21 [Herminiimonas arsenicoxydans]
 gi|151283239|gb|ABR91649.1| small subunit ribosomal protein S21 [Janthinobacterium sp.
          Marseille]
          Length = 70

 Score = 42.2 bits (98), Expect = 0.025,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 33/62 (53%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   E A+R  K+ ++  G+L +L+ R  YEKP+ +R R  + A++R  K +R     +
Sbjct: 8  ENEPFEVAMRRFKRTIEKTGLLTDLRAREFYEKPTAERKRKLAAAVKRHYKRIRSQQLPK 67

Query: 85 GA 86
            
Sbjct: 68 KL 69


>gi|125717668|ref|YP_001034801.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK36]
 gi|157149903|ref|YP_001450558.1| 30S ribosomal protein S21 [Streptococcus gordonii str. Challis
          substr. CH1]
 gi|223932507|ref|ZP_03624508.1| ribosomal protein S21 [Streptococcus suis 89/1591]
 gi|253753967|ref|YP_003027108.1| 30S ribosomal protein S21 [Streptococcus suis P1/7]
 gi|253755902|ref|YP_003029042.1| 30S ribosomal protein S21 [Streptococcus suis BM407]
 gi|289167561|ref|YP_003445830.1| 30S ribosomal protein S21 [Streptococcus mitis B6]
 gi|293365727|ref|ZP_06612436.1| 30S ribosomal protein S21 [Streptococcus oralis ATCC 35037]
 gi|306824950|ref|ZP_07458293.1| 30S ribosomal protein S21 [Streptococcus sp. oral taxon 071 str.
          73H25AP]
 gi|306829779|ref|ZP_07462968.1| 30S ribosomal protein S21 [Streptococcus mitis ATCC 6249]
 gi|307703668|ref|ZP_07640610.1| ribosomal protein S21 [Streptococcus oralis ATCC 35037]
 gi|307705264|ref|ZP_07642130.1| ribosomal protein S21 [Streptococcus mitis SK597]
 gi|307706875|ref|ZP_07643677.1| ribosomal protein S21 [Streptococcus mitis SK321]
 gi|307709510|ref|ZP_07645966.1| ribosomal protein S21 [Streptococcus mitis SK564]
 gi|309798496|ref|ZP_07692779.1| ribosomal protein S21 [Streptococcus infantis SK1302]
 gi|315223012|ref|ZP_07864891.1| ribosomal protein S21 [Streptococcus anginosus F0211]
 gi|319939164|ref|ZP_08013528.1| 30S ribosomal protein S21 [Streptococcus anginosus 1_2_62CV]
 gi|319947292|ref|ZP_08021525.1| 30S ribosomal protein S21 [Streptococcus australis ATCC 700641]
 gi|322375516|ref|ZP_08050029.1| ribosomal protein S21 [Streptococcus sp. C300]
 gi|322377316|ref|ZP_08051807.1| ribosomal protein S21 [Streptococcus sp. M334]
 gi|322387509|ref|ZP_08061118.1| 30S ribosomal protein S21 [Streptococcus infantis ATCC 700779]
 gi|322391738|ref|ZP_08065203.1| 30S ribosomal protein S21 [Streptococcus peroris ATCC 700780]
 gi|330833087|ref|YP_004401912.1| 30S ribosomal protein S21 [Streptococcus suis ST3]
 gi|331266087|ref|YP_004325717.1| 30S ribosomal protein S21 [Streptococcus oralis Uo5]
 gi|166225201|sp|A3CM46|RS21_STRSV RecName: Full=30S ribosomal protein S21
 gi|189044920|sp|A8AXP8|RS21_STRGC RecName: Full=30S ribosomal protein S21
 gi|125497585|gb|ABN44251.1| Ribosomal protein S21, putative [Streptococcus sanguinis SK36]
 gi|157074697|gb|ABV09380.1| ribosomal protein S21 [Streptococcus gordonii str. Challis
          substr. CH1]
 gi|223898778|gb|EEF65138.1| ribosomal protein S21 [Streptococcus suis 89/1591]
 gi|251818366|emb|CAZ56192.1| 30S ribosomal protein S21 [Streptococcus suis BM407]
 gi|251820213|emb|CAR46621.1| 30S ribosomal protein S21 [Streptococcus suis P1/7]
 gi|288907128|emb|CBJ21962.1| 30S ribosomal protein S21 [Streptococcus mitis B6]
 gi|291316095|gb|EFE56539.1| 30S ribosomal protein S21 [Streptococcus oralis ATCC 35037]
 gi|292558727|gb|ADE31728.1| 30S Ribosomal protein S21 [Streptococcus suis GZ1]
 gi|304428130|gb|EFM31221.1| 30S ribosomal protein S21 [Streptococcus mitis ATCC 6249]
 gi|304432777|gb|EFM35750.1| 30S ribosomal protein S21 [Streptococcus sp. oral taxon 071 str.
          73H25AP]
 gi|307617748|gb|EFN96913.1| ribosomal protein S21 [Streptococcus mitis SK321]
 gi|307619729|gb|EFN98849.1| ribosomal protein S21 [Streptococcus mitis SK564]
 gi|307621177|gb|EFO00248.1| ribosomal protein S21 [Streptococcus mitis SK597]
 gi|307623075|gb|EFO02070.1| ribosomal protein S21 [Streptococcus oralis ATCC 35037]
 gi|308117878|gb|EFO55271.1| ribosomal protein S21 [Streptococcus infantis SK1302]
 gi|315187962|gb|EFU21698.1| ribosomal protein S21 [Streptococcus anginosus F0211]
 gi|319746534|gb|EFV98794.1| 30S ribosomal protein S21 [Streptococcus australis ATCC 700641]
 gi|319758525|gb|ADV70467.1| 30S ribosomal protein S21 [Streptococcus suis JS14]
 gi|319812214|gb|EFW08480.1| 30S ribosomal protein S21 [Streptococcus anginosus 1_2_62CV]
 gi|321141376|gb|EFX36872.1| 30S ribosomal protein S21 [Streptococcus infantis ATCC 700779]
 gi|321145218|gb|EFX40614.1| 30S ribosomal protein S21 [Streptococcus peroris ATCC 700780]
 gi|321279779|gb|EFX56819.1| ribosomal protein S21 [Streptococcus sp. C300]
 gi|321281516|gb|EFX58525.1| ribosomal protein S21 [Streptococcus sp. M334]
 gi|325693943|gb|EGD35861.1| 30S ribosomal protein S21 [Streptococcus sanguinis SK150]
 gi|326682759|emb|CBZ00376.1| 30S ribosomal protein S21 [Streptococcus oralis Uo5]
 gi|329307310|gb|AEB81726.1| 30S ribosomal protein S21 [Streptococcus suis ST3]
          Length = 58

 Score = 42.2 bits (98), Expect = 0.025,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A +R +
Sbjct: 1  MSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKRKSEAARKRKK 57


>gi|187931641|ref|YP_001891625.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          mediasiatica FSC147]
 gi|187712550|gb|ACD30847.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          mediasiatica FSC147]
          Length = 62

 Score = 42.2 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 30/47 (63%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + ALR  K+  +  G++ EL+ R ++EKP+  R R K+ A++R+ K
Sbjct: 12 FDVALRRFKRSCEKAGIVSELRRREYFEKPTWARKRKKTAAVKRAHK 58


>gi|91205269|ref|YP_537624.1| 30S ribosomal protein S21 [Rickettsia bellii RML369-C]
 gi|119367304|sp|Q1RJC9|RS21_RICBR RecName: Full=30S ribosomal protein S21
 gi|91068813|gb|ABE04535.1| 30S ribosomal protein S21 [Rickettsia bellii RML369-C]
          Length = 66

 Score = 42.2 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 27/50 (54%)

Query: 19 AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSE 68
           + V V   N +  L+  KKK+Q E   R++K + +YE  S KRVR   E
Sbjct: 1  MILVNVHAGNCDNTLKNFKKKLQRELYFRKMKEQRYYEPKSVKRVRKAQE 50


>gi|37522205|ref|NP_925582.1| 30S ribosomal protein S21 [Gloeobacter violaceus PCC 7421]
 gi|81709392|sp|Q7NHA1|RS212_GLOVI RecName: Full=30S ribosomal protein S21 2
 gi|35213205|dbj|BAC90577.1| 30S ribosomal protein S21 [Gloeobacter violaceus PCC 7421]
          Length = 57

 Score = 42.2 bits (98), Expect = 0.026,   Method: Composition-based stats.
 Identities = 22/50 (44%), Positives = 31/50 (62%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           + ++E AL+  KKK+Q  G+L E+K R  YEKPS +R R    A +R R
Sbjct: 8  ENESIESALKRFKKKIQKAGILSEIKRRERYEKPSARRKRKAEAARKRRR 57


>gi|315658149|ref|ZP_07911021.1| 30S ribosomal protein S21 [Staphylococcus lugdunensis M23590]
 gi|315496478|gb|EFU84801.1| 30S ribosomal protein S21 [Staphylococcus lugdunensis M23590]
          Length = 75

 Score = 42.2 bits (98), Expect = 0.027,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 35/66 (53%)

Query: 10 IFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
          IF       +  V+ ++ ++E ALR  K+ +   G ++E++ R  YEKPS KR +    A
Sbjct: 10 IFGGREIQMSKTVVRKNESLEDALRRFKRSVSKSGTIQEVRKREFYEKPSVKRKKKSEAA 69

Query: 70 IRRSRK 75
           +R  K
Sbjct: 70 RKRKFK 75


>gi|257425700|ref|ZP_05602124.1| SSU ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          55/2053]
 gi|257428361|ref|ZP_05604759.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          65-1322]
 gi|257430998|ref|ZP_05607378.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          68-397]
 gi|257433686|ref|ZP_05610044.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus E1410]
 gi|257436600|ref|ZP_05612644.1| SSU ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          M876]
 gi|257793651|ref|ZP_05642630.1| 30S ribosomal protein S21 [Staphylococcus aureus A9781]
 gi|258411049|ref|ZP_05681329.1| 30S ribosomal protein S21 [Staphylococcus aureus A9763]
 gi|258424003|ref|ZP_05686885.1| SSU ribosomal protein S21 [Staphylococcus aureus A9635]
 gi|258437407|ref|ZP_05689391.1| ribosomal protein S21 [Staphylococcus aureus A9299]
 gi|258443613|ref|ZP_05691952.1| ribosomal protein S21 [Staphylococcus aureus A8115]
 gi|258446820|ref|ZP_05694974.1| 30S ribosomal protein S21 [Staphylococcus aureus A6300]
 gi|258448734|ref|ZP_05696846.1| 30s ribosomal protein S21 [Staphylococcus aureus A6224]
 gi|258450596|ref|ZP_05698658.1| ribosomal protein S21 [Staphylococcus aureus A5948]
 gi|258453551|ref|ZP_05701529.1| ribosomal protein S21 [Staphylococcus aureus A5937]
 gi|282893076|ref|ZP_06301310.1| 30S ribosomal protein S21 [Staphylococcus aureus A8117]
 gi|282904157|ref|ZP_06312045.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus C160]
 gi|282905984|ref|ZP_06313839.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          Btn1260]
 gi|282908894|ref|ZP_06316712.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          WW2703/97]
 gi|282911213|ref|ZP_06319015.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          WBG10049]
 gi|282914382|ref|ZP_06322168.1| conserved domain protein [Staphylococcus aureus subsp. aureus
          M899]
 gi|282916845|ref|ZP_06324603.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          D139]
 gi|282919351|ref|ZP_06327086.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          C427]
 gi|282920124|ref|ZP_06327849.1| 30S ribosomal protein S21 [Staphylococcus aureus A9765]
 gi|282924676|ref|ZP_06332344.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          C101]
 gi|282928208|ref|ZP_06335813.1| 30S ribosomal protein S21 [Staphylococcus aureus A10102]
 gi|283770651|ref|ZP_06343543.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          H19]
 gi|283958339|ref|ZP_06375790.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          A017934/97]
 gi|293503456|ref|ZP_06667303.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          58-424]
 gi|293510473|ref|ZP_06669179.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          M809]
 gi|293531013|ref|ZP_06671695.1| conserved domain protein [Staphylococcus aureus subsp. aureus
          M1015]
 gi|257271394|gb|EEV03540.1| SSU ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          55/2053]
 gi|257275202|gb|EEV06689.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          65-1322]
 gi|257278428|gb|EEV09064.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          68-397]
 gi|257281779|gb|EEV11916.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus E1410]
 gi|257283951|gb|EEV14074.1| SSU ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          M876]
 gi|257787623|gb|EEV25963.1| 30S ribosomal protein S21 [Staphylococcus aureus A9781]
 gi|257840199|gb|EEV64663.1| 30S ribosomal protein S21 [Staphylococcus aureus A9763]
 gi|257845624|gb|EEV69656.1| SSU ribosomal protein S21 [Staphylococcus aureus A9635]
 gi|257848612|gb|EEV72600.1| ribosomal protein S21 [Staphylococcus aureus A9299]
 gi|257851019|gb|EEV74962.1| ribosomal protein S21 [Staphylococcus aureus A8115]
 gi|257854395|gb|EEV77344.1| 30S ribosomal protein S21 [Staphylococcus aureus A6300]
 gi|257858012|gb|EEV80901.1| 30s ribosomal protein S21 [Staphylococcus aureus A6224]
 gi|257861754|gb|EEV84553.1| ribosomal protein S21 [Staphylococcus aureus A5948]
 gi|257864282|gb|EEV87032.1| ribosomal protein S21 [Staphylococcus aureus A5937]
 gi|282313511|gb|EFB43906.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          C101]
 gi|282317161|gb|EFB47535.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          C427]
 gi|282319332|gb|EFB49684.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          D139]
 gi|282321563|gb|EFB51888.1| conserved domain protein [Staphylococcus aureus subsp. aureus
          M899]
 gi|282324908|gb|EFB55218.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          WBG10049]
 gi|282327158|gb|EFB57453.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          WW2703/97]
 gi|282331276|gb|EFB60790.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          Btn1260]
 gi|282590015|gb|EFB95097.1| 30S ribosomal protein S21 [Staphylococcus aureus A10102]
 gi|282594472|gb|EFB99457.1| 30S ribosomal protein S21 [Staphylococcus aureus A9765]
 gi|282595775|gb|EFC00739.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus C160]
 gi|282764394|gb|EFC04520.1| 30S ribosomal protein S21 [Staphylococcus aureus A8117]
 gi|283460798|gb|EFC07888.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          H19]
 gi|283790488|gb|EFC29305.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          A017934/97]
 gi|290920281|gb|EFD97347.1| conserved domain protein [Staphylococcus aureus subsp. aureus
          M1015]
 gi|291095122|gb|EFE25387.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          58-424]
 gi|291466837|gb|EFF09357.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          M809]
          Length = 67

 Score = 42.2 bits (98), Expect = 0.027,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 35/66 (53%)

Query: 10 IFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
          IF       +  V+ ++ ++E ALR  K+ +   G ++E++ R  YEKPS KR +    A
Sbjct: 2  IFGGREIQMSKTVVRKNESLEDALRRFKRSVSKSGTIQEVRKREFYEKPSVKRKKKSEAA 61

Query: 70 IRRSRK 75
           +R  K
Sbjct: 62 RKRKFK 67


>gi|170940220|emb|CAP65447.1| unnamed protein product [Podospora anserina S mat+]
          Length = 241

 Score = 42.2 bits (98), Expect = 0.027,   Method: Composition-based stats.
 Identities = 16/64 (25%), Positives = 28/64 (43%)

Query: 12  SEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
              R  S   V V+ N+  +A +VL    +   +   ++ +  +E+P+ KR R   E  R
Sbjct: 160 IRLRPTSGRTVPVKSNDPARAFKVLNALCRHNNLSNTVREQRFHERPALKRKRKLRERWR 219

Query: 72  RSRK 75
              K
Sbjct: 220 TRFK 223


>gi|317153212|ref|YP_004121260.1| 30S ribosomal protein S21 [Desulfovibrio aespoeensis Aspo-2]
 gi|316943463|gb|ADU62514.1| ribosomal protein S21 [Desulfovibrio aespoeensis Aspo-2]
          Length = 66

 Score = 42.2 bits (98), Expect = 0.027,   Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 36/53 (67%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          +N + +LR  KK+++  G+L ELK R HYEKPS ++ + K+ A +R  K MRK
Sbjct: 10 DNFDISLRRFKKQVEKAGILSELKKRQHYEKPSVQKKKKKAAAKKRLAKKMRK 62


>gi|167855427|ref|ZP_02478192.1| 30S ribosomal protein S21 [Haemophilus parasuis 29755]
 gi|219871372|ref|YP_002475747.1| 30S ribosomal protein S21 [Haemophilus parasuis SH0165]
 gi|254813720|sp|B8F647|RS21_HAEPS RecName: Full=30S ribosomal protein S21
 gi|167853421|gb|EDS24670.1| 30S ribosomal protein S21 [Haemophilus parasuis 29755]
 gi|219691576|gb|ACL32799.1| 30S ribosomal protein S21 [Haemophilus parasuis SH0165]
          Length = 71

 Score = 42.2 bits (98), Expect = 0.027,   Method: Composition-based stats.
 Identities = 21/66 (31%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R K+   +R  K  
Sbjct: 1  MPVIKVRENESFDVALRRFKRSCEKAGLLAEVRAREFYEKPTTIRKREKASLAKRHAKRN 60

Query: 78 RKIAQR 83
           +   R
Sbjct: 61 FRENAR 66


>gi|119953055|ref|YP_945264.1| 30S ribosomal protein S21 [Borrelia turicatae 91E135]
 gi|119861826|gb|AAX17594.1| SSU ribosomal protein S21P [Borrelia turicatae 91E135]
          Length = 72

 Score = 42.2 bits (98), Expect = 0.027,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 39/61 (63%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
          ++  +E+AL+  K+ ++ E ++RE K R +YEKPS  RV+ +    R+  K +RK+ Q+ 
Sbjct: 11 KNEGLEKALKRFKRMIEKEAIIREWKRREYYEKPSTIRVKKEKAFKRKQAKKVRKLKQKI 70

Query: 85 G 85
          G
Sbjct: 71 G 71


>gi|315924409|ref|ZP_07920631.1| 30S ribosomal protein S21 [Pseudoramibacter alactolyticus ATCC
          23263]
 gi|315622288|gb|EFV02247.1| 30S ribosomal protein S21 [Pseudoramibacter alactolyticus ATCC
          23263]
          Length = 61

 Score = 42.2 bits (98), Expect = 0.028,   Method: Composition-based stats.
 Identities = 26/61 (42%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N  +E ALR  K+K    GV+ E++ R HYEKPS KR +    A +R  K  
Sbjct: 1  MSEVRVRENESLESALRRFKRKTAMAGVMSEIRKREHYEKPSVKRKKKSEAARKRKMKKH 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|51891652|ref|YP_074343.1| 30S ribosomal protein S21 [Symbiobacterium thermophilum IAM
          14863]
 gi|61215886|sp|Q67S44|RS21_SYMTH RecName: Full=30S ribosomal protein S21
 gi|51855341|dbj|BAD39499.1| 30S ribosomal protein S21 [Symbiobacterium thermophilum IAM
          14863]
          Length = 58

 Score = 42.2 bits (98), Expect = 0.028,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          ++ +++ ALR  K+++Q  GVL E++ R HYEKPS KR +    A RR  +
Sbjct: 8  KNESLDSALRRFKRQLQRAGVLAEIRKREHYEKPSVKRKKKSEAARRRKYR 58


>gi|15674824|ref|NP_268998.1| 30S ribosomal protein S21 [Streptococcus pyogenes M1 GAS]
 gi|19745863|ref|NP_606999.1| 30S ribosomal protein S21 [Streptococcus pyogenes MGAS8232]
 gi|21910052|ref|NP_664320.1| 30S ribosomal protein S21 [Streptococcus pyogenes MGAS315]
 gi|22537575|ref|NP_688426.1| 30S ribosomal protein S21 [Streptococcus agalactiae 2603V/R]
 gi|24379273|ref|NP_721228.1| 30S ribosomal protein S21 [Streptococcus mutans UA159]
 gi|25011541|ref|NP_735936.1| 30S ribosomal protein S21 [Streptococcus agalactiae NEM316]
 gi|28896250|ref|NP_802600.1| 30S ribosomal protein S21 [Streptococcus pyogenes SSI-1]
 gi|76788105|ref|YP_330072.1| 30S ribosomal protein S21 [Streptococcus agalactiae A909]
 gi|139474035|ref|YP_001128751.1| 30S ribosomal protein S21 [Streptococcus pyogenes str. Manfredo]
 gi|161761317|ref|YP_059932.2| 30S ribosomal protein S21 [Streptococcus pyogenes MGAS10394]
 gi|161936125|ref|YP_281960.2| 30S ribosomal protein S21 [Streptococcus pyogenes MGAS5005]
 gi|162139085|ref|YP_596383.2| 30S ribosomal protein S21 [Streptococcus pyogenes MGAS9429]
 gi|162139109|ref|YP_598261.2| 30S ribosomal protein S21 [Streptococcus pyogenes MGAS10270]
 gi|162139134|ref|YP_600257.2| 30S ribosomal protein S21 [Streptococcus pyogenes MGAS2096]
 gi|162139186|ref|YP_602176.2| 30S ribosomal protein S21 [Streptococcus pyogenes MGAS10750]
 gi|162139407|ref|YP_280045.2| 30S ribosomal protein S21 [Streptococcus pyogenes MGAS6180]
 gi|222152851|ref|YP_002562028.1| 30S ribosomal protein S21 [Streptococcus uberis 0140J]
 gi|251782158|ref|YP_002996460.1| 30S ribosomal protein S21 [Streptococcus dysgalactiae subsp.
          equisimilis GGS_124]
 gi|288905583|ref|YP_003430805.1| ribosomal protein S21 [Streptococcus gallolyticus UCN34]
 gi|290580722|ref|YP_003485114.1| 30S ribosomal protein S21 [Streptococcus mutans NN2025]
 gi|313890550|ref|ZP_07824178.1| ribosomal protein S21 [Streptococcus pseudoporcinus SPIN 20026]
 gi|329116023|ref|ZP_08244740.1| ribosomal protein S21 [Streptococcus parauberis NCFD 2020]
 gi|332523092|ref|ZP_08399344.1| ribosomal protein S21 [Streptococcus porcinus str. Jelinkova 176]
 gi|54039483|sp|P66527|RS21_STRP3 RecName: Full=30S ribosomal protein S21
 gi|54039484|sp|P66528|RS21_STRP8 RecName: Full=30S ribosomal protein S21
 gi|54039485|sp|P66529|RS21_STRA3 RecName: Full=30S ribosomal protein S21
 gi|54039486|sp|P66530|RS21_STRA5 RecName: Full=30S ribosomal protein S21
 gi|54039487|sp|P66531|RS21_STRMU RecName: Full=30S ribosomal protein S21
 gi|54042172|sp|P66526|RS21_STRP1 RecName: Full=30S ribosomal protein S21
 gi|61215820|sp|Q5XCW4|RS21_STRP6 RecName: Full=30S ribosomal protein S21
 gi|119367321|sp|Q3K081|RS21_STRA1 RecName: Full=30S ribosomal protein S21
 gi|119367322|sp|Q1JCJ5|RS21_STRPB RecName: Full=30S ribosomal protein S21
 gi|119367323|sp|Q1JMH3|RS21_STRPC RecName: Full=30S ribosomal protein S21
 gi|119367324|sp|Q1JHL9|RS21_STRPD RecName: Full=30S ribosomal protein S21
 gi|119367325|sp|Q1J7E2|RS21_STRPF RecName: Full=30S ribosomal protein S21
 gi|119367326|sp|Q48UB6|RS21_STRPM RecName: Full=30S ribosomal protein S21
 gi|166225200|sp|A2RFA6|RS21_STRPG RecName: Full=30S ribosomal protein S21
 gi|254764436|sp|B9DRV3|RS21_STRU0 RecName: Full=30S ribosomal protein S21
 gi|22534458|gb|AAN00299.1|AE014257_6 ribosomal protein S21 [Streptococcus agalactiae 2603V/R]
 gi|24377190|gb|AAN58534.1|AE014922_9 30S ribosomal protein S21 [Streptococcus mutans UA159]
 gi|13621956|gb|AAK33719.1| 30S ribosomal protein S21 [Streptococcus pyogenes M1 GAS]
 gi|19748013|gb|AAL97498.1| 30S ribosomal protein S21 [Streptococcus pyogenes MGAS8232]
 gi|21904243|gb|AAM79123.1| 30S ribosomal protein S21 [Streptococcus pyogenes MGAS315]
 gi|24413080|emb|CAD47158.1| ribosomal protein S21 [Streptococcus agalactiae NEM316]
 gi|28811501|dbj|BAC64433.1| 30S ribosomal protein S21 [Streptococcus pyogenes SSI-1]
 gi|76563162|gb|ABA45746.1| ribosomal protein S21 [Streptococcus agalactiae A909]
 gi|134272282|emb|CAM30535.1| 30S ribosomal protein S21 [Streptococcus pyogenes str. Manfredo]
 gi|222113664|emb|CAR41588.1| 30S ribosomal protein S21 [Streptococcus uberis 0140J]
 gi|242390787|dbj|BAH81246.1| 30S ribosomal protein S21 [Streptococcus dysgalactiae subsp.
          equisimilis GGS_124]
 gi|254997621|dbj|BAH88222.1| 30S ribosomal protein S21 [Streptococcus mutans NN2025]
 gi|288732309|emb|CBI13879.1| ribosomal protein S21 [Streptococcus gallolyticus UCN34]
 gi|313121067|gb|EFR44178.1| ribosomal protein S21 [Streptococcus pseudoporcinus SPIN 20026]
 gi|322411494|gb|EFY02402.1| 30S ribosomal protein S21 [Streptococcus dysgalactiae subsp.
          dysgalactiae ATCC 27957]
 gi|323127011|gb|ADX24308.1| 30S ribosomal protein S21 [Streptococcus dysgalactiae subsp.
          equisimilis ATCC 12394]
 gi|326906428|gb|EGE53342.1| ribosomal protein S21 [Streptococcus parauberis NCFD 2020]
 gi|332314356|gb|EGJ27341.1| ribosomal protein S21 [Streptococcus porcinus str. Jelinkova 176]
          Length = 58

 Score = 41.8 bits (97), Expect = 0.028,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A +R +
Sbjct: 1  MSKTVVRKNESLDDALRRFKRSVTKAGTLQESRKREFYEKPSVKRKRKSEAARKRKK 57


>gi|259503173|ref|ZP_05746075.1| 30S ribosomal protein S21 [Lactobacillus antri DSM 16041]
 gi|259168830|gb|EEW53325.1| 30S ribosomal protein S21 [Lactobacillus antri DSM 16041]
          Length = 62

 Score = 41.8 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 32/61 (52%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR      A +R  K  
Sbjct: 1  MSKTVVRKNESLDDALRRFKRSVSRNGTLQEYRKREFYEKPSVKRKLKSEAARKRKNKRG 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|329906285|ref|ZP_08274381.1| SSU ribosomal protein S21p [Oxalobacteraceae bacterium IMCC9480]
 gi|327547305|gb|EGF32144.1| SSU ribosomal protein S21p [Oxalobacteraceae bacterium IMCC9480]
          Length = 70

 Score = 41.8 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 33/62 (53%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R  K +R     +
Sbjct: 8  ENEPFEVAMRRFKRTIEKTGLLTELRAREFYEKPTAERKRKLAAAVKRHYKRIRSQQLPK 67

Query: 85 GA 86
            
Sbjct: 68 KL 69


>gi|162450022|ref|YP_001612389.1| 30S ribosomal protein S21 [Sorangium cellulosum 'So ce 56']
 gi|161160604|emb|CAN91909.1| 30S ribosomal protein S21 [Sorangium cellulosum 'So ce 56']
          Length = 74

 Score = 41.8 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 24/49 (48%), Positives = 33/49 (67%)

Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVR 64
          +   + V V D  +E+A++ LK+KM  EG+LRELK R HY KPS KR +
Sbjct: 7  QCKPLEVAVGDKGIERAIKHLKRKMAAEGILRELKRRRHYMKPSVKRRK 55


>gi|21233245|ref|NP_639162.1| 30S ribosomal protein S21 [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|21244596|ref|NP_644178.1| 30S ribosomal protein S21 [Xanthomonas axonopodis pv. citri str.
          306]
 gi|66770187|ref|YP_244949.1| 30S ribosomal protein S21 [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|78049547|ref|YP_365722.1| 30S ribosomal protein S21 [Xanthomonas campestris pv. vesicatoria
          str. 85-10]
 gi|84625559|ref|YP_452931.1| 30S ribosomal protein S21 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|166710405|ref|ZP_02241612.1| 30S ribosomal protein S21 [Xanthomonas oryzae pv. oryzicola
          BLS256]
 gi|188574982|ref|YP_001911911.1| 30S ribosomal protein S21 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|188993397|ref|YP_001905407.1| 30S ribosomal protein S21 [Xanthomonas campestris pv. campestris
          str. B100]
 gi|190572512|ref|YP_001970357.1| 30S ribosomal protein S21 [Stenotrophomonas maltophilia K279a]
 gi|194364104|ref|YP_002026714.1| 30S ribosomal protein S21 [Stenotrophomonas maltophilia R551-3]
 gi|254522614|ref|ZP_05134669.1| ribosomal protein S21 [Stenotrophomonas sp. SKA14]
 gi|289666287|ref|ZP_06487868.1| 30S ribosomal protein S21 [Xanthomonas campestris pv. vasculorum
          NCPPB702]
 gi|289670008|ref|ZP_06491083.1| 30S ribosomal protein S21 [Xanthomonas campestris pv. musacearum
          NCPPB4381]
 gi|325918194|ref|ZP_08180343.1| SSU ribosomal protein S21P [Xanthomonas vesicatoria ATCC 35937]
 gi|325920510|ref|ZP_08182435.1| SSU ribosomal protein S21P [Xanthomonas gardneri ATCC 19865]
 gi|325928841|ref|ZP_08190008.1| SSU ribosomal protein S21P [Xanthomonas perforans 91-118]
 gi|54039490|sp|P66536|RS21_XANCP RecName: Full=30S ribosomal protein S21
 gi|54042174|sp|P66535|RS21_XANAC RecName: Full=30S ribosomal protein S21
 gi|81303861|sp|Q4UPU4|RS21_XANC8 RecName: Full=30S ribosomal protein S21
 gi|119367341|sp|Q3BNE1|RS21_XANC5 RecName: Full=30S ribosomal protein S21
 gi|119367342|sp|Q2NYH0|RS21_XANOM RecName: Full=30S ribosomal protein S21
 gi|119367343|sp|Q05I90|RS21_XANOR RecName: Full=30S ribosomal protein S21
 gi|226695053|sp|B4SHI8|RS21_STRM5 RecName: Full=30S ribosomal protein S21
 gi|226695054|sp|B2FK05|RS21_STRMK RecName: Full=30S ribosomal protein S21
 gi|226695066|sp|B2SLA2|RS21_XANOP RecName: Full=30S ribosomal protein S21
 gi|226732164|sp|B0RXI3|RS21_XANCB RecName: Full=30S ribosomal protein S21
 gi|21110275|gb|AAM38714.1| 30S ribosomal protein S21 [Xanthomonas axonopodis pv. citri str.
          306]
 gi|21115568|gb|AAM43491.1| 30S ribosomal protein S21 [Xanthomonas campestris pv. campestris
          str. ATCC 33913]
 gi|66575519|gb|AAY50929.1| 30S ribosomal protein S21 [Xanthomonas campestris pv. campestris
          str. 8004]
 gi|78037977|emb|CAJ25722.1| 30S ribosomal protein S21 [Xanthomonas campestris pv. vesicatoria
          str. 85-10]
 gi|84369499|dbj|BAE70657.1| 30S ribosomal protein S21 [Xanthomonas oryzae pv. oryzae MAFF
          311018]
 gi|116247107|gb|ABJ90033.1| 30S ribosomal protein S21 [Xanthomonas oryzae pv. oryzae
          KACC10331]
 gi|167735157|emb|CAP53369.1| 30S ribosomal protein S21 [Xanthomonas campestris pv. campestris]
 gi|188519434|gb|ACD57379.1| ribosomal protein S21 [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|190010434|emb|CAQ44042.1| 30S ribosomal protein S21 [Stenotrophomonas maltophilia K279a]
 gi|194346908|gb|ACF50031.1| ribosomal protein S21 [Stenotrophomonas maltophilia R551-3]
 gi|219720205|gb|EED38730.1| ribosomal protein S21 [Stenotrophomonas sp. SKA14]
 gi|325535601|gb|EGD07448.1| SSU ribosomal protein S21P [Xanthomonas vesicatoria ATCC 35937]
 gi|325540814|gb|EGD12389.1| SSU ribosomal protein S21P [Xanthomonas perforans 91-118]
 gi|325548993|gb|EGD19922.1| SSU ribosomal protein S21P [Xanthomonas gardneri ATCC 19865]
          Length = 71

 Score = 41.8 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   E ALR  K+  +  GVL E + R  YEKP+Q+R R  + A++R  +  
Sbjct: 1  MPSVKVRENEPFEFALRRFKRTCEKAGVLAETRKREFYEKPTQERKRKAAAAVKRQLRRS 60

Query: 78 RKIAQRE 84
           +   + 
Sbjct: 61 SRDVTKR 67


>gi|254480973|ref|ZP_05094219.1| ribosomal protein S21 [marine gamma proteobacterium HTCC2148]
 gi|214038768|gb|EEB79429.1| ribosomal protein S21 [marine gamma proteobacterium HTCC2148]
          Length = 71

 Score = 41.8 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 33/60 (55%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   + ALR  K+  +  GVL E++ R HYEKP+  R R  + A++R  K + +  ++ 
Sbjct: 8  ENEPFDVALRRFKRSCEKAGVLAEVRKREHYEKPTTVRKRAGAAAVKRHLKKLSRENRKR 67


>gi|332969259|gb|EGK08287.1| 30S ribosomal protein S21 [Kingella kingae ATCC 23330]
          Length = 70

 Score = 41.8 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R +K +
Sbjct: 1  MPSIRVKENEPFEVAMRRFKRSIEKTGLLTELRAREAYEKPTTERKRKKAAAVKRLQKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|294787949|ref|ZP_06753193.1| ribosomal protein S21 [Simonsiella muelleri ATCC 29453]
 gi|294484242|gb|EFG31925.1| ribosomal protein S21 [Simonsiella muelleri ATCC 29453]
          Length = 70

 Score = 41.8 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R +K +
Sbjct: 1  MPAIRVKENEPFEVAMRRFKRAIEKTGLLTELRAREAYEKPTTERKRKKAAAVKRLQKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|307824739|ref|ZP_07654962.1| ribosomal protein S21 [Methylobacter tundripaludum SV96]
 gi|307734097|gb|EFO04951.1| ribosomal protein S21 [Methylobacter tundripaludum SV96]
          Length = 77

 Score = 41.8 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 19/64 (29%), Positives = 35/64 (54%), Gaps = 1/64 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +++N   + A+R  K+  +  GVL E++ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPSVKIKENEPFDIAIRRFKRACEKAGVLAEVRRREFYEKPTAERKRKGAAAVKRHLKKL 60

Query: 78 RKIA 81
           +  
Sbjct: 61 ARER 64


>gi|261393279|emb|CAX50905.1| 30S ribosomal protein S21 [Neisseria meningitidis 8013]
          Length = 70

 Score = 41.8 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 38/61 (62%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R +K +
Sbjct: 1  MPAIRVKENEPFEVAMRRFKRAVEKTGLLTELRTREAYEKPTTERKRKKAAAVKRLQKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|45657570|ref|YP_001656.1| 30S ribosomal protein S21 [Leptospira interrogans serovar
          Copenhageni str. Fiocruz L1-130]
 gi|116328270|ref|YP_797990.1| 30S ribosomal protein S21 [Leptospira borgpetersenii serovar
          Hardjo-bovis L550]
 gi|116330994|ref|YP_800712.1| 30S ribosomal protein S21 [Leptospira borgpetersenii serovar
          Hardjo-bovis JB197]
 gi|161484951|ref|NP_712410.2| 30S ribosomal protein S21 [Leptospira interrogans serovar Lai
          str. 56601]
 gi|61215972|sp|Q72RP1|RS21_LEPIC RecName: Full=30S ribosomal protein S21
 gi|61216062|sp|Q8F418|RS21_LEPIN RecName: Full=30S ribosomal protein S21
 gi|122281254|sp|Q04T16|RS21_LEPBJ RecName: Full=30S ribosomal protein S21
 gi|122283940|sp|Q051D8|RS21_LEPBL RecName: Full=30S ribosomal protein S21
 gi|45600809|gb|AAS70293.1| 30S ribosomal protein S21 [Leptospira interrogans serovar
          Copenhageni str. Fiocruz L1-130]
 gi|116121014|gb|ABJ79057.1| 30S Ribosomal protein S21 [Leptospira borgpetersenii serovar
          Hardjo-bovis L550]
 gi|116124683|gb|ABJ75954.1| 30S Ribosomal protein S21 [Leptospira borgpetersenii serovar
          Hardjo-bovis JB197]
 gi|293385909|gb|AAN49428.2| 30S ribosomal protein S21 [Leptospira interrogans serovar Lai
          str. 56601]
          Length = 69

 Score = 41.8 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 29/48 (60%), Gaps = 1/48 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
           V ++V+D   +E AL+  K+     G++ E+K R ++EKPS K+ + 
Sbjct: 1  MVGIIVKDGESIESALKRFKRDCANAGIMSEIKRREYFEKPSIKKKKA 48


>gi|94311545|ref|YP_584755.1| 30S ribosomal protein S21P [Cupriavidus metallidurans CH34]
 gi|119367222|sp|Q1LK40|RS212_RALME RecName: Full=30S ribosomal protein S21 2
 gi|93355397|gb|ABF09486.1| 30S ribosomal subunit protein S21 [Cupriavidus metallidurans
          CH34]
          Length = 70

 Score = 41.8 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 34/62 (54%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   E ALR  K+ ++  G+L EL+ R  YEKP+ +R R +  A++R+ K +R     +
Sbjct: 8  ENEPFEVALRRFKRTIEKNGLLPELRAREFYEKPTAERKRKRDAAVKRNYKRLRSQMLPK 67

Query: 85 GA 86
            
Sbjct: 68 KL 69


>gi|240255434|ref|NP_189267.4| unknown protein [Arabidopsis thaliana]
 gi|332643628|gb|AEE77149.1| Ribosomal protein S21 family protein [Arabidopsis thaliana]
          Length = 101

 Score = 41.8 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 12 SEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELK-MRGHYEKPSQKRVRLKSEAI 70
           + ++   + V V  N++++AL +L+KKMQ  G+ R +K  + H+ K S+K+V  +    
Sbjct: 19 QQLQQERGIRVKVFSNDLDKALTILQKKMQSSGMERLIKGTQTHHIKNSEKKVLARKNLE 78

Query: 71 RRSR 74
          RR +
Sbjct: 79 RRIK 82


>gi|285017228|ref|YP_003374939.1| 30s ribosomal protein s21 [Xanthomonas albilineans GPE PC73]
 gi|283472446|emb|CBA14951.1| probable 30s ribosomal protein s21 [Xanthomonas albilineans]
          Length = 71

 Score = 41.8 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   E ALR  K+  +  GVL E + R  YEKP+Q+R R  + A++R  +  
Sbjct: 1  MPSVKVRENEPFEFALRRFKRTCEKAGVLAETRKREFYEKPTQERKRKAAAAVKRQLRRT 60

Query: 78 RKIAQRE 84
           +   + 
Sbjct: 61 SRDVTKR 67


>gi|146319087|ref|YP_001198799.1| 30S ribosomal protein S21 [Streptococcus suis 05ZYH33]
 gi|146321292|ref|YP_001201003.1| 30S ribosomal protein S21 [Streptococcus suis 98HAH33]
 gi|145689893|gb|ABP90399.1| 30S Ribosomal protein S21 [Streptococcus suis 05ZYH33]
 gi|145692098|gb|ABP92603.1| 30S Ribosomal protein S21 [Streptococcus suis 98HAH33]
          Length = 83

 Score = 41.8 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 19/62 (30%), Positives = 33/62 (53%)

Query: 13 EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           G +  +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R      +R
Sbjct: 21 RGVKKMSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKRKSEAVRKR 80

Query: 73 SR 74
           +
Sbjct: 81 KK 82


>gi|15672222|ref|NP_266396.1| 30S ribosomal protein S21 [Lactococcus lactis subsp. lactis
          Il1403]
 gi|116511070|ref|YP_808286.1| 30S ribosomal protein S21 [Lactococcus lactis subsp. cremoris
          SK11]
 gi|125623127|ref|YP_001031610.1| 30S ribosomal protein S21 [Lactococcus lactis subsp. cremoris
          MG1363]
 gi|281490726|ref|YP_003352706.1| 50S ribosomal protein S21P [Lactococcus lactis subsp. lactis
          KF147]
 gi|13959513|sp|Q9CIW6|RS21_LACLA RecName: Full=30S ribosomal protein S21
 gi|123025641|sp|Q032K8|RS21_LACLS RecName: Full=30S ribosomal protein S21
 gi|166224037|sp|A2RHW9|RS21_LACLM RecName: Full=30S ribosomal protein S21
 gi|12723098|gb|AAK04338.1|AE006261_9 30S ribosomal protein S21 [Lactococcus lactis subsp. lactis
          Il1403]
 gi|116106724|gb|ABJ71864.1| SSU ribosomal protein S21P [Lactococcus lactis subsp. cremoris
          SK11]
 gi|124491935|emb|CAL96857.1| 30S ribosomal protein S21 [Lactococcus lactis subsp. cremoris
          MG1363]
 gi|281374495|gb|ADA64016.1| SSU ribosomal protein S21P [Lactococcus lactis subsp. lactis
          KF147]
 gi|300069874|gb|ADJ59274.1| 30S ribosomal protein S21 [Lactococcus lactis subsp. cremoris
          NZ9000]
 gi|326405818|gb|ADZ62889.1| 30S ribosomal protein S21 [Lactococcus lactis subsp. lactis CV56]
          Length = 58

 Score = 41.8 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 34/57 (59%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           +  ++ ++ +++ ALR  K+ +   G L+EL+ R HYEKPS KR R    A +R +
Sbjct: 1  MSKTLVRKNESLDDALRRFKRSVTKAGTLQELRKREHYEKPSVKRKRKSEAARKRKK 57


>gi|261868197|ref|YP_003256119.1| 30S ribosomal protein S21 [Aggregatibacter actinomycetemcomitans
          D11S-1]
 gi|293391711|ref|ZP_06636045.1| 30S ribosomal protein S21 [Aggregatibacter actinomycetemcomitans
          D7S-1]
 gi|261413529|gb|ACX82900.1| 30S ribosomal protein S21 [Aggregatibacter actinomycetemcomitans
          D11S-1]
 gi|290952245|gb|EFE02364.1| 30S ribosomal protein S21 [Aggregatibacter actinomycetemcomitans
          D7S-1]
          Length = 71

 Score = 41.8 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R  +   +R  K +
Sbjct: 1  MPVIKVRENESFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIRKRENATRAKRHAKRL 60

Query: 78 RKIAQR 83
           +   R
Sbjct: 61 ARENAR 66


>gi|161611283|ref|YP_139909.2| 30S ribosomal protein S21 [Streptococcus thermophilus LMG 18311]
 gi|161936366|ref|YP_141836.2| 30S ribosomal protein S21 [Streptococcus thermophilus CNRZ1066]
 gi|119367327|sp|Q5LYS8|RS21_STRT1 RecName: Full=30S ribosomal protein S21
 gi|119367328|sp|Q5M3E1|RS21_STRT2 RecName: Full=30S ribosomal protein S21
          Length = 58

 Score = 41.8 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 33/57 (57%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           +  V+ ++ +++ ALR  K+ +   G L+E + R HYEKPS KR R    A +R +
Sbjct: 1  MSKIVVRKNESLDDALRRFKRSVTKAGTLQEARKREHYEKPSVKRKRKSEAARKRKK 57


>gi|116492871|ref|YP_804606.1| 30S ribosomal protein S21 [Pediococcus pentosaceus ATCC 25745]
 gi|270291322|ref|ZP_06197544.1| 30S ribosomal protein S21 [Pediococcus acidilactici 7_4]
 gi|304385072|ref|ZP_07367418.1| 30S ribosomal protein S21 [Pediococcus acidilactici DSM 20284]
 gi|122265665|sp|Q03F58|RS21_PEDPA RecName: Full=30S ribosomal protein S21
 gi|116103021|gb|ABJ68164.1| SSU ribosomal protein S21P [Pediococcus pentosaceus ATCC 25745]
 gi|270280168|gb|EFA26004.1| 30S ribosomal protein S21 [Pediococcus acidilactici 7_4]
 gi|304329266|gb|EFL96486.1| 30S ribosomal protein S21 [Pediococcus acidilactici DSM 20284]
          Length = 61

 Score = 41.8 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 31/60 (51%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR      A +R  K  
Sbjct: 1  MSKTVVRKNESLDDALRRFKRTVSKSGTLQEYRKREFYEKPSVKRKLKSEAARKRKNKKR 60


>gi|116628189|ref|YP_820808.1| 30S ribosomal protein S21 [Streptococcus thermophilus LMD-9]
 gi|122267215|sp|Q03JL0|RS21_STRTD RecName: Full=30S ribosomal protein S21
 gi|116101466|gb|ABJ66612.1| SSU ribosomal protein S21P [Streptococcus thermophilus LMD-9]
 gi|312278804|gb|ADQ63461.1| 30S ribosomal protein S21 [Streptococcus thermophilus ND03]
          Length = 58

 Score = 41.8 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 33/57 (57%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           +  V+ ++ +++ ALR  K+ +   G L+E + R HYEKPS KR R    A +R +
Sbjct: 1  MSKVVVRKNESLDDALRRFKRSVTKAGTLQEARKREHYEKPSVKRKRKSEAARKRKK 57


>gi|152978399|ref|YP_001344028.1| 30S ribosomal protein S21 [Actinobacillus succinogenes 130Z]
 gi|251793984|ref|YP_003008716.1| 30S ribosomal protein S21 [Aggregatibacter aphrophilus NJ8700]
 gi|315634865|ref|ZP_07890147.1| 30S ribosomal protein S21 [Aggregatibacter segnis ATCC 33393]
 gi|171704229|sp|A6VM96|RS21_ACTSZ RecName: Full=30S ribosomal protein S21
 gi|150840122|gb|ABR74093.1| ribosomal protein S21 [Actinobacillus succinogenes 130Z]
 gi|247535383|gb|ACS98629.1| ribosomal protein S21 [Aggregatibacter aphrophilus NJ8700]
 gi|315476417|gb|EFU67167.1| 30S ribosomal protein S21 [Aggregatibacter segnis ATCC 33393]
          Length = 71

 Score = 41.8 bits (97), Expect = 0.032,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R  +   +R  K +
Sbjct: 1  MPVIKVRENESFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIRKRENATRAKRHAKRV 60

Query: 78 RKIAQR 83
           +   R
Sbjct: 61 ARENAR 66


>gi|78486150|ref|YP_392075.1| ribosomal protein S21 [Thiomicrospira crunogena XCL-2]
 gi|119367337|sp|Q31EM2|RS21_THICR RecName: Full=30S ribosomal protein S21
 gi|78364436|gb|ABB42401.1| SSU ribosomal protein S21P [Thiomicrospira crunogena XCL-2]
          Length = 71

 Score = 41.8 bits (97), Expect = 0.033,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VRD    + ALR  K+  +  GVL E + R  YEKP+  R R+K+ A++R  K +
Sbjct: 1  MPSVKVRDTEPFDVALRRFKRACEKAGVLTESRKREFYEKPTWARKRMKAAAVKRLAKRL 60

Query: 78 RKIAQR 83
           +  +R
Sbjct: 61 SRENRR 66


>gi|15903314|ref|NP_358864.1| 30S ribosomal protein S21 [Streptococcus pneumoniae R6]
 gi|182684372|ref|YP_001836119.1| ribosomal protein S21 [Streptococcus pneumoniae CGSP14]
 gi|307068067|ref|YP_003877033.1| hypothetical protein SPAP_1445 [Streptococcus pneumoniae AP200]
 gi|15458911|gb|AAL00075.1| 30S Ribosomal protein S21 [Streptococcus pneumoniae R6]
 gi|182629706|gb|ACB90654.1| ribosomal protein S21 [Streptococcus pneumoniae CGSP14]
 gi|306409604|gb|ADM85031.1| hypothetical protein SPAP_1445 [Streptococcus pneumoniae AP200]
          Length = 66

 Score = 41.8 bits (97), Expect = 0.033,   Method: Composition-based stats.
 Identities = 20/62 (32%), Positives = 35/62 (56%)

Query: 13 EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          +G +  +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A +R
Sbjct: 4  KGVKKMSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKRKSEVARKR 63

Query: 73 SR 74
           +
Sbjct: 64 KK 65


>gi|302798651|ref|XP_002981085.1| hypothetical protein SELMODRAFT_444781 [Selaginella
          moellendorffii]
 gi|300151139|gb|EFJ17786.1| hypothetical protein SELMODRAFT_444781 [Selaginella
          moellendorffii]
          Length = 410

 Score = 41.8 bits (97), Expect = 0.033,   Method: Composition-based stats.
 Identities = 14/64 (21%), Positives = 32/64 (50%), Gaps = 2/64 (3%)

Query: 33 LRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL--MRKIAQREGAPVSR 90
          +    +KM+ +  L +L  + +Y KPS++R + + E ++R++K     K+         +
Sbjct: 1  MARYGRKMRQDKTLNDLLKKEYYVKPSEQRRQAEKERVKRTKKRLFREKLKFVLMLRARK 60

Query: 91 LRQH 94
           R+ 
Sbjct: 61 SRRP 64


>gi|153003630|ref|YP_001377955.1| 30S ribosomal protein S21 [Anaeromyxobacter sp. Fw109-5]
 gi|166224008|sp|A7H8C5|RS21_ANADF RecName: Full=30S ribosomal protein S21
 gi|152027203|gb|ABS24971.1| ribosomal protein S21 [Anaeromyxobacter sp. Fw109-5]
          Length = 64

 Score = 41.8 bits (97), Expect = 0.035,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 25/43 (58%), Gaps = 1/43 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
             V V+D    E A++  KK+ +  G+L E++ R HYEKPS 
Sbjct: 1  MTGVRVKDGESFENAMKRFKKQCEKAGILSEIRKREHYEKPSV 43


>gi|328947539|ref|YP_004364876.1| 30S ribosomal protein S21 [Treponema succinifaciens DSM 2489]
 gi|328447863|gb|AEB13579.1| 30S ribosomal protein S21 [Treponema succinifaciens DSM 2489]
          Length = 70

 Score = 41.8 bits (97), Expect = 0.035,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           + N+E+A++  K+ ++ EG++RE K R +YEKPS    R      R+  K   K
Sbjct: 8  ENENLEKAIKRFKRMVEKEGIIREYKKREYYEKPSTILNRKNKSLARKLLKKNHK 62


>gi|15603104|ref|NP_246176.1| 30S ribosomal protein S21 [Pasteurella multocida subsp. multocida
          str. Pm70]
 gi|52425817|ref|YP_088954.1| 30S ribosomal protein S21 [Mannheimia succiniciproducens MBEL55E]
 gi|113461380|ref|YP_719449.1| 30S ribosomal protein S21 [Haemophilus somnus 129PT]
 gi|170719014|ref|YP_001784173.1| 30S ribosomal protein S21 [Haemophilus somnus 2336]
 gi|260912698|ref|ZP_05919184.1| 30S ribosomal protein S21 [Pasteurella dagmatis ATCC 43325]
 gi|13959514|sp|Q9CLJ0|RS21_PASMU RecName: Full=30S ribosomal protein S21
 gi|81691331|sp|Q65RP1|RS21_MANSM RecName: Full=30S ribosomal protein S21
 gi|119367261|sp|Q0I4Z6|RS21_HAES1 RecName: Full=30S ribosomal protein S21
 gi|189044904|sp|B0USS4|RS21_HAES2 RecName: Full=30S ribosomal protein S21
 gi|12721595|gb|AAK03323.1| RpS21 [Pasteurella multocida subsp. multocida str. Pm70]
 gi|52307869|gb|AAU38369.1| RpsU protein [Mannheimia succiniciproducens MBEL55E]
 gi|112823423|gb|ABI25512.1| SSU ribosomal protein S21P [Haemophilus somnus 129PT]
 gi|168827143|gb|ACA32514.1| ribosomal protein S21 [Haemophilus somnus 2336]
 gi|260633076|gb|EEX51241.1| 30S ribosomal protein S21 [Pasteurella dagmatis ATCC 43325]
          Length = 71

 Score = 41.8 bits (97), Expect = 0.036,   Method: Composition-based stats.
 Identities = 20/66 (30%), Positives = 33/66 (50%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+  R R  +   +R  K +
Sbjct: 1  MPVIKVRENESFDVALRRFKRSCEKAGILAEVRSREFYEKPTTIRKRENATRAKRHAKRV 60

Query: 78 RKIAQR 83
           +   R
Sbjct: 61 ARENAR 66


>gi|331270006|ref|YP_004396498.1| 30S ribosomal protein S21 [Clostridium botulinum BKT015925]
 gi|329126556|gb|AEB76501.1| ribosomal protein S21 [Clostridium botulinum BKT015925]
          Length = 60

 Score = 41.4 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VRDN  +E AL+  K+     GVL E++ R HYEKPS KR +    A RR  K+ 
Sbjct: 1  MSEVKVRDNESLESALKRFKRSCAKAGVLSEVRKREHYEKPSVKRKKKSEAARRRKTKVR 60


>gi|118443087|ref|YP_878560.1| ribosomal protein S21 [Clostridium novyi NT]
 gi|168187869|ref|ZP_02622504.1| ribosomal protein S21 [Clostridium botulinum C str. Eklund]
 gi|253682448|ref|ZP_04863245.1| ribosomal protein S21 [Clostridium botulinum D str. 1873]
 gi|166224026|sp|A0Q1Q8|RS21_CLONN RecName: Full=30S ribosomal protein S21
 gi|118133543|gb|ABK60587.1| ribosomal protein S21 [Clostridium novyi NT]
 gi|169294274|gb|EDS76407.1| ribosomal protein S21 [Clostridium botulinum C str. Eklund]
 gi|253562160|gb|EES91612.1| ribosomal protein S21 [Clostridium botulinum D str. 1873]
          Length = 60

 Score = 41.4 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 26/60 (43%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VRDN  +E AL+  K+     GVL E++ R HYEKPS KR +    A RR  K+ 
Sbjct: 1  MSEVKVRDNESLESALKRFKRSCAKAGVLSEVRKREHYEKPSVKRKKKSEAARRRKSKVR 60


>gi|329119122|ref|ZP_08247813.1| 30S ribosomal protein S21 [Neisseria bacilliformis ATCC BAA-1200]
 gi|327464753|gb|EGF11047.1| 30S ribosomal protein S21 [Neisseria bacilliformis ATCC BAA-1200]
          Length = 92

 Score = 41.4 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 23/74 (31%), Positives = 41/74 (55%), Gaps = 1/74 (1%)

Query: 6  AFRGIFSEGREISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVR 64
           F    ++ +      + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R
Sbjct: 10 PFSDGLNKFKGNKMPTIKVKENEPFEVAMRRFKRAIEKTGLLTELRAREAYEKPTTERKR 69

Query: 65 LKSEAIRRSRKLMR 78
           K+ A +R +K +R
Sbjct: 70 KKAAAAKRLQKRLR 83


>gi|90961677|ref|YP_535593.1| 30S ribosomal protein S21 [Lactobacillus salivarius UCC118]
 gi|227890765|ref|ZP_04008570.1| 30S ribosomal protein S21 [Lactobacillus salivarius ATCC 11741]
 gi|301300756|ref|ZP_07206940.1| ribosomal protein S21 [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|323340789|ref|ZP_08081041.1| 30S ribosomal protein S21 [Lactobacillus ruminis ATCC 25644]
 gi|119367267|sp|Q1WU25|RS21_LACS1 RecName: Full=30S ribosomal protein S21
 gi|90820871|gb|ABD99510.1| SSU ribosomal protein S21P [Lactobacillus salivarius UCC118]
 gi|227867174|gb|EEJ74595.1| 30S ribosomal protein S21 [Lactobacillus salivarius ATCC 11741]
 gi|300851606|gb|EFK79306.1| ribosomal protein S21 [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|323091912|gb|EFZ34532.1| 30S ribosomal protein S21 [Lactobacillus ruminis ATCC 25644]
          Length = 61

 Score = 41.4 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 32/60 (53%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR +    A +R  K  
Sbjct: 1  MSKTVVRKNESLDDALRRFKRSVSKTGTLQEYRKREFYEKPSVKRKKKSEAARKRKNKRR 60


>gi|317051091|ref|YP_004112207.1| 30S ribosomal protein S21 [Desulfurispirillum indicum S5]
 gi|316946175|gb|ADU65651.1| ribosomal protein S21 [Desulfurispirillum indicum S5]
          Length = 70

 Score = 41.4 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 26/65 (40%), Positives = 41/65 (63%)

Query: 21 YVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
          YV V    V  AL+  K+K++ EG++RE+K    YEKP++ R R K +A R+  KL+ K+
Sbjct: 6  YVRVDGEEVNDALKAFKRKVEREGLIREMKKYTFYEKPTEARRRKKLKAKRKQLKLLNKM 65

Query: 81 AQREG 85
           + +G
Sbjct: 66 RRLQG 70


>gi|118497508|ref|YP_898558.1| 30S ribosomal protein S21 [Francisella tularensis subsp. novicida
          U112]
 gi|195536202|ref|ZP_03079209.1| ribosomal protein S21 [Francisella tularensis subsp. novicida
          FTE]
 gi|208779307|ref|ZP_03246653.1| ribosomal protein S21 [Francisella novicida FTG]
 gi|254372873|ref|ZP_04988362.1| 30S ribosomal protein S21 [Francisella tularensis subsp. novicida
          GA99-3549]
 gi|254374328|ref|ZP_04989810.1| 30S ribosomal protein S21 [Francisella novicida GA99-3548]
 gi|118423414|gb|ABK89804.1| 30S ribosomal protein S21 [Francisella novicida U112]
 gi|151570600|gb|EDN36254.1| 30S ribosomal protein S21 [Francisella novicida GA99-3549]
 gi|151572048|gb|EDN37702.1| 30S ribosomal protein S21 [Francisella novicida GA99-3548]
 gi|194372679|gb|EDX27390.1| ribosomal protein S21 [Francisella tularensis subsp. novicida
          FTE]
 gi|208745107|gb|EDZ91405.1| ribosomal protein S21 [Francisella novicida FTG]
 gi|328676043|gb|AEB28718.1| SSU ribosomal protein S21p [Francisella cf. novicida 3523]
 gi|332678204|gb|AEE87333.1| SSU ribosomal protein S21p [Francisella cf. novicida Fx1]
          Length = 65

 Score = 41.4 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 30/47 (63%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + ALR  K+  +  G++ EL+ R ++EKP+  R R K+ A++R+ K
Sbjct: 12 FDVALRRFKRSCEKAGIVSELRRREYFEKPTWARKRKKAAAVKRAHK 58


>gi|15924565|ref|NP_372099.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          Mu50]
 gi|15927155|ref|NP_374688.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          N315]
 gi|21283256|ref|NP_646344.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          MW2]
 gi|27468180|ref|NP_764817.1| 30S ribosomal protein S21 [Staphylococcus epidermidis ATCC 12228]
 gi|49483823|ref|YP_041047.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          MRSA252]
 gi|49486410|ref|YP_043631.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          MSSA476]
 gi|57651968|ref|YP_186472.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          COL]
 gi|57867025|ref|YP_188719.1| 30S ribosomal protein S21 [Staphylococcus epidermidis RP62A]
 gi|70726342|ref|YP_253256.1| 30S ribosomal protein S21 [Staphylococcus haemolyticus JCSC1435]
 gi|82751178|ref|YP_416919.1| 30S ribosomal protein S21 [Staphylococcus aureus RF122]
 gi|87162355|ref|YP_494230.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          USA300_FPR3757]
 gi|88195384|ref|YP_500188.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          NCTC 8325]
 gi|148268059|ref|YP_001247002.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          JH9]
 gi|150394127|ref|YP_001316802.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          JH1]
 gi|151221690|ref|YP_001332512.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          str. Newman]
 gi|156979893|ref|YP_001442152.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          Mu3]
 gi|161509803|ref|YP_001575462.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          USA300_TCH1516]
 gi|221140005|ref|ZP_03564498.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          str. JKD6009]
 gi|223044375|ref|ZP_03614409.1| ribosomal protein S21 [Staphylococcus capitis SK14]
 gi|224476683|ref|YP_002634289.1| 30S ribosomal protein S21 [Staphylococcus carnosus subsp.
          carnosus TM300]
 gi|239637613|ref|ZP_04678585.1| ribosomal protein S21 [Staphylococcus warneri L37603]
 gi|242242850|ref|ZP_04797295.1| 30S ribosomal protein S21 [Staphylococcus epidermidis W23144]
 gi|242373880|ref|ZP_04819454.1| 30S ribosomal protein S21 [Staphylococcus epidermidis M23864:W1]
 gi|251810992|ref|ZP_04825465.1| 30S ribosomal protein S21 [Staphylococcus epidermidis
          BCM-HMP0060]
 gi|253316050|ref|ZP_04839263.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          str. CF-Marseille]
 gi|253732228|ref|ZP_04866393.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          USA300_TCH959]
 gi|253733174|ref|ZP_04867339.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          TCH130]
 gi|255006361|ref|ZP_05144962.2| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          Mu50-omega]
 gi|258420147|ref|ZP_05683102.1| SSU ribosomal protein S21 [Staphylococcus aureus A9719]
 gi|262049148|ref|ZP_06022025.1| 30S ribosomal protein S21 [Staphylococcus aureus D30]
 gi|262051235|ref|ZP_06023459.1| 30S ribosomal protein S21 [Staphylococcus aureus 930918-3]
 gi|269203203|ref|YP_003282472.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          ED98]
 gi|282875999|ref|ZP_06284866.1| ribosomal protein S21 [Staphylococcus epidermidis SK135]
 gi|284024634|ref|ZP_06379032.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          132]
 gi|289550654|ref|YP_003471558.1| SSU ribosomal protein S21p [Staphylococcus lugdunensis HKU09-01]
 gi|293366464|ref|ZP_06613141.1| 30S ribosomal protein S21 [Staphylococcus epidermidis
          M23864:W2(grey)]
 gi|294848606|ref|ZP_06789352.1| 30S ribosomal protein S21 [Staphylococcus aureus A9754]
 gi|295406698|ref|ZP_06816503.1| 30S ribosomal protein S21 [Staphylococcus aureus A8819]
 gi|295428153|ref|ZP_06820785.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          EMRSA16]
 gi|296275803|ref|ZP_06858310.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          MR1]
 gi|297207706|ref|ZP_06924141.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          ATCC 51811]
 gi|297245720|ref|ZP_06929585.1| 30S ribosomal protein S21 [Staphylococcus aureus A8796]
 gi|297590881|ref|ZP_06949519.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          MN8]
 gi|300911787|ref|ZP_07129230.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          TCH70]
 gi|304380836|ref|ZP_07363496.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          ATCC BAA-39]
 gi|314933748|ref|ZP_07841113.1| ribosomal protein S21 [Staphylococcus caprae C87]
 gi|54039479|sp|P66521|RS21_STAAN RecName: Full=30S ribosomal protein S21
 gi|54039480|sp|P66522|RS21_STAAW RecName: Full=30S ribosomal protein S21
 gi|54039481|sp|P66523|RS21_STAES RecName: Full=30S ribosomal protein S21
 gi|54042170|sp|P66520|RS21_STAAM RecName: Full=30S ribosomal protein S21
 gi|56749513|sp|Q6G8Z2|RS21_STAAS RecName: Full=30S ribosomal protein S21
 gi|56749560|sp|Q6GGC5|RS21_STAAR RecName: Full=30S ribosomal protein S21
 gi|73917928|sp|Q5HFI5|RS21_STAAC RecName: Full=30S ribosomal protein S21
 gi|73917929|sp|Q5HNX1|RS21_STAEQ RecName: Full=30S ribosomal protein S21
 gi|119367316|sp|Q2FGE8|RS21_STAA3 RecName: Full=30S ribosomal protein S21
 gi|119367317|sp|Q2FXZ7|RS21_STAA8 RecName: Full=30S ribosomal protein S21
 gi|119367318|sp|Q2YT04|RS21_STAAB RecName: Full=30S ribosomal protein S21
 gi|119367319|sp|Q4L6S5|RS21_STAHJ RecName: Full=30S ribosomal protein S21
 gi|166225199|sp|A7X2X5|RS21_STAA1 RecName: Full=30S ribosomal protein S21
 gi|172048909|sp|A6QHB8|RS21_STAAE RecName: Full=30S ribosomal protein S21
 gi|189044917|sp|A6U247|RS21_STAA2 RecName: Full=30S ribosomal protein S21
 gi|189044918|sp|A5ITA3|RS21_STAA9 RecName: Full=30S ribosomal protein S21
 gi|189044919|sp|A8Z4B4|RS21_STAAT RecName: Full=30S ribosomal protein S21
 gi|254807394|sp|B9DNM1|RS21_STACT RecName: Full=30S ribosomal protein S21
 gi|27315726|gb|AAO04861.1|AE016748_95 30S ribosomal protein S21 [Staphylococcus epidermidis ATCC 12228]
 gi|13701373|dbj|BAB42667.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          N315]
 gi|14247346|dbj|BAB57737.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          Mu50]
 gi|21204696|dbj|BAB95392.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          MW2]
 gi|49241952|emb|CAG40647.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          MRSA252]
 gi|49244853|emb|CAG43314.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          MSSA476]
 gi|57286154|gb|AAW38248.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus COL]
 gi|57637683|gb|AAW54471.1| ribosomal protein S21 [Staphylococcus epidermidis RP62A]
 gi|68447066|dbj|BAE04650.1| 30S ribosomal protein S21 [Staphylococcus haemolyticus JCSC1435]
 gi|82656709|emb|CAI81136.1| 30S ribosomal protein S21 [Staphylococcus aureus RF122]
 gi|87128329|gb|ABD22843.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          USA300_FPR3757]
 gi|87202942|gb|ABD30752.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus NCTC
          8325]
 gi|147741128|gb|ABQ49426.1| SSU ribosomal protein S21P [Staphylococcus aureus subsp. aureus
          JH9]
 gi|149946579|gb|ABR52515.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus JH1]
 gi|150374490|dbj|BAF67750.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          str. Newman]
 gi|156722028|dbj|BAF78445.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          Mu3]
 gi|160368612|gb|ABX29583.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          USA300_TCH1516]
 gi|222421290|emb|CAL28104.1| 30S ribosomal protein S21 [Staphylococcus carnosus subsp.
          carnosus TM300]
 gi|222442244|gb|EEE48355.1| ribosomal protein S21 [Staphylococcus capitis SK14]
 gi|239596831|gb|EEQ79356.1| ribosomal protein S21 [Staphylococcus warneri L37603]
 gi|242233692|gb|EES36004.1| 30S ribosomal protein S21 [Staphylococcus epidermidis W23144]
 gi|242348434|gb|EES40036.1| 30S ribosomal protein S21 [Staphylococcus epidermidis M23864:W1]
 gi|251805502|gb|EES58159.1| 30S ribosomal protein S21 [Staphylococcus epidermidis
          BCM-HMP0060]
 gi|253724017|gb|EES92746.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          USA300_TCH959]
 gi|253728714|gb|EES97443.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          TCH130]
 gi|257843858|gb|EEV68252.1| SSU ribosomal protein S21 [Staphylococcus aureus A9719]
 gi|259160872|gb|EEW45892.1| 30S ribosomal protein S21 [Staphylococcus aureus 930918-3]
 gi|259162817|gb|EEW47382.1| 30S ribosomal protein S21 [Staphylococcus aureus D30]
 gi|262075493|gb|ACY11466.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          ED98]
 gi|269941065|emb|CBI49449.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          TW20]
 gi|281295024|gb|EFA87551.1| ribosomal protein S21 [Staphylococcus epidermidis SK135]
 gi|283470854|emb|CAQ50065.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus ST398]
 gi|285817257|gb|ADC37744.1| 30S ribosomal protein S21 [Staphylococcus aureus 04-02981]
 gi|289180186|gb|ADC87431.1| SSU ribosomal protein S21p [Staphylococcus lugdunensis HKU09-01]
 gi|291319233|gb|EFE59602.1| 30S ribosomal protein S21 [Staphylococcus epidermidis
          M23864:W2(grey)]
 gi|294824632|gb|EFG41055.1| 30S ribosomal protein S21 [Staphylococcus aureus A9754]
 gi|294968445|gb|EFG44469.1| 30S ribosomal protein S21 [Staphylococcus aureus A8819]
 gi|295128511|gb|EFG58145.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          EMRSA16]
 gi|296887723|gb|EFH26621.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          ATCC 51811]
 gi|297177371|gb|EFH36623.1| 30S ribosomal protein S21 [Staphylococcus aureus A8796]
 gi|297575767|gb|EFH94483.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          MN8]
 gi|298694857|gb|ADI98079.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          ED133]
 gi|300886033|gb|EFK81235.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          TCH70]
 gi|302333251|gb|ADL23444.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          JKD6159]
 gi|302751405|gb|ADL65582.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          str. JKD6008]
 gi|304340563|gb|EFM06497.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          ATCC BAA-39]
 gi|312437956|gb|ADQ77027.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          TCH60]
 gi|312829963|emb|CBX34805.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus ECT-R
          2]
 gi|313653898|gb|EFS17655.1| ribosomal protein S21 [Staphylococcus caprae C87]
 gi|315129854|gb|EFT85844.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          CGS03]
 gi|315195478|gb|EFU25865.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          CGS00]
 gi|315198729|gb|EFU29057.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          CGS01]
 gi|319400911|gb|EFV89130.1| ribosomal protein S21 [Staphylococcus epidermidis FRI909]
 gi|320140540|gb|EFW32394.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          MRSA131]
 gi|320144077|gb|EFW35846.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          MRSA177]
 gi|323440473|gb|EGA98185.1| 30S ribosomal protein S21 [Staphylococcus aureus O11]
 gi|323443247|gb|EGB00865.1| 30S ribosomal protein S21 [Staphylococcus aureus O46]
 gi|329314251|gb|AEB88664.1| 30S ribosomal protein S21 [Staphylococcus aureus subsp. aureus
          T0131]
 gi|329725439|gb|EGG61922.1| ribosomal protein S21 [Staphylococcus epidermidis VCU144]
 gi|329727656|gb|EGG64112.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus 21172]
 gi|329728422|gb|EGG64859.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus 21189]
 gi|329733246|gb|EGG69583.1| ribosomal protein S21 [Staphylococcus aureus subsp. aureus 21193]
 gi|329735201|gb|EGG71493.1| ribosomal protein S21 [Staphylococcus epidermidis VCU045]
 gi|329737462|gb|EGG73716.1| ribosomal protein S21 [Staphylococcus epidermidis VCU028]
 gi|330686121|gb|EGG97742.1| ribosomal protein S21 [Staphylococcus epidermidis VCU121]
          Length = 58

 Score = 41.4 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 33/58 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           +  V+ ++ ++E ALR  K+ +   G ++E++ R  YEKPS KR +    A +R  K
Sbjct: 1  MSKTVVRKNESLEDALRRFKRSVSKSGTIQEVRKREFYEKPSVKRKKKSEAARKRKFK 58


>gi|237746703|ref|ZP_04577183.1| small subunit ribosomal protein S21 [Oxalobacter formigenes
          HOxBLS]
 gi|237748839|ref|ZP_04579319.1| small subunit ribosomal protein S21 [Oxalobacter formigenes
          OXCC13]
 gi|229378054|gb|EEO28145.1| small subunit ribosomal protein S21 [Oxalobacter formigenes
          HOxBLS]
 gi|229380201|gb|EEO30292.1| small subunit ribosomal protein S21 [Oxalobacter formigenes
          OXCC13]
          Length = 70

 Score = 41.4 bits (96), Expect = 0.041,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 32/54 (59%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           +   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R  + A++R  K +R
Sbjct: 8  ENEPFEVAMRRFKRTIEKTGLLTELRAREFYEKPTAERKRKLAAAVKRHYKRIR 61


>gi|167627927|ref|YP_001678427.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|241668479|ref|ZP_04756057.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|254877013|ref|ZP_05249723.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|167597928|gb|ABZ87926.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|254843034|gb|EET21448.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
          Length = 65

 Score = 41.4 bits (96), Expect = 0.042,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 30/47 (63%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + ALR  K+  +  G++ EL+ R ++EKP+  R R K+ A++R+ K
Sbjct: 12 FDVALRRFKRSCEKAGIVSELRRREYFEKPTWARKRKKAAAVKRAYK 58


>gi|256847121|ref|ZP_05552567.1| ribosomal protein S21 [Lactobacillus coleohominis 101-4-CHN]
 gi|256715785|gb|EEU30760.1| ribosomal protein S21 [Lactobacillus coleohominis 101-4-CHN]
          Length = 61

 Score = 41.4 bits (96), Expect = 0.043,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 31/60 (51%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR      A +R  K  
Sbjct: 1  MSKTVVRKNESLDDALRRFKRTVSRNGTLQEYRKREFYEKPSVKRKLKSEAARKRKNKRR 60


>gi|91202946|emb|CAJ72585.1| similar to ribosomal protein S21 [Candidatus Kuenenia
          stuttgartiensis]
          Length = 82

 Score = 41.4 bits (96), Expect = 0.043,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
          D N+  ALR  KK    EG++ + K   ++EKPS+K+ R +S  I+  ++  +
Sbjct: 9  DENIRDALRRFKKMCDKEGIINQSKRIAYFEKPSEKKRREESRRIKNIKRAQK 61


>gi|15894570|ref|NP_347919.1| 30S ribosomal protein S21 [Clostridium acetobutylicum ATCC 824]
 gi|20978718|sp|Q97JJ2|RS21_CLOAB RecName: Full=30S ribosomal protein S21
 gi|15024217|gb|AAK79259.1|AE007641_5 Ribosomal protein S21 [Clostridium acetobutylicum ATCC 824]
 gi|325508702|gb|ADZ20338.1| 30S ribosomal protein S21 [Clostridium acetobutylicum EA 2018]
          Length = 58

 Score = 41.4 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 30/51 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + ++E ALR  K+K    GVL E++ R HYEKPS KR +    A +R  K
Sbjct: 8  ENESLESALRRFKRKCARAGVLSEVRKREHYEKPSVKRKKKSEAARKRKFK 58


>gi|238019338|ref|ZP_04599764.1| hypothetical protein VEIDISOL_01202 [Veillonella dispar ATCC
          17748]
 gi|269797949|ref|YP_003311849.1| ribosomal protein S21 [Veillonella parvula DSM 2008]
 gi|282850178|ref|ZP_06259557.1| ribosomal protein S21 [Veillonella parvula ATCC 17745]
 gi|294791830|ref|ZP_06756978.1| ribosomal protein S21 [Veillonella sp. 6_1_27]
 gi|294793691|ref|ZP_06758828.1| ribosomal protein S21 [Veillonella sp. 3_1_44]
 gi|303228789|ref|ZP_07315603.1| ribosomal protein S21 [Veillonella atypica ACS-134-V-Col7a]
 gi|303232020|ref|ZP_07318723.1| ribosomal protein S21 [Veillonella atypica ACS-049-V-Sch6]
 gi|313893375|ref|ZP_07826947.1| ribosomal protein S21 [Veillonella sp. oral taxon 158 str. F0412]
 gi|237864037|gb|EEP65327.1| hypothetical protein VEIDISOL_01202 [Veillonella dispar ATCC
          17748]
 gi|269094578|gb|ACZ24569.1| ribosomal protein S21 [Veillonella parvula DSM 2008]
 gi|282579671|gb|EFB85075.1| ribosomal protein S21 [Veillonella parvula ATCC 17745]
 gi|294455261|gb|EFG23633.1| ribosomal protein S21 [Veillonella sp. 3_1_44]
 gi|294457060|gb|EFG25422.1| ribosomal protein S21 [Veillonella sp. 6_1_27]
 gi|302513126|gb|EFL55165.1| ribosomal protein S21 [Veillonella atypica ACS-049-V-Sch6]
 gi|302516501|gb|EFL58429.1| ribosomal protein S21 [Veillonella atypica ACS-134-V-Col7a]
 gi|313442016|gb|EFR60436.1| ribosomal protein S21 [Veillonella sp. oral taxon 158 str. F0412]
          Length = 59

 Score = 41.4 bits (96), Expect = 0.045,   Method: Composition-based stats.
 Identities = 21/48 (43%), Positives = 29/48 (60%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++  +E ALR  K+  Q  GVL E++ R HYEKPS KR +    A +R
Sbjct: 8  KNETLESALRRFKRSCQKAGVLSEVRKREHYEKPSVKRKKKSEAARKR 55


>gi|225027031|ref|ZP_03716223.1| hypothetical protein EUBHAL_01287 [Eubacterium hallii DSM 3353]
 gi|224955495|gb|EEG36704.1| hypothetical protein EUBHAL_01287 [Eubacterium hallii DSM 3353]
          Length = 58

 Score = 41.4 bits (96), Expect = 0.046,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + +++ ALR  K+     G+ +E++ R HYEKPS KR +    A +R  K
Sbjct: 8  ENESLDSALRRFKRSCAKAGIQQEIRKREHYEKPSVKRKKKSEAARKRKYK 58


>gi|168335131|ref|ZP_02693239.1| ribosomal protein S21 [Epulopiscium sp. 'N.t. morphotype B']
          Length = 59

 Score = 41.4 bits (96), Expect = 0.046,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             V VR+N  ++ ALR  K+     G+++E++ R HYEKPS KR +    A +++R
Sbjct: 1  MSEVTVRENESLDSALRRFKRNCAKAGIMQEIRKREHYEKPSVKRKKKSEAARKKNR 57


>gi|312602320|ref|YP_004022165.1| 30S ribosomal protein S21P [Burkholderia rhizoxinica HKI 454]
 gi|312169634|emb|CBW76646.1| SSU ribosomal protein S21P [Burkholderia rhizoxinica HKI 454]
          Length = 70

 Score = 41.4 bits (96), Expect = 0.046,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 36/61 (59%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREG 85
          +  VE ALR  ++ ++  G+++EL+ R  YEKP+ +R R K+ A+ R RK MR+      
Sbjct: 9  NEPVEVALRRFRRSIESTGLIKELRARMAYEKPTTERKRKKAAAVARLRKQMRRSLPPRK 68

Query: 86 A 86
           
Sbjct: 69 L 69


>gi|116629760|ref|YP_814932.1| 30S ribosomal protein S21 [Lactobacillus gasseri ATCC 33323]
 gi|116095342|gb|ABJ60494.1| SSU ribosomal protein S21P [Lactobacillus gasseri ATCC 33323]
          Length = 69

 Score = 41.4 bits (96), Expect = 0.046,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 29/60 (48%)

Query: 15 REISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
              A  ++  + +++ ALR  K+ +   G L+E + R  YEKPS KR      A +R  
Sbjct: 9  GSHMAKTIVHENESIDDALRRFKRSVSRSGTLQEYRKREFYEKPSVKRKLKSEAARKRRH 68


>gi|20515969|gb|AAM24220.1| Ribosomal protein S21 [Thermoanaerobacter tengcongensis MB4]
          Length = 73

 Score = 41.4 bits (96), Expect = 0.046,   Method: Composition-based stats.
 Identities = 24/71 (33%), Positives = 38/71 (53%)

Query: 8  RGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKS 67
          R ++ EG  + A   +  + +++ ALR  +++    GVL EL+ R HYE PS KR +   
Sbjct: 3  RAVYLEGGRVVAEVRVGENESLDSALRRFRRQCSKAGVLSELRKREHYESPSVKRKKKAE 62

Query: 68 EAIRRSRKLMR 78
           A +R  K  R
Sbjct: 63 AARKRKYKYGR 73


>gi|307718355|ref|YP_003873887.1| 30S ribosomal protein S21 [Spirochaeta thermophila DSM 6192]
 gi|306532080|gb|ADN01614.1| 30S ribosomal protein S21 [Spirochaeta thermophila DSM 6192]
 gi|315186024|gb|EFU19787.1| SSU ribosomal protein S21P [Spirochaeta thermophila DSM 6578]
          Length = 74

 Score = 41.4 bits (96), Expect = 0.048,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 42/69 (60%), Gaps = 1/69 (1%)

Query: 17 ISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          I  +++ V +   +E+AL+  K+ ++ EGV+RE K R  Y KPS+ + + K    R+  K
Sbjct: 2  IVIIHIPVDNGEPLEKALKRFKRVVEKEGVIREWKKREFYIKPSELKNQKKKALQRKLLK 61

Query: 76 LMRKIAQRE 84
           +RK+ ++E
Sbjct: 62 KLRKMQEKE 70


>gi|153953542|ref|YP_001394307.1| 30S ribosomal protein S21 [Clostridium kluyveri DSM 555]
 gi|219854164|ref|YP_002471286.1| hypothetical protein CKR_0821 [Clostridium kluyveri NBRC 12016]
 gi|255525321|ref|ZP_05392261.1| ribosomal protein S21 [Clostridium carboxidivorans P7]
 gi|296188189|ref|ZP_06856581.1| ribosomal protein S21 [Clostridium carboxidivorans P7]
 gi|300853990|ref|YP_003778974.1| putative 30S ribosomal protein S21 [Clostridium ljungdahlii DSM
          13528]
 gi|189044894|sp|A5N6M8|RS21_CLOK5 RecName: Full=30S ribosomal protein S21
 gi|254813611|sp|B9E047|RS21_CLOK1 RecName: Full=30S ribosomal protein S21
 gi|146346423|gb|EDK32959.1| RpsU [Clostridium kluyveri DSM 555]
 gi|219567888|dbj|BAH05872.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
 gi|255510993|gb|EET87293.1| ribosomal protein S21 [Clostridium carboxidivorans P7]
 gi|296047315|gb|EFG86757.1| ribosomal protein S21 [Clostridium carboxidivorans P7]
 gi|300434105|gb|ADK13872.1| predicted 30S ribosomal protein S21 [Clostridium ljungdahlii DSM
          13528]
          Length = 58

 Score = 41.0 bits (95), Expect = 0.048,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 29/51 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           +  +E ALR  K+K    GVL E++ R HYEKPS KR +    A +R  K
Sbjct: 8  ENETIESALRRFKRKCARAGVLSEVRKREHYEKPSVKRKKKSEAARKRKFK 58


>gi|312898009|ref|ZP_07757418.1| ribosomal protein S21 [Megasphaera micronuciformis F0359]
 gi|310620934|gb|EFQ04485.1| ribosomal protein S21 [Megasphaera micronuciformis F0359]
          Length = 59

 Score = 41.0 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          ++  ++ ALR  K+  Q  GVL E++ R HYEKPS +R +    A +R  K
Sbjct: 8  KNETLDSALRRFKRSCQKAGVLSEVRKREHYEKPSVRRKKKSEAARKRKFK 58


>gi|255994497|ref|ZP_05427632.1| ribosomal protein S21 [Eubacterium saphenum ATCC 49989]
 gi|255993210|gb|EEU03299.1| ribosomal protein S21 [Eubacterium saphenum ATCC 49989]
          Length = 59

 Score = 41.0 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             V V++N  +E AL+  K+    +GV+ E++ R HYEKPS KR +    A ++++K
Sbjct: 1  MAQVYVKENESLESALKRFKRLCARDGVMSEIRKREHYEKPSVKRKKKSEAARKKAKK 58


>gi|291533060|emb|CBL06173.1| SSU ribosomal protein S21P [Megamonas hypermegale ART12/1]
          Length = 60

 Score = 41.0 bits (95), Expect = 0.050,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          ++  ++ ALR  K+  Q  G L E++ R HYEKPS KR +    A +R  +
Sbjct: 9  KNETIDSALRRFKRTCQKAGTLAEVRKREHYEKPSVKRKKKSEAARKRRYR 59


>gi|115444717|ref|NP_001046138.1| Os02g0189000 [Oryza sativa Japonica Group]
 gi|46389907|dbj|BAD15528.1| ribosomal protein S21-like protein [Oryza sativa Japonica Group]
 gi|46390953|dbj|BAD16466.1| ribosomal protein S21-like protein [Oryza sativa Japonica Group]
 gi|113535669|dbj|BAF08052.1| Os02g0189000 [Oryza sativa Japonica Group]
 gi|125538403|gb|EAY84798.1| hypothetical protein OsI_06165 [Oryza sativa Indica Group]
 gi|125581098|gb|EAZ22029.1| hypothetical protein OsJ_05685 [Oryza sativa Japonica Group]
 gi|215767777|dbj|BAH00006.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 146

 Score = 41.0 bits (95), Expect = 0.050,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 18  SAVYVLVRDNNVEQAL-RVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
             V ++V +N  E+++ R  ++++   GVL+E+K R  YE    +R R 
Sbjct: 52  YNVQIVVDENEGEESIFRRFRREVMRAGVLQEIKRRRRYESKKDERKRK 100


>gi|75764336|ref|ZP_00743863.1| SSU ribosomal protein S21P [Bacillus thuringiensis serovar
          israelensis ATCC 35646]
 gi|118479477|ref|YP_896628.1| 30S ribosomal protein S21 [Bacillus thuringiensis str. Al Hakam]
 gi|42739365|gb|AAS43291.1| ribosomal protein S21 [Bacillus cereus ATCC 10987]
 gi|74488176|gb|EAO51865.1| SSU ribosomal protein S21P [Bacillus thuringiensis serovar
          israelensis ATCC 35646]
 gi|118418702|gb|ABK87121.1| SSU ribosomal protein S21P [Bacillus thuringiensis str. Al Hakam]
          Length = 66

 Score = 41.0 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 33/63 (52%)

Query: 10 IFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
          +F    +  +  V+ ++ ++E ALR  K+ +   G L E + R  YEKPS KR +    A
Sbjct: 2  MFRREGKRMSKTVVRKNESLEDALRRFKRSVSKTGTLAEARKREFYEKPSVKRKKKSEAA 61

Query: 70 IRR 72
           +R
Sbjct: 62 RKR 64


>gi|67924714|ref|ZP_00518119.1| Ribosomal protein S21 [Crocosphaera watsonii WH 8501]
 gi|126654706|ref|ZP_01726240.1| 30S ribosomal protein S21 [Cyanothece sp. CCY0110]
 gi|172035206|ref|YP_001801707.1| 30S ribosomal protein S21 [Cyanothece sp. ATCC 51142]
 gi|67853430|gb|EAM48784.1| Ribosomal protein S21 [Crocosphaera watsonii WH 8501]
 gi|126623441|gb|EAZ94145.1| 30S ribosomal protein S21 [Cyanothece sp. CCY0110]
 gi|171696660|gb|ACB49641.1| 30S ribosomal protein S21 [Cyanothece sp. ATCC 51142]
          Length = 60

 Score = 41.0 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKS 67
             V+V  N  +E ALR  K+++   G+  + K    +E P +KR R ++
Sbjct: 1  MTQVVVGQNEPIESALRRFKRQVAKAGIYTDYKKHQFFETPQEKRKRKEA 50


>gi|255630575|gb|ACU15647.1| unknown [Glycine max]
          Length = 112

 Score = 41.0 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 21/74 (28%), Positives = 37/74 (50%), Gaps = 1/74 (1%)

Query: 4  FNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELK-MRGHYEKPSQKR 62
          FN       + ++   + V V   N+E AL ++++KMQ  G+ R +K  +  + K S+KR
Sbjct: 22 FNNGHHQMQKLQQCRGIRVKVIGGNLEAALGLMQRKMQSSGIERMIKQEQRFHIKNSEKR 81

Query: 63 VRLKSEAIRRSRKL 76
          V  +    R+ R  
Sbjct: 82 VLAQKNLERKIRSE 95


>gi|18311005|ref|NP_562939.1| 30S ribosomal protein S21 [Clostridium perfringens str. 13]
 gi|110800958|ref|YP_696703.1| 30S ribosomal protein S21 [Clostridium perfringens ATCC 13124]
 gi|110802241|ref|YP_699304.1| 30S ribosomal protein S21 [Clostridium perfringens SM101]
 gi|168204738|ref|ZP_02630743.1| ribosomal protein S21 [Clostridium perfringens E str. JGS1987]
 gi|168208725|ref|ZP_02634350.1| ribosomal protein S21 [Clostridium perfringens B str. ATCC 3626]
 gi|168212940|ref|ZP_02638565.1| ribosomal protein S21 [Clostridium perfringens CPE str. F4969]
 gi|168215650|ref|ZP_02641275.1| ribosomal protein S21 [Clostridium perfringens NCTC 8239]
 gi|169343687|ref|ZP_02864686.1| ribosomal protein S21 [Clostridium perfringens C str. JGS1495]
 gi|182626912|ref|ZP_02954646.1| ribosomal protein S21 [Clostridium perfringens D str. JGS1721]
 gi|20978680|sp|Q8XIU0|RS21_CLOPE RecName: Full=30S ribosomal protein S21
 gi|119367248|sp|Q0TNT7|RS21_CLOP1 RecName: Full=30S ribosomal protein S21
 gi|119367249|sp|Q0SRF3|RS21_CLOPS RecName: Full=30S ribosomal protein S21
 gi|18145687|dbj|BAB81729.1| 30S ribosomal protein S2 [Clostridium perfringens str. 13]
 gi|110675605|gb|ABG84592.1| 30S ribosomal protein S21 [Clostridium perfringens ATCC 13124]
 gi|110682742|gb|ABG86112.1| 30S ribosomal protein S21 [Clostridium perfringens SM101]
 gi|169298247|gb|EDS80337.1| ribosomal protein S21 [Clostridium perfringens C str. JGS1495]
 gi|170663573|gb|EDT16256.1| ribosomal protein S21 [Clostridium perfringens E str. JGS1987]
 gi|170713130|gb|EDT25312.1| ribosomal protein S21 [Clostridium perfringens B str. ATCC 3626]
 gi|170715582|gb|EDT27764.1| ribosomal protein S21 [Clostridium perfringens CPE str. F4969]
 gi|177907762|gb|EDT70374.1| ribosomal protein S21 [Clostridium perfringens D str. JGS1721]
 gi|182382113|gb|EDT79592.1| ribosomal protein S21 [Clostridium perfringens NCTC 8239]
          Length = 58

 Score = 41.0 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 24/58 (41%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             + V++N  +EQALR  K++    GVL E++ R HYEKPS KR +    A +R  K
Sbjct: 1  MSEIRVKENESLEQALRRFKRQCARAGVLSEVRKREHYEKPSVKRKKKSEAARKRKFK 58


>gi|73662490|ref|YP_301271.1| 30S ribosomal protein S21 [Staphylococcus saprophyticus subsp.
          saprophyticus ATCC 15305]
 gi|119367320|sp|Q49Y18|RS21_STAS1 RecName: Full=30S ribosomal protein S21
 gi|72495005|dbj|BAE18326.1| 30S ribosomal protein S21 [Staphylococcus saprophyticus subsp.
          saprophyticus ATCC 15305]
          Length = 58

 Score = 41.0 bits (95), Expect = 0.053,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 33/58 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           +  V+ ++ ++E ALR  K+ +   G ++E++ R  YEKPS KR +    A +R  K
Sbjct: 1  MSKTVVKKNESLEDALRRFKRTVSKSGTIQEVRKREFYEKPSVKRKKKSEAARKRKFK 58


>gi|326791258|ref|YP_004309079.1| ribosomal protein S21 [Clostridium lentocellum DSM 5427]
 gi|326542022|gb|ADZ83881.1| ribosomal protein S21 [Clostridium lentocellum DSM 5427]
          Length = 59

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 20/57 (35%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             V VR+N  ++ ALR  K+     G+++E++ R HYEKPS KR +    A ++++
Sbjct: 1  MSEVTVRENESLDSALRRFKRNCAKAGIMQEIRKREHYEKPSVKRKKKSEAARKKNK 57


>gi|291519141|emb|CBK74362.1| SSU ribosomal protein S21P [Butyrivibrio fibrisolvens 16/4]
          Length = 57

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
            YV V++N  ++ ALR  K+     G+ +E++ R HYEKPS KR +    A +R
Sbjct: 1  MSYVTVKENESLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVKRKKKSEAARKR 55


>gi|182418315|ref|ZP_02949610.1| ribosomal protein S21 [Clostridium butyricum 5521]
 gi|237666850|ref|ZP_04526835.1| ribosomal protein S21 [Clostridium butyricum E4 str. BoNT E
          BL5262]
 gi|182377697|gb|EDT75241.1| ribosomal protein S21 [Clostridium butyricum 5521]
 gi|237658049|gb|EEP55604.1| ribosomal protein S21 [Clostridium butyricum E4 str. BoNT E
          BL5262]
          Length = 58

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 29/51 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           +  +E ALR  K+K    GV+ E++ R HYEKPS KR +    A +R  K
Sbjct: 8  ENETLESALRRFKRKCARAGVISEVRKREHYEKPSVKRKKKSEAARKRKFK 58


>gi|83589454|ref|YP_429463.1| 30S ribosomal protein S21 [Moorella thermoacetica ATCC 39073]
 gi|119367275|sp|Q2RKW9|RS21_MOOTA RecName: Full=30S ribosomal protein S21
 gi|83572368|gb|ABC18920.1| SSU ribosomal protein S21P [Moorella thermoacetica ATCC 39073]
          Length = 58

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 29/49 (59%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
          ++ +++ ALR  K+  Q  GVL E + R HYEKPS +R +    A +R 
Sbjct: 8  KNESLDAALRRFKRICQKSGVLSEARRREHYEKPSVRRKKKSEAARKRR 56


>gi|319892633|ref|YP_004149508.1| SSU ribosomal protein S21p [Staphylococcus pseudintermedius
          HKU10-03]
 gi|317162329|gb|ADV05872.1| SSU ribosomal protein S21p [Staphylococcus pseudintermedius
          HKU10-03]
 gi|323464329|gb|ADX76482.1| ribosomal protein S21 [Staphylococcus pseudintermedius ED99]
          Length = 58

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 32/55 (58%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G ++E++ R  YEKPS KR +    A +R
Sbjct: 1  MSKTVVRKNESLEDALRRFKRSVSKSGTIQEVRKREFYEKPSVKRKKKSEAARKR 55


>gi|254519871|ref|ZP_05131927.1| ribosomal protein S21 [Clostridium sp. 7_2_43FAA]
 gi|226913620|gb|EEH98821.1| ribosomal protein S21 [Clostridium sp. 7_2_43FAA]
          Length = 58

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 29/51 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           +  +E ALR  K+K    GVL E++ R HYEKPS KR +    A +R  K
Sbjct: 8  ENETLESALRRFKRKCARAGVLSEVRKREHYEKPSVKRKKKSEAARKRKFK 58


>gi|170725518|ref|YP_001759544.1| 30S ribosomal protein S21 [Shewanella woodyi ATCC 51908]
 gi|226695051|sp|B1KHE1|RS21_SHEWM RecName: Full=30S ribosomal protein S21
 gi|169810865|gb|ACA85449.1| ribosomal protein S21 [Shewanella woodyi ATCC 51908]
          Length = 71

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VRDN   + ALR  K+  +  G+L +++ R  YEKP+  R R K+ A++R  K +
Sbjct: 1  MPIIKVRDNEPFDVALRRFKRSCEKAGILADVRAREFYEKPTTARKRAKAAAVKRLAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|157374214|ref|YP_001472814.1| 30S ribosomal protein S21 [Shewanella sediminis HAW-EB3]
 gi|189044916|sp|A8FS63|RS21_SHESH RecName: Full=30S ribosomal protein S21
 gi|157316588|gb|ABV35686.1| ribosomal protein S21 [Shewanella sediminis HAW-EB3]
          Length = 71

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VRDN   + ALR  K+  +  G+L +++ R  YEKP+  R R K+ AI+R  K +
Sbjct: 1  MPIIKVRDNEPFDVALRRFKRSCEKAGILADVRAREFYEKPTTARKRAKAAAIKRLAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|228476120|ref|ZP_04060828.1| ribosomal protein S21 [Staphylococcus hominis SK119]
 gi|314936304|ref|ZP_07843651.1| ribosomal protein S21 [Staphylococcus hominis subsp. hominis C80]
 gi|228269943|gb|EEK11423.1| ribosomal protein S21 [Staphylococcus hominis SK119]
 gi|313654923|gb|EFS18668.1| ribosomal protein S21 [Staphylococcus hominis subsp. hominis C80]
          Length = 58

 Score = 41.0 bits (95), Expect = 0.054,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 33/58 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           +  V+ ++ ++E ALR  K+ +   G ++E++ R  YEKPS +R +    A +R  K
Sbjct: 1  MSKTVVRKNESLEDALRRFKRSVSKSGTIQEVRKREFYEKPSVRRKKKSEAARKRKFK 58


>gi|15901268|ref|NP_345872.1| 30S ribosomal protein S21 [Streptococcus pneumoniae TIGR4]
 gi|111658607|ref|ZP_01409264.1| hypothetical protein SpneT_02000282 [Streptococcus pneumoniae
          TIGR4]
 gi|116517095|ref|YP_816712.1| ribosomal protein S21 [Streptococcus pneumoniae D39]
 gi|148985631|ref|ZP_01818785.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
          [Streptococcus pneumoniae SP3-BS71]
 gi|148989537|ref|ZP_01820896.1| ribosomal protein S21 [Streptococcus pneumoniae SP6-BS73]
 gi|148993026|ref|ZP_01822620.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
          [Streptococcus pneumoniae SP9-BS68]
 gi|148997532|ref|ZP_01825137.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
          [Streptococcus pneumoniae SP11-BS70]
 gi|149002806|ref|ZP_01827732.1| ribosomal protein S21 [Streptococcus pneumoniae SP14-BS69]
 gi|149007316|ref|ZP_01830974.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
          [Streptococcus pneumoniae SP18-BS74]
 gi|149011656|ref|ZP_01832852.1| ribosomal protein S21 [Streptococcus pneumoniae SP19-BS75]
 gi|149019370|ref|ZP_01834732.1| ribosomal protein S21 [Streptococcus pneumoniae SP23-BS72]
 gi|168483960|ref|ZP_02708912.1| ribosomal protein S21 [Streptococcus pneumoniae CDC1873-00]
 gi|168486109|ref|ZP_02710617.1| ribosomal protein S21 [Streptococcus pneumoniae CDC1087-00]
 gi|168489579|ref|ZP_02713778.1| ribosomal protein S21 [Streptococcus pneumoniae SP195]
 gi|168491318|ref|ZP_02715461.1| ribosomal protein S21 [Streptococcus pneumoniae CDC0288-04]
 gi|168493318|ref|ZP_02717461.1| ribosomal protein S21 [Streptococcus pneumoniae CDC3059-06]
 gi|168575873|ref|ZP_02721788.1| ribosomal protein S21 [Streptococcus pneumoniae MLV-016]
 gi|169833745|ref|YP_001694849.1| 30S ribosomal protein S21 [Streptococcus pneumoniae Hungary19A-6]
 gi|194397316|ref|YP_002038062.1| 30S ribosomal protein S21 [Streptococcus pneumoniae G54]
 gi|221232154|ref|YP_002511307.1| 30S ribosomal protein S21 [Streptococcus pneumoniae ATCC 700669]
 gi|225854861|ref|YP_002736373.1| 30S ribosomal protein S21 [Streptococcus pneumoniae JJA]
 gi|225857049|ref|YP_002738560.1| 30S ribosomal protein S21 [Streptococcus pneumoniae P1031]
 gi|225859179|ref|YP_002740689.1| 30S ribosomal protein S21 [Streptococcus pneumoniae 70585]
 gi|225860806|ref|YP_002742315.1| 30S ribosomal protein S21 [Streptococcus pneumoniae Taiwan19F-14]
 gi|237650001|ref|ZP_04524253.1| 30S ribosomal protein S21 [Streptococcus pneumoniae CCRI 1974]
 gi|237822449|ref|ZP_04598294.1| 30S ribosomal protein S21 [Streptococcus pneumoniae CCRI 1974M2]
 gi|298229583|ref|ZP_06963264.1| 30S ribosomal protein S21 [Streptococcus pneumoniae str. Canada
          MDR_19F]
 gi|298255444|ref|ZP_06979030.1| 30S ribosomal protein S21 [Streptococcus pneumoniae str. Canada
          MDR_19A]
 gi|298502635|ref|YP_003724575.1| 30S ribosomal protein S21 [Streptococcus pneumoniae TCH8431/19A]
 gi|303254569|ref|ZP_07340673.1| ribosomal protein S21 [Streptococcus pneumoniae BS455]
 gi|303259010|ref|ZP_07344989.1| ribosomal protein S21 [Streptococcus pneumoniae SP-BS293]
 gi|303261694|ref|ZP_07347641.1| ribosomal protein S21 [Streptococcus pneumoniae SP14-BS292]
 gi|303264363|ref|ZP_07350283.1| ribosomal protein S21 [Streptococcus pneumoniae BS397]
 gi|303265838|ref|ZP_07351735.1| ribosomal protein S21 [Streptococcus pneumoniae BS457]
 gi|303268171|ref|ZP_07353970.1| ribosomal protein S21 [Streptococcus pneumoniae BS458]
 gi|307127017|ref|YP_003879048.1| 30S ribosomal protein S21 [Streptococcus pneumoniae 670-6B]
 gi|54039482|sp|P66525|RS21_STRR6 RecName: Full=30S ribosomal protein S21
 gi|54042171|sp|P66524|RS21_STRPN RecName: Full=30S ribosomal protein S21
 gi|122278402|sp|Q04JT6|RS21_STRP2 RecName: Full=30S ribosomal protein S21
 gi|226695055|sp|B5E5S2|RS21_STRP4 RecName: Full=30S ribosomal protein S21
 gi|226695056|sp|B1ICL4|RS21_STRPI RecName: Full=30S ribosomal protein S21
 gi|254764434|sp|C1C813|RS21_STRP7 RecName: Full=30S ribosomal protein S21
 gi|254764435|sp|B8ZKX3|RS21_STRPJ RecName: Full=30S ribosomal protein S21
 gi|254764437|sp|C1CF02|RS21_STRZJ RecName: Full=30S ribosomal protein S21
 gi|254764438|sp|C1CLC2|RS21_STRZP RecName: Full=30S ribosomal protein S21
 gi|254764439|sp|C1CQU3|RS21_STRZT RecName: Full=30S ribosomal protein S21
 gi|14972903|gb|AAK75512.1| ribosomal protein S21 [Streptococcus pneumoniae TIGR4]
 gi|116077671|gb|ABJ55391.1| ribosomal protein S21 [Streptococcus pneumoniae D39]
 gi|147756587|gb|EDK63628.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
          [Streptococcus pneumoniae SP11-BS70]
 gi|147759100|gb|EDK66094.1| ribosomal protein S21 [Streptococcus pneumoniae SP14-BS69]
 gi|147761120|gb|EDK68088.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
          [Streptococcus pneumoniae SP18-BS74]
 gi|147764087|gb|EDK71019.1| ribosomal protein S21 [Streptococcus pneumoniae SP19-BS75]
 gi|147922112|gb|EDK73234.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
          [Streptococcus pneumoniae SP3-BS71]
 gi|147925080|gb|EDK76161.1| ribosomal protein S21 [Streptococcus pneumoniae SP6-BS73]
 gi|147928227|gb|EDK79244.1| S-adenosylmethionine:tRNA ribosyltransferase-isomerase
          [Streptococcus pneumoniae SP9-BS68]
 gi|147931240|gb|EDK82219.1| ribosomal protein S21 [Streptococcus pneumoniae SP23-BS72]
 gi|168996247|gb|ACA36859.1| ribosomal protein S21 [Streptococcus pneumoniae Hungary19A-6]
 gi|172042792|gb|EDT50838.1| ribosomal protein S21 [Streptococcus pneumoniae CDC1873-00]
 gi|183570736|gb|EDT91264.1| ribosomal protein S21 [Streptococcus pneumoniae CDC1087-00]
 gi|183571959|gb|EDT92487.1| ribosomal protein S21 [Streptococcus pneumoniae SP195]
 gi|183574474|gb|EDT95002.1| ribosomal protein S21 [Streptococcus pneumoniae CDC0288-04]
 gi|183576684|gb|EDT97212.1| ribosomal protein S21 [Streptococcus pneumoniae CDC3059-06]
 gi|183578308|gb|EDT98836.1| ribosomal protein S21 [Streptococcus pneumoniae MLV-016]
 gi|194356983|gb|ACF55431.1| ribosomal protein S21 [Streptococcus pneumoniae G54]
 gi|220674615|emb|CAR69178.1| 30S ribosomal protein S21 [Streptococcus pneumoniae ATCC 700669]
 gi|225722102|gb|ACO17956.1| ribosomal protein S21 [Streptococcus pneumoniae 70585]
 gi|225723898|gb|ACO19751.1| ribosomal protein S21 [Streptococcus pneumoniae JJA]
 gi|225726157|gb|ACO22009.1| ribosomal protein S21 [Streptococcus pneumoniae P1031]
 gi|225727520|gb|ACO23371.1| ribosomal protein S21 [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238230|gb|ADI69361.1| 30S ribosomal protein S21 [Streptococcus pneumoniae TCH8431/19A]
 gi|301794454|emb|CBW36888.1| 30S ribosomal protein S21 [Streptococcus pneumoniae INV104]
 gi|301800279|emb|CBW32899.1| 30S ribosomal protein S21 [Streptococcus pneumoniae OXC141]
 gi|301802155|emb|CBW34892.1| 30S ribosomal protein S21 [Streptococcus pneumoniae INV200]
 gi|302598537|gb|EFL65579.1| ribosomal protein S21 [Streptococcus pneumoniae BS455]
 gi|302637274|gb|EFL67762.1| ribosomal protein S21 [Streptococcus pneumoniae SP14-BS292]
 gi|302639953|gb|EFL70409.1| ribosomal protein S21 [Streptococcus pneumoniae SP-BS293]
 gi|302642250|gb|EFL72598.1| ribosomal protein S21 [Streptococcus pneumoniae BS458]
 gi|302644573|gb|EFL74823.1| ribosomal protein S21 [Streptococcus pneumoniae BS457]
 gi|302646175|gb|EFL76402.1| ribosomal protein S21 [Streptococcus pneumoniae BS397]
 gi|306484079|gb|ADM90948.1| ribosomal protein S21 [Streptococcus pneumoniae 670-6B]
 gi|327389600|gb|EGE87945.1| ribosomal protein S21 [Streptococcus pneumoniae GA04375]
 gi|332073721|gb|EGI84200.1| ribosomal protein S21 [Streptococcus pneumoniae GA17570]
 gi|332074737|gb|EGI85211.1| ribosomal protein S21 [Streptococcus pneumoniae GA17545]
 gi|332074995|gb|EGI85467.1| ribosomal protein S21 [Streptococcus pneumoniae GA41301]
 gi|332200856|gb|EGJ14928.1| ribosomal protein S21 [Streptococcus pneumoniae GA41317]
 gi|332201865|gb|EGJ15935.1| ribosomal protein S21 [Streptococcus pneumoniae GA47368]
 gi|332203244|gb|EGJ17312.1| ribosomal protein S21 [Streptococcus pneumoniae GA47901]
          Length = 58

 Score = 41.0 bits (95), Expect = 0.056,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 32/57 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A +R +
Sbjct: 1  MSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKRKSEVARKRKK 57


>gi|253752142|ref|YP_003025283.1| 30S ribosomal protein S21 [Streptococcus suis SC84]
 gi|251816431|emb|CAZ52064.1| 30S ribosomal protein S21 [Streptococcus suis SC84]
          Length = 58

 Score = 41.0 bits (95), Expect = 0.056,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 31/57 (54%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R      +R +
Sbjct: 1  MSKTVVRKNESLDDALRRFKRAVTKAGTLQETRKREFYEKPSVKRKRKSEAVRKRKK 57


>gi|160892620|ref|ZP_02073410.1| hypothetical protein CLOL250_00150 [Clostridium sp. L2-50]
 gi|156865661|gb|EDO59092.1| hypothetical protein CLOL250_00150 [Clostridium sp. L2-50]
 gi|291522225|emb|CBK80518.1| SSU ribosomal protein S21P [Coprococcus catus GD/7]
          Length = 58

 Score = 41.0 bits (95), Expect = 0.056,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R  K
Sbjct: 1  MSNVIVKENETLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKRKYK 58


>gi|229824086|ref|ZP_04450155.1| hypothetical protein GCWU000282_01390 [Catonella morbi ATCC
          51271]
 gi|229786440|gb|EEP22554.1| hypothetical protein GCWU000282_01390 [Catonella morbi ATCC
          51271]
          Length = 73

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 21/63 (33%), Positives = 34/63 (53%)

Query: 10 IFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
            SEG +  +  V+  + +++ ALR  K+ +   G LRE + R  YEKPS +R +    A
Sbjct: 9  KSSEGGKPMSKTVVRENESLDDALRRFKRNVSKTGTLREARKREFYEKPSVRRKKKSEAA 68

Query: 70 IRR 72
           +R
Sbjct: 69 RKR 71


>gi|87125303|ref|ZP_01081149.1| 30S Ribosomal protein S21 [Synechococcus sp. RS9917]
 gi|88807216|ref|ZP_01122728.1| 30S Ribosomal protein S21 [Synechococcus sp. WH 7805]
 gi|113954666|ref|YP_731664.1| 30S ribosomal protein S21 [Synechococcus sp. CC9311]
 gi|116073813|ref|ZP_01471075.1| 30S Ribosomal protein S21 [Synechococcus sp. RS9916]
 gi|148240474|ref|YP_001225861.1| 30S ribosomal protein S21 [Synechococcus sp. WH 7803]
 gi|119367333|sp|Q0I7A8|RS21_SYNS3 RecName: Full=30S ribosomal protein S21
 gi|166225203|sp|A5GNP9|RS21_SYNPW RecName: Full=30S ribosomal protein S21
 gi|86167072|gb|EAQ68333.1| 30S Ribosomal protein S21 [Synechococcus sp. RS9917]
 gi|88788430|gb|EAR19585.1| 30S Ribosomal protein S21 [Synechococcus sp. WH 7805]
 gi|113882017|gb|ABI46975.1| ribosomal protein S21 [Synechococcus sp. CC9311]
 gi|116069118|gb|EAU74870.1| 30S Ribosomal protein S21 [Synechococcus sp. RS9916]
 gi|147849013|emb|CAK24564.1| 30S ribosomal protein S21 [Synechococcus sp. WH 7803]
          Length = 56

 Score = 41.0 bits (95), Expect = 0.057,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQK 61
             V V +N  +E ALR  K+++   G+  +LK   H+E P +K
Sbjct: 1  MTQVTVGENEGIESALRRFKRQVSKAGIFADLKRLRHHETPIEK 44


>gi|194477118|ref|YP_002049297.1| 30S ribosomal protein S21 [Paulinella chromatophora]
 gi|317967979|ref|ZP_07969369.1| 30S ribosomal protein S21 [Synechococcus sp. CB0205]
 gi|318040512|ref|ZP_07972468.1| 30S ribosomal protein S21 [Synechococcus sp. CB0101]
 gi|171192125|gb|ACB43087.1| 30S ribosomal protein S21 [Paulinella chromatophora]
          Length = 56

 Score = 41.0 bits (95), Expect = 0.058,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQK 61
             V V +N  +E ALR  K+++   G+  +LK   H+E P +K
Sbjct: 1  MTQVTVGENEGIESALRRFKRQVSKAGIFADLKRLRHHETPVEK 44


>gi|167767296|ref|ZP_02439349.1| hypothetical protein CLOSS21_01815 [Clostridium sp. SS2/1]
 gi|167711271|gb|EDS21850.1| hypothetical protein CLOSS21_01815 [Clostridium sp. SS2/1]
          Length = 71

 Score = 41.0 bits (95), Expect = 0.058,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 18 SAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
              V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R  K
Sbjct: 13 RMSNVIVKENESLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKRKSK 71


>gi|148241451|ref|YP_001226608.1| 30S ribosomal protein S21 [Synechococcus sp. RCC307]
 gi|166225204|sp|A5GQU6|RS21_SYNR3 RecName: Full=30S ribosomal protein S21
 gi|147849761|emb|CAK27255.1| 30S ribosomal protein S21 [Synechococcus sp. RCC307]
          Length = 56

 Score = 41.0 bits (95), Expect = 0.058,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQK 61
             V V +N  +E ALR  K+++   G+  +LK   H+E P +K
Sbjct: 1  MTQVTVGENEGIESALRRFKRQVSKAGIFADLKRLRHHETPVEK 44


>gi|126652820|ref|ZP_01724965.1| 30S ribosomal protein S21 [Bacillus sp. B14905]
 gi|169829178|ref|YP_001699336.1| 30S ribosomal protein S21 [Lysinibacillus sphaericus C3-41]
 gi|299535800|ref|ZP_07049121.1| 30S ribosomal protein S21 [Lysinibacillus fusiformis ZC1]
 gi|226695025|sp|B1HTK2|RS21_LYSSC RecName: Full=30S ribosomal protein S21
 gi|126590356|gb|EAZ84476.1| 30S ribosomal protein S21 [Bacillus sp. B14905]
 gi|168993666|gb|ACA41206.1| 30S ribosomal protein S21 [Lysinibacillus sphaericus C3-41]
 gi|298729000|gb|EFI69554.1| 30S ribosomal protein S21 [Lysinibacillus fusiformis ZC1]
 gi|327440947|dbj|BAK17312.1| ribosomal protein S21 [Solibacillus silvestris StLB046]
          Length = 57

 Score = 41.0 bits (95), Expect = 0.058,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 32/55 (58%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G ++E++ R  YEKPS KR +    A +R
Sbjct: 1  MSKTVVRKNESLEDALRRFKRTVSKSGTIQEVRKREFYEKPSVKRKKKSEAARKR 55


>gi|16331371|ref|NP_442099.1| 30S ribosomal protein S21 [Synechocystis sp. PCC 6803]
 gi|1350964|sp|P48949|RS21_SYNY3 RecName: Full=30S ribosomal protein S21
 gi|1001542|dbj|BAA10169.1| 30S ribosomal protein S21 [Synechocystis sp. PCC 6803]
          Length = 60

 Score = 41.0 bits (95), Expect = 0.058,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 25/50 (50%), Gaps = 1/50 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKS 67
             V+V  N  +E ALR  K+++   G+  + K    +E P +K  R ++
Sbjct: 1  MTQVVVGQNEPIESALRRFKRQVAKAGIYTDFKKHQFFETPQEKHKRKEA 50


>gi|150017529|ref|YP_001309783.1| ribosomal protein S21 [Clostridium beijerinckii NCIMB 8052]
 gi|149903994|gb|ABR34827.1| ribosomal protein S21 [Clostridium beijerinckii NCIMB 8052]
          Length = 58

 Score = 41.0 bits (95), Expect = 0.058,   Method: Composition-based stats.
 Identities = 25/51 (49%), Positives = 31/51 (60%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + ++EQALR  KKK    G+L E K R HYEKPS KR +   EA +R  K
Sbjct: 8  ENESLEQALRRFKKKCSMSGILSEAKKRQHYEKPSVKRKKKSEEARKRKFK 58


>gi|56708125|ref|YP_170021.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|89256385|ref|YP_513747.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica LVS]
 gi|110670596|ref|YP_667153.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|115314831|ref|YP_763554.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica OSU18]
 gi|134301936|ref|YP_001121905.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis WY96-3418]
 gi|156502474|ref|YP_001428539.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica FTNF002-00]
 gi|224457216|ref|ZP_03665689.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|254367722|ref|ZP_04983743.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica 257]
 gi|254369357|ref|ZP_04985369.1| 30S ribosomal protein S21 3 [Francisella tularensis subsp.
          holarctica FSC022]
 gi|254370611|ref|ZP_04986616.1| 30S ribosomal protein S21 3 [Francisella tularensis subsp.
          tularensis FSC033]
 gi|254874925|ref|ZP_05247635.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|290953808|ref|ZP_06558429.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|295312819|ref|ZP_06803551.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|81677051|sp|Q5NG21|RS213_FRATT RecName: Full=30S ribosomal protein S21 3
 gi|119367219|sp|Q2A3F5|RS212_FRATH RecName: Full=30S ribosomal protein S21 2
 gi|119367220|sp|Q0BLW7|RS212_FRATO RecName: Full=30S ribosomal protein S21 2
 gi|119367228|sp|Q14HH3|RS213_FRAT1 RecName: Full=30S ribosomal protein S21 3
 gi|56604617|emb|CAG45671.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|89144216|emb|CAJ79486.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica LVS]
 gi|110320929|emb|CAL09054.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|115129730|gb|ABI82917.1| ribosomal protein S21 [Francisella tularensis subsp. holarctica
          OSU18]
 gi|134049713|gb|ABO46784.1| ribosomal protein S21 [Francisella tularensis subsp. tularensis
          WY96-3418]
 gi|134253533|gb|EBA52627.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica 257]
 gi|151568854|gb|EDN34508.1| 30S ribosomal protein S21 3 [Francisella tularensis subsp.
          tularensis FSC033]
 gi|156253077|gb|ABU61583.1| ribosomal protein S21 [Francisella tularensis subsp. holarctica
          FTNF002-00]
 gi|157122307|gb|EDO66447.1| 30S ribosomal protein S21 3 [Francisella tularensis subsp.
          holarctica FSC022]
 gi|254840924|gb|EET19360.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|282159326|gb|ADA78717.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis NE061598]
          Length = 65

 Score = 41.0 bits (95), Expect = 0.062,   Method: Composition-based stats.
 Identities = 17/47 (36%), Positives = 30/47 (63%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + ALR  K+  +  G++ EL+ R ++EKP+  R R K+ A++R+ K
Sbjct: 12 FDVALRRFKRSCEKAGIVSELRRREYFEKPTWARKRKKTAAVKRAHK 58


>gi|310826531|ref|YP_003958888.1| 30S ribosomal protein S21 [Eubacterium limosum KIST612]
 gi|308738265|gb|ADO35925.1| 30S ribosomal protein S21 [Eubacterium limosum KIST612]
          Length = 60

 Score = 41.0 bits (95), Expect = 0.062,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 33/60 (55%), Gaps = 1/60 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +++N  +E ALR  K+K    GV+ E++ R HYEKPS KR R    A +R  K  
Sbjct: 1  MSEVKIKENETLESALRRFKRKTAMAGVMSEIRKREHYEKPSVKRKRKSEAARKRKMKKR 60


>gi|149198174|ref|ZP_01875221.1| hypothetical protein LNTAR_15972 [Lentisphaera araneosa HTCC2155]
 gi|149138776|gb|EDM27182.1| hypothetical protein LNTAR_15972 [Lentisphaera araneosa HTCC2155]
          Length = 64

 Score = 40.6 bits (94), Expect = 0.063,   Method: Composition-based stats.
 Identities = 25/50 (50%), Positives = 33/50 (66%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
          +++ALR LKKK+  EGVLREL+ R  YEKPS+ + R      +R RK  R
Sbjct: 13 IDKALRRLKKKLDREGVLRELRNRRCYEKPSEIKRREGKSLAKRIRKENR 62


>gi|29376911|ref|NP_816065.1| 30S ribosomal protein S21 [Enterococcus faecalis V583]
 gi|255972116|ref|ZP_05422702.1| ribosomal protein S21 [Enterococcus faecalis T1]
 gi|255975183|ref|ZP_05425769.1| ribosomal protein S21 [Enterococcus faecalis T2]
 gi|256617027|ref|ZP_05473873.1| ribosomal protein S21 [Enterococcus faecalis ATCC 4200]
 gi|256763109|ref|ZP_05503689.1| ribosomal protein S21 [Enterococcus faecalis T3]
 gi|256853777|ref|ZP_05559142.1| ribosomal protein S21 [Enterococcus faecalis T8]
 gi|256956693|ref|ZP_05560864.1| ribosomal protein S21 [Enterococcus faecalis DS5]
 gi|256961290|ref|ZP_05565461.1| 30S ribosomal protein S21 [Enterococcus faecalis Merz96]
 gi|256963583|ref|ZP_05567754.1| 30S ribosomal protein S21 [Enterococcus faecalis HIP11704]
 gi|257079648|ref|ZP_05574009.1| 30S ribosomal protein S21 [Enterococcus faecalis JH1]
 gi|257082006|ref|ZP_05576367.1| 30S ribosomal protein S21 [Enterococcus faecalis E1Sol]
 gi|257084557|ref|ZP_05578918.1| 30S ribosomal protein S21 [Enterococcus faecalis Fly1]
 gi|257087447|ref|ZP_05581808.1| ribosomal protein S21 [Enterococcus faecalis D6]
 gi|257090606|ref|ZP_05584967.1| 30S ribosomal protein S21 [Enterococcus faecalis CH188]
 gi|257416654|ref|ZP_05593648.1| ribosomal protein S21 [Enterococcus faecalis AR01/DG]
 gi|257419870|ref|ZP_05596864.1| 30S ribosomal protein S21 [Enterococcus faecalis T11]
 gi|257421942|ref|ZP_05598932.1| 30S ribosomal protein S21 [Enterococcus faecalis X98]
 gi|257865827|ref|ZP_05645480.1| ribosomal protein S21 [Enterococcus casseliflavus EC30]
 gi|257869121|ref|ZP_05648774.1| ribosomal protein S21 [Enterococcus gallinarum EG2]
 gi|257872162|ref|ZP_05651815.1| ribosomal protein S21 [Enterococcus casseliflavus EC10]
 gi|257875455|ref|ZP_05655108.1| ribosomal protein S21 [Enterococcus casseliflavus EC20]
 gi|294780103|ref|ZP_06745477.1| ribosomal protein S21 [Enterococcus faecalis PC1.1]
 gi|300860891|ref|ZP_07106978.1| ribosomal protein S21 [Enterococcus faecalis TUSoD Ef11]
 gi|315640631|ref|ZP_07895737.1| 30S ribosomal protein S21 [Enterococcus italicus DSM 15952]
 gi|325569842|ref|ZP_08145836.1| 30S ribosomal protein S21 [Enterococcus casseliflavus ATCC 12755]
 gi|61216040|sp|Q831T3|RS21_ENTFA RecName: Full=30S ribosomal protein S21
 gi|29344376|gb|AAO82135.1| ribosomal protein S21 [Enterococcus faecalis V583]
 gi|255963134|gb|EET95610.1| ribosomal protein S21 [Enterococcus faecalis T1]
 gi|255968055|gb|EET98677.1| ribosomal protein S21 [Enterococcus faecalis T2]
 gi|256596554|gb|EEU15730.1| ribosomal protein S21 [Enterococcus faecalis ATCC 4200]
 gi|256684360|gb|EEU24055.1| ribosomal protein S21 [Enterococcus faecalis T3]
 gi|256710720|gb|EEU25763.1| ribosomal protein S21 [Enterococcus faecalis T8]
 gi|256947189|gb|EEU63821.1| ribosomal protein S21 [Enterococcus faecalis DS5]
 gi|256951786|gb|EEU68418.1| 30S ribosomal protein S21 [Enterococcus faecalis Merz96]
 gi|256954079|gb|EEU70711.1| 30S ribosomal protein S21 [Enterococcus faecalis HIP11704]
 gi|256987678|gb|EEU74980.1| 30S ribosomal protein S21 [Enterococcus faecalis JH1]
 gi|256990036|gb|EEU77338.1| 30S ribosomal protein S21 [Enterococcus faecalis E1Sol]
 gi|256992587|gb|EEU79889.1| 30S ribosomal protein S21 [Enterococcus faecalis Fly1]
 gi|256995477|gb|EEU82779.1| ribosomal protein S21 [Enterococcus faecalis D6]
 gi|256999418|gb|EEU85938.1| 30S ribosomal protein S21 [Enterococcus faecalis CH188]
 gi|257158482|gb|EEU88442.1| ribosomal protein S21 [Enterococcus faecalis ARO1/DG]
 gi|257161698|gb|EEU91658.1| 30S ribosomal protein S21 [Enterococcus faecalis T11]
 gi|257163766|gb|EEU93726.1| 30S ribosomal protein S21 [Enterococcus faecalis X98]
 gi|257799761|gb|EEV28813.1| ribosomal protein S21 [Enterococcus casseliflavus EC30]
 gi|257803285|gb|EEV32107.1| ribosomal protein S21 [Enterococcus gallinarum EG2]
 gi|257806326|gb|EEV35148.1| ribosomal protein S21 [Enterococcus casseliflavus EC10]
 gi|257809621|gb|EEV38441.1| ribosomal protein S21 [Enterococcus casseliflavus EC20]
 gi|294452819|gb|EFG21247.1| ribosomal protein S21 [Enterococcus faecalis PC1.1]
 gi|295113468|emb|CBL32105.1| SSU ribosomal protein S21P [Enterococcus sp. 7L76]
 gi|300849930|gb|EFK77680.1| ribosomal protein S21 [Enterococcus faecalis TUSoD Ef11]
 gi|315150145|gb|EFT94161.1| ribosomal protein S21 [Enterococcus faecalis TX0012]
 gi|315483659|gb|EFU74149.1| 30S ribosomal protein S21 [Enterococcus italicus DSM 15952]
 gi|323481405|gb|ADX80844.1| ribosomal protein S21 [Enterococcus faecalis 62]
 gi|325156965|gb|EGC69133.1| 30S ribosomal protein S21 [Enterococcus casseliflavus ATCC 12755]
          Length = 58

 Score = 40.6 bits (94), Expect = 0.064,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 32/57 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR +    A +R +
Sbjct: 1  MSKTVVRKNESLDDALRRFKRSVSKAGTLQESRKREFYEKPSVKRKKKSEAARKRKK 57


>gi|9294294|dbj|BAB02196.1| unnamed protein product [Arabidopsis thaliana]
          Length = 99

 Score = 40.6 bits (94), Expect = 0.064,   Method: Composition-based stats.
 Identities = 20/64 (31%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 12 SEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELK-MRGHYEKPSQKRVRLKSEAI 70
           + ++   + V V  N++++AL +L+KKMQ  G+ R +K  + H+ K S+K+V  +    
Sbjct: 19 QQLQQERGIRVKVFSNDLDKALTILQKKMQSSGMERLIKGTQTHHIKNSEKKVLARKNLE 78

Query: 71 RRSR 74
          RR +
Sbjct: 79 RRIK 82


>gi|302389479|ref|YP_003825300.1| SSU ribosomal protein S21P [Thermosediminibacter oceani DSM
          16646]
 gi|302200107|gb|ADL07677.1| SSU ribosomal protein S21P [Thermosediminibacter oceani DSM
          16646]
          Length = 58

 Score = 40.6 bits (94), Expect = 0.065,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 31/51 (60%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + +++ AL+  K++ Q  GVL EL+ R HYEKPS +R +    A RR  +
Sbjct: 8  ENESIDSALKRFKRQCQKAGVLSELRKREHYEKPSVRRKKKSEAARRRKHR 58


>gi|296133937|ref|YP_003641184.1| ribosomal protein S21 [Thermincola sp. JR]
 gi|296032515|gb|ADG83283.1| ribosomal protein S21 [Thermincola potens JR]
          Length = 58

 Score = 40.6 bits (94), Expect = 0.065,   Method: Composition-based stats.
 Identities = 19/49 (38%), Positives = 29/49 (59%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
          ++  ++ ALR  K+  Q  GVL E++ R HYEKPS +R +    A +R 
Sbjct: 8  KNETLDSALRRFKRSCQKAGVLSEVRKREHYEKPSVRRKKKSEAARKRR 56


>gi|81428483|ref|YP_395483.1| 30S ribosomal protein S21 [Lactobacillus sakei subsp. sakei 23K]
 gi|119367268|sp|Q38XA7|RS21_LACSS RecName: Full=30S ribosomal protein S21
 gi|78610125|emb|CAI55174.1| 30S ribosomal protein S21 [Lactobacillus sakei subsp. sakei 23K]
          Length = 58

 Score = 40.6 bits (94), Expect = 0.065,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 29/57 (50%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
              V+  + +++ ALR  K+ +   G ++E + R  YEKPS KR      A +R +
Sbjct: 1  MGKTVVRSNESLDDALRRFKRSVSKAGTIQEYRKREFYEKPSVKRKLKSEAARKRKK 57


>gi|332709281|ref|ZP_08429244.1| SSU ribosomal protein S21P [Lyngbya majuscula 3L]
 gi|332351955|gb|EGJ31532.1| SSU ribosomal protein S21P [Lyngbya majuscula 3L]
          Length = 59

 Score = 40.6 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
             V+V +N  +E ALR  K+++   G+  ++K   H+E P +
Sbjct: 1  MTQVVVGENEGIESALRRFKRQVSKAGIFADMKRLRHFETPIE 43


>gi|254409701|ref|ZP_05023482.1| ribosomal protein S21 [Microcoleus chthonoplastes PCC 7420]
 gi|196183698|gb|EDX78681.1| ribosomal protein S21 [Microcoleus chthonoplastes PCC 7420]
          Length = 59

 Score = 40.6 bits (94), Expect = 0.066,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
             V+V +N  +E ALR  K+++   G+  ++K   H+E P +
Sbjct: 1  MTQVVVGENEGIESALRRFKRQVSKAGIFADMKRLRHFETPIE 43


>gi|160880748|ref|YP_001559716.1| ribosomal protein S21 [Clostridium phytofermentans ISDg]
 gi|189044895|sp|A9KMW6|RS21_CLOPH RecName: Full=30S ribosomal protein S21
 gi|160429414|gb|ABX42977.1| ribosomal protein S21 [Clostridium phytofermentans ISDg]
          Length = 58

 Score = 40.6 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS KR +    A +R  K
Sbjct: 1  MSNVIVKENESLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVKRKKKSEAARKRKFK 58


>gi|53717185|ref|YP_105585.1| 30S ribosomal protein S21 [Burkholderia mallei ATCC 23344]
 gi|53722390|ref|YP_111375.1| 30S ribosomal protein S21 [Burkholderia pseudomallei K96243]
 gi|76818901|ref|YP_335548.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1710b]
 gi|126442806|ref|YP_001062942.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 668]
 gi|126455657|ref|YP_001075890.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106a]
 gi|166999522|ref|ZP_02265359.1| 30S ribosomal protein S21 [Burkholderia mallei PRL-20]
 gi|167723963|ref|ZP_02407199.1| 30S ribosomal protein S21 [Burkholderia pseudomallei DM98]
 gi|167742934|ref|ZP_02415708.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 14]
 gi|167820109|ref|ZP_02451789.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 91]
 gi|167828485|ref|ZP_02459956.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 9]
 gi|167849940|ref|ZP_02475448.1| 30S ribosomal protein S21 [Burkholderia pseudomallei B7210]
 gi|167898545|ref|ZP_02485946.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 7894]
 gi|167906894|ref|ZP_02494099.1| 30S ribosomal protein S21 [Burkholderia pseudomallei NCTC 13177]
 gi|167915251|ref|ZP_02502342.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 112]
 gi|167923082|ref|ZP_02510173.1| 30S ribosomal protein S21 [Burkholderia pseudomallei BCC215]
 gi|226199078|ref|ZP_03794640.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pakistan 9]
 gi|242313230|ref|ZP_04812247.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106b]
 gi|254183756|ref|ZP_04890348.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1655]
 gi|254186669|ref|ZP_04893185.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pasteur
          52237]
 gi|254193706|ref|ZP_04900138.1| 30S ribosomal protein S21 [Burkholderia pseudomallei S13]
 gi|254263542|ref|ZP_04954407.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1710a]
 gi|254301647|ref|ZP_04969091.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 406e]
 gi|254356629|ref|ZP_04972904.1| 30S ribosomal protein S21 [Burkholderia mallei 2002721280]
 gi|61216073|sp|Q62CJ3|RS21C_BURMA RecName: Full=30S ribosomal protein S21 C
 gi|81690024|sp|Q63KJ7|RS212_BURPS RecName: Full=30S ribosomal protein S21 2
 gi|119367215|sp|Q3JLK5|RS212_BURP1 RecName: Full=30S ribosomal protein S21 2
 gi|52212804|emb|CAH38836.1| 30S ribosomal protein S21 [Burkholderia pseudomallei K96243]
 gi|52423155|gb|AAU46725.1| ribosomal protein S21 [Burkholderia mallei ATCC 23344]
 gi|76583374|gb|ABA52848.1| ribosomal protein S21 [Burkholderia pseudomallei 1710b]
 gi|126222297|gb|ABN85802.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 668]
 gi|126229425|gb|ABN92838.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106a]
 gi|148025656|gb|EDK83779.1| 30S ribosomal protein S21 [Burkholderia mallei 2002721280]
 gi|157811123|gb|EDO88293.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 406e]
 gi|157934353|gb|EDO90023.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pasteur
          52237]
 gi|169650457|gb|EDS83150.1| 30S ribosomal protein S21 [Burkholderia pseudomallei S13]
 gi|184214289|gb|EDU11332.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1655]
 gi|225928853|gb|EEH24878.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pakistan 9]
 gi|242136469|gb|EES22872.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1106b]
 gi|243064362|gb|EES46548.1| 30S ribosomal protein S21 [Burkholderia mallei PRL-20]
 gi|254214544|gb|EET03929.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1710a]
          Length = 70

 Score = 40.6 bits (94), Expect = 0.068,   Method: Composition-based stats.
 Identities = 23/64 (35%), Positives = 38/64 (59%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
              VL  +  VE ALR  ++ ++  G+++EL+ R  YEKP+ +R R K+ A+ R RK +
Sbjct: 1  MTTIVLNPNEPVEVALRRFRRSIERTGLIKELRARTSYEKPTTERKRKKAAAVARLRKQV 60

Query: 78 RKIA 81
          R+  
Sbjct: 61 RRSM 64


>gi|257456794|ref|ZP_05621978.1| ribosomal protein S21 [Treponema vincentii ATCC 35580]
 gi|257445800|gb|EEV20859.1| ribosomal protein S21 [Treponema vincentii ATCC 35580]
          Length = 69

 Score = 40.6 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 23/62 (37%), Positives = 36/62 (58%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           A  V+    N+E+A++  K++++ EG++RE K R +YEKPS    R K    R+  K  
Sbjct: 1  MASIVIDDSENLEKAIKRFKRQVEKEGIIREWKKREYYEKPSTILNRKKKALQRKLMKKN 60

Query: 78 RK 79
          RK
Sbjct: 61 RK 62


>gi|302874327|ref|YP_003842960.1| 30S ribosomal protein S21 [Clostridium cellulovorans 743B]
 gi|307689406|ref|ZP_07631852.1| 30S ribosomal protein S21 [Clostridium cellulovorans 743B]
 gi|302577184|gb|ADL51196.1| ribosomal protein S21 [Clostridium cellulovorans 743B]
          Length = 58

 Score = 40.6 bits (94), Expect = 0.072,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 30/51 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + ++E AL+  K+K    GVL E++ R HYEKPS KR +    A +R  K
Sbjct: 8  ENESLESALKRFKRKCARAGVLSEVRKREHYEKPSVKRKKKSEAARKRKFK 58


>gi|225175064|ref|ZP_03729060.1| ribosomal protein S21 [Dethiobacter alkaliphilus AHT 1]
 gi|225169240|gb|EEG78038.1| ribosomal protein S21 [Dethiobacter alkaliphilus AHT 1]
          Length = 62

 Score = 40.6 bits (94), Expect = 0.072,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 30/53 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
          ++  ++ A+R  KK+    G++ E++ R HYEKPS KR +    A +  +K  
Sbjct: 8  KNETLDSAIRRFKKQCSKTGIIAEVRKREHYEKPSVKRKKKSEAARKNMKKKR 60


>gi|302670583|ref|YP_003830543.1| ribosomal protein S21 RpsU [Butyrivibrio proteoclasticus B316]
 gi|302395056|gb|ADL33961.1| ribosomal protein S21 RpsU [Butyrivibrio proteoclasticus B316]
          Length = 58

 Score = 40.6 bits (94), Expect = 0.073,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R
Sbjct: 1  MSTVVVKENETLDSALRRFKRSCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKR 55


>gi|225019233|ref|ZP_03708425.1| hypothetical protein CLOSTMETH_03186 [Clostridium methylpentosum
          DSM 5476]
 gi|224947864|gb|EEG29073.1| hypothetical protein CLOSTMETH_03186 [Clostridium methylpentosum
          DSM 5476]
          Length = 58

 Score = 40.6 bits (94), Expect = 0.073,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             + V+DN  ++ ALR  K+     G++ E++ R HYEKPS KR +    A +R
Sbjct: 1  MAEIRVKDNESLDSALRRFKRSCAKSGIISEVRKREHYEKPSVKRKKKSEAARKR 55


>gi|76799606|ref|ZP_00781726.1| ribosomal protein S21 [Streptococcus agalactiae 18RS21]
 gi|76585041|gb|EAO61679.1| ribosomal protein S21 [Streptococcus agalactiae 18RS21]
          Length = 51

 Score = 40.6 bits (94), Expect = 0.073,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          ++ +++ ALR  K+ +   G L+E + R  YEKPS KR R    A +R +
Sbjct: 1  KNESLDDALRRFKRSVTKAGTLQESRKREFYEKPSVKRKRKSEAARKRKK 50


>gi|254422915|ref|ZP_05036633.1| ribosomal protein S21 [Synechococcus sp. PCC 7335]
 gi|196190404|gb|EDX85368.1| ribosomal protein S21 [Synechococcus sp. PCC 7335]
          Length = 62

 Score = 40.6 bits (94), Expect = 0.074,   Method: Composition-based stats.
 Identities = 16/47 (34%), Positives = 27/47 (57%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSE 68
          VL +D N+E ALR  K+K+   G+ +++K   ++E P +K  R    
Sbjct: 5  VLGQDENLEAALRRFKRKVVRAGIFQDIKKNRYFETPPEKHKRKALA 51


>gi|17544727|ref|NP_518129.1| 30S ribosomal protein S21 [Ralstonia solanacearum GMI1000]
 gi|83747151|ref|ZP_00944194.1| SSU ribosomal protein S21P [Ralstonia solanacearum UW551]
 gi|187930812|ref|YP_001901299.1| 30S ribosomal protein S21 [Ralstonia pickettii 12J]
 gi|207727490|ref|YP_002255884.1| 30s ribosomal protein s21 [Ralstonia solanacearum MolK2]
 gi|207741904|ref|YP_002258296.1| 30s ribosomal protein s21 [Ralstonia solanacearum IPO1609]
 gi|241665002|ref|YP_002983362.1| 30S ribosomal protein S21 [Ralstonia pickettii 12D]
 gi|300692985|ref|YP_003753980.1| 30S ribosomal subunit protein S21 [Ralstonia solanacearum PSI07]
 gi|300705588|ref|YP_003747191.1| 30S ribosomal protein S21 [Ralstonia solanacearum CFBP2957]
 gi|309780192|ref|ZP_07674943.1| ribosomal protein S21 [Ralstonia sp. 5_7_47FAA]
 gi|20978685|sp|Q8Y3H2|RS21_RALSO RecName: Full=30S ribosomal protein S21
 gi|226695040|sp|B2U814|RS21_RALPJ RecName: Full=30S ribosomal protein S21
 gi|17427016|emb|CAD13536.1| probable 30s ribosomal protein s21 [Ralstonia solanacearum
          GMI1000]
 gi|83726126|gb|EAP73261.1| SSU ribosomal protein S21P [Ralstonia solanacearum UW551]
 gi|187727702|gb|ACD28867.1| ribosomal protein S21 [Ralstonia pickettii 12J]
 gi|206590727|emb|CAQ56339.1| 30s ribosomal protein s21 [Ralstonia solanacearum MolK2]
 gi|206593290|emb|CAQ60217.1| 30s ribosomal protein s21 [Ralstonia solanacearum IPO1609]
 gi|240867029|gb|ACS64690.1| ribosomal protein S21 [Ralstonia pickettii 12D]
 gi|299068426|emb|CBJ39650.1| 30S ribosomal subunit protein S21 [Ralstonia solanacearum CMR15]
 gi|299073252|emb|CBJ44611.1| 30S ribosomal subunit protein S21 [Ralstonia solanacearum
          CFBP2957]
 gi|299080045|emb|CBJ52719.1| 30S ribosomal subunit protein S21 [Ralstonia solanacearum PSI07]
 gi|308920895|gb|EFP66541.1| ribosomal protein S21 [Ralstonia sp. 5_7_47FAA]
          Length = 70

 Score = 40.6 bits (94), Expect = 0.074,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 38/62 (61%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +  VE ALR  +++++  G+++EL+ R  YEKP+ +R R K+ A+ R+RK +R     +
Sbjct: 8  ENEPVEVALRRFRREIERTGLIKELRARTAYEKPTTERKRKKAAAVSRTRKRLRSQMLPK 67

Query: 85 GA 86
            
Sbjct: 68 KL 69


>gi|291559394|emb|CBL38194.1| SSU ribosomal protein S21P [butyrate-producing bacterium SSC/2]
          Length = 58

 Score = 40.6 bits (94), Expect = 0.075,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R  K
Sbjct: 1  MSNVIVKENESLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKRKSK 58


>gi|288572911|ref|ZP_06391268.1| ribosomal protein S21 [Dethiosulfovibrio peptidovorans DSM 11002]
 gi|288568652|gb|EFC90209.1| ribosomal protein S21 [Dethiosulfovibrio peptidovorans DSM 11002]
          Length = 59

 Score = 40.6 bits (94), Expect = 0.075,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 33/59 (55%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
              V   + ++E ALR  K+ +   GVLRE + R HYEKPS+ + R + E  ++ R+ 
Sbjct: 1  MTTIVRRDNESLEDALRRFKRDVSKTGVLREARQREHYEKPSEAKKRKRQELAKKRRRK 59


>gi|88798843|ref|ZP_01114425.1| Ribosomal protein S21 [Reinekea sp. MED297]
 gi|88778323|gb|EAR09516.1| Ribosomal protein S21 [Reinekea sp. MED297]
          Length = 71

 Score = 40.6 bits (94), Expect = 0.075,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
            +V V+DN   + ALR  K+  +  GVL E++ R HYEKP+  R R  + A++R  K +
Sbjct: 1  MPHVKVKDNEPFDVALRRFKRSCEKAGVLSEVRRREHYEKPTWVRKRAAAAAVKRHAKKL 60

Query: 78 RKIAQR 83
           +  +R
Sbjct: 61 SRENKR 66


>gi|154483550|ref|ZP_02025998.1| hypothetical protein EUBVEN_01254 [Eubacterium ventriosum ATCC
          27560]
 gi|149735460|gb|EDM51346.1| hypothetical protein EUBVEN_01254 [Eubacterium ventriosum ATCC
          27560]
          Length = 58

 Score = 40.6 bits (94), Expect = 0.076,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS KR +    A +R
Sbjct: 1  MSSVIVKENESIDSALRRFKRNCAKAGIQQEIRKREHYEKPSVKRKKKSEAARKR 55


>gi|167583909|ref|ZP_02376297.1| hypothetical protein BuboB_01147 [Burkholderia ubonensis Bu]
          Length = 55

 Score = 40.6 bits (94), Expect = 0.077,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 31/54 (57%)

Query: 33 LRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGA 86
          +R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R  K +R     +  
Sbjct: 1  MRRFKRTIEKNGLLTELRAREFYEKPTAERKRKKAAAVKRHYKRIRSQMLPKKL 54


>gi|330718272|ref|ZP_08312872.1| 30S ribosomal protein S21 [Leuconostoc fallax KCTC 3537]
          Length = 61

 Score = 40.6 bits (94), Expect = 0.077,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 35/61 (57%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           A  ++ ++ +++ ALR  K+ +  +G L+E + R +Y KPS +R      A +R++K  
Sbjct: 1  MAKVIVRKNESLDDALRRFKRGVSKDGTLQEYRKREYYIKPSVQRKLKSEAARKRNKKKS 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|212274571|ref|NP_001130854.1| hypothetical protein LOC100191958 [Zea mays]
 gi|194690276|gb|ACF79222.1| unknown [Zea mays]
 gi|195641548|gb|ACG40242.1| hypothetical protein [Zea mays]
          Length = 110

 Score = 40.6 bits (94), Expect = 0.077,   Method: Composition-based stats.
 Identities = 25/73 (34%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 13  EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHY-EKPSQKRVRLKSEAIR 71
           + ++   + V VRD N+E+AL V+++KM+  G+ R ++ R HY  K S+KRV  +   ++
Sbjct: 29  QVQQARGIVVQVRDGNLERALAVMERKMRSSGMERLIRARTHYHVKDSEKRVLARKALMQ 88

Query: 72  RSRKLMRKIAQRE 84
           R R        RE
Sbjct: 89  RVRSQELGKKLRE 101


>gi|53720928|ref|YP_109914.1| 30S ribosomal protein S21 [Burkholderia pseudomallei K96243]
 gi|53724341|ref|YP_104382.1| 30S ribosomal protein S21 [Burkholderia mallei ATCC 23344]
 gi|121598335|ref|YP_994725.1| 30S ribosomal protein S21 [Burkholderia mallei SAVP1]
 gi|124385892|ref|YP_001027652.1| 30S ribosomal protein S21 [Burkholderia mallei NCTC 10229]
 gi|126448185|ref|YP_001082622.1| 30S ribosomal protein S21 [Burkholderia mallei NCTC 10247]
 gi|161723172|ref|YP_443689.2| 30S ribosomal protein S21 [Burkholderia thailandensis E264]
 gi|162210083|ref|YP_331506.2| 30S ribosomal protein S21 [Burkholderia pseudomallei 1710b]
 gi|167000418|ref|ZP_02266232.1| 30S ribosomal protein S21 [Burkholderia mallei PRL-20]
 gi|167582730|ref|ZP_02375604.1| 30S ribosomal protein S21 [Burkholderia thailandensis TXDOH]
 gi|167620845|ref|ZP_02389476.1| 30S ribosomal protein S21 [Burkholderia thailandensis Bt4]
 gi|167721706|ref|ZP_02404942.1| 30S ribosomal protein S21 [Burkholderia pseudomallei DM98]
 gi|167740684|ref|ZP_02413458.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 14]
 gi|167817897|ref|ZP_02449577.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 91]
 gi|167826274|ref|ZP_02457745.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 9]
 gi|167838323|ref|ZP_02465182.1| 30S ribosomal protein S21 [Burkholderia thailandensis MSMB43]
 gi|167847781|ref|ZP_02473289.1| 30S ribosomal protein S21 [Burkholderia pseudomallei B7210]
 gi|167896370|ref|ZP_02483772.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 7894]
 gi|167904743|ref|ZP_02491948.1| 30S ribosomal protein S21 [Burkholderia pseudomallei NCTC 13177]
 gi|167913024|ref|ZP_02500115.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 112]
 gi|167920960|ref|ZP_02508051.1| 30S ribosomal protein S21 [Burkholderia pseudomallei BCC215]
 gi|238563180|ref|ZP_00439278.2| 30S ribosomal protein S21 [Burkholderia mallei GB8 horse 4]
 gi|254175139|ref|ZP_04881800.1| 30S ribosomal protein S21 [Burkholderia mallei ATCC 10399]
 gi|254183901|ref|ZP_04890492.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1655]
 gi|254186377|ref|ZP_04892894.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pasteur
          52237]
 gi|254194515|ref|ZP_04900946.1| 30S ribosomal protein S21 [Burkholderia pseudomallei S13]
 gi|254206796|ref|ZP_04913147.1| 30S ribosomal protein S21 [Burkholderia mallei JHU]
 gi|254298781|ref|ZP_04966232.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 406e]
 gi|254357181|ref|ZP_04973455.1| 30S ribosomal protein S21 [Burkholderia mallei 2002721280]
 gi|2500486|sp|P70943|RS211_BURPS RecName: Full=30S ribosomal protein S21 1
 gi|55977890|sp|Q9WW25|RS21A_BURMA RecName: Full=30S ribosomal protein S21 A
 gi|119367203|sp|Q3JY47|RS211_BURP1 RecName: Full=30S ribosomal protein S21 1
 gi|119367204|sp|Q2STR0|RS211_BURTA RecName: Full=30S ribosomal protein S21 1
 gi|166224014|sp|A2S6T3|RS21_BURM9 RecName: Full=30S ribosomal protein S21
 gi|1929917|gb|AAB51475.1| ribosomal protein S21 [Burkholderia pseudomallei 1026b]
 gi|17863806|gb|AAL46938.1| ribosomal subunit S21 [Burkholderia pseudomallei]
 gi|17863808|gb|AAL46939.1| ribosomal subunit S21 [Burkholderia thailandensis E264]
 gi|52211342|emb|CAH37331.1| 30S ribosomal protein S21 [Burkholderia pseudomallei K96243]
 gi|52427764|gb|AAU48357.1| ribosomal protein S21 [Burkholderia mallei ATCC 23344]
 gi|121227145|gb|ABM49663.1| 30S ribosomal protein S21 [Burkholderia mallei SAVP1]
 gi|124293912|gb|ABN03181.1| 30S ribosomal protein S21 [Burkholderia mallei NCTC 10229]
 gi|126241055|gb|ABO04148.1| 30S ribosomal protein S21 [Burkholderia mallei NCTC 10247]
 gi|147752338|gb|EDK59404.1| 30S ribosomal protein S21 [Burkholderia mallei JHU]
 gi|148026245|gb|EDK84330.1| 30S ribosomal protein S21 [Burkholderia mallei 2002721280]
 gi|157808505|gb|EDO85675.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 406e]
 gi|157934062|gb|EDO89732.1| 30S ribosomal protein S21 [Burkholderia pseudomallei Pasteur
          52237]
 gi|160696184|gb|EDP86154.1| 30S ribosomal protein S21 [Burkholderia mallei ATCC 10399]
 gi|169651265|gb|EDS83958.1| 30S ribosomal protein S21 [Burkholderia pseudomallei S13]
 gi|184214433|gb|EDU11476.1| 30S ribosomal protein S21 [Burkholderia pseudomallei 1655]
 gi|238521189|gb|EEP84642.1| 30S ribosomal protein S21 [Burkholderia mallei GB8 horse 4]
 gi|243063610|gb|EES45796.1| 30S ribosomal protein S21 [Burkholderia mallei PRL-20]
          Length = 70

 Score = 40.6 bits (94), Expect = 0.079,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 33/62 (53%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   E A+R  ++ ++  G++ EL+ R  YEKP+  R R K+ A++R  K +R     +
Sbjct: 8  ENEPFEVAIRRFRRAIEKNGLIAELRERQAYEKPTAVRKRKKAAAVKRLHKRLRSQMLPK 67

Query: 85 GA 86
            
Sbjct: 68 KL 69


>gi|166365468|ref|YP_001657741.1| 30S ribosomal protein S21 [Microcystis aeruginosa NIES-843]
 gi|189044906|sp|B0JIQ1|RS21_MICAN RecName: Full=30S ribosomal protein S21
 gi|159027411|emb|CAO86895.1| rpsU [Microcystis aeruginosa PCC 7806]
 gi|166087841|dbj|BAG02549.1| 30S ribosomal protein S21 [Microcystis aeruginosa NIES-843]
          Length = 60

 Score = 40.6 bits (94), Expect = 0.080,   Method: Composition-based stats.
 Identities = 12/43 (27%), Positives = 22/43 (51%), Gaps = 1/43 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
             V+V  N  +E ALR  K+++   G+  ++K    +E P +
Sbjct: 1  MTQVVVGQNEAIESALRRFKRQVAKAGIYADIKKHQFFETPQE 43


>gi|320537114|ref|ZP_08037087.1| ribosomal protein S21 [Treponema phagedenis F0421]
 gi|320146039|gb|EFW37682.1| ribosomal protein S21 [Treponema phagedenis F0421]
          Length = 69

 Score = 40.6 bits (94), Expect = 0.081,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 33/53 (62%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           N+E+A++  K++++ EG++RE K R +YEKPS    R K    R+  K  RK
Sbjct: 10 ENLEKAIKRFKRQVEKEGIIREWKKREYYEKPSTILNRKKKALQRKLMKKNRK 62


>gi|332638288|ref|ZP_08417151.1| 30S ribosomal protein S21 [Weissella cibaria KACC 11862]
          Length = 61

 Score = 40.3 bits (93), Expect = 0.082,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 32/61 (52%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           A  V+ ++ +++ ALR  K+ +  +G L+E + R  Y KPS +R      A +R  K  
Sbjct: 1  MAKTVVRKNESLDDALRRFKRGVSKDGTLQEYRKREFYIKPSVQRKLKAEAARKRKNKKS 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|260888212|ref|ZP_05899475.1| ribosomal protein S21 [Selenomonas sputigena ATCC 35185]
 gi|330838446|ref|YP_004413026.1| ribosomal protein S21 [Selenomonas sputigena ATCC 35185]
 gi|260862046|gb|EEX76546.1| ribosomal protein S21 [Selenomonas sputigena ATCC 35185]
 gi|329746210|gb|AEB99566.1| ribosomal protein S21 [Selenomonas sputigena ATCC 35185]
          Length = 60

 Score = 40.3 bits (93), Expect = 0.082,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 28/48 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++  ++ ALR  K+  Q  G L E++ R HYEKPS KR +    A +R
Sbjct: 9  KNETIDSALRRFKRTCQKAGTLAEVRKREHYEKPSVKRKKKSEAARKR 56


>gi|197121171|ref|YP_002133122.1| 30S ribosomal protein S21 [Anaeromyxobacter sp. K]
 gi|220915871|ref|YP_002491175.1| ribosomal protein S21 [Anaeromyxobacter dehalogenans 2CP-1]
 gi|119367234|sp|Q2INW0|RS21_ANADE RecName: Full=30S ribosomal protein S21
 gi|226694970|sp|B4UDK2|RS21_ANASK RecName: Full=30S ribosomal protein S21
 gi|254813077|sp|B8JDL4|RS21_ANAD2 RecName: Full=30S ribosomal protein S21
 gi|196171020|gb|ACG71993.1| ribosomal protein S21 [Anaeromyxobacter sp. K]
 gi|219953725|gb|ACL64109.1| ribosomal protein S21 [Anaeromyxobacter dehalogenans 2CP-1]
          Length = 64

 Score = 40.3 bits (93), Expect = 0.082,   Method: Composition-based stats.
 Identities = 25/62 (40%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V+D    E A++  KK+ +  G+L E++ R HYEKPS KR +    A +R+ K M
Sbjct: 1  MTGVRVKDGESFENAMKRFKKQCEKAGILSEIRKREHYEKPSVKRKKKALAAKKRALKKM 60

Query: 78 RK 79
          RK
Sbjct: 61 RK 62


>gi|332296324|ref|YP_004438247.1| 30S ribosomal protein S21 [Thermodesulfobium narugense DSM 14796]
 gi|332179427|gb|AEE15116.1| 30S ribosomal protein S21 [Thermodesulfobium narugense DSM 14796]
          Length = 59

 Score = 40.3 bits (93), Expect = 0.083,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
          +D +++ AL+   K +Q EG+L E++ R  YE PS 
Sbjct: 8  KDESIDSALKRFNKVVQQEGILSEVRKREFYESPSV 43


>gi|167566048|ref|ZP_02358964.1| 30S ribosomal protein S21 [Burkholderia oklahomensis EO147]
 gi|167573126|ref|ZP_02366000.1| 30S ribosomal protein S21 [Burkholderia oklahomensis C6786]
          Length = 70

 Score = 40.3 bits (93), Expect = 0.083,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 36/56 (64%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
          +  VE ALR  ++ ++  G+++EL+ R  YEKP+ +R R K+ A+ R RK +R+  
Sbjct: 9  NEPVEVALRRFRRTIERTGLIKELRARTSYEKPTTERKRKKASAVARLRKQIRRSM 64


>gi|295398016|ref|ZP_06808072.1| 30S ribosomal protein S21 [Aerococcus viridans ATCC 11563]
 gi|294973774|gb|EFG49545.1| 30S ribosomal protein S21 [Aerococcus viridans ATCC 11563]
          Length = 57

 Score = 40.3 bits (93), Expect = 0.085,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ +++ ALR  K+ +   G ++E + R  YEKPS KR +    A +R
Sbjct: 1  MSKTVVRKNESLDDALRRFKRSVSKSGTIQEARKREFYEKPSVKRKKKSEAARKR 55


>gi|149183476|ref|ZP_01861906.1| SSU ribosomal protein S21P [Bacillus sp. SG-1]
 gi|148848812|gb|EDL63032.1| SSU ribosomal protein S21P [Bacillus sp. SG-1]
          Length = 57

 Score = 40.3 bits (93), Expect = 0.085,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G L+E + R  YEKPS KR +    A +R
Sbjct: 1  MSKTVVRKNESLEDALRRFKRSVSKTGTLQEYRKREFYEKPSVKRKKKSEAARKR 55


>gi|119773963|ref|YP_926703.1| 30S ribosomal protein S21 [Shewanella amazonensis SB2B]
 gi|166224067|sp|A1S3S7|RS21_SHEAM RecName: Full=30S ribosomal protein S21
 gi|119766463|gb|ABL99033.1| SSU ribosomal protein S21P [Shewanella amazonensis SB2B]
          Length = 71

 Score = 40.3 bits (93), Expect = 0.085,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   + ALR  K+  +  G+L +++ R  YEKP+  R R K+ A++R  K +
Sbjct: 1  MPIVKVRENEPFDVALRRFKRSCEKAGILADVRAREFYEKPTTARKRAKAAAVKRLAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|303238660|ref|ZP_07325193.1| ribosomal protein S21 [Acetivibrio cellulolyticus CD2]
 gi|302593779|gb|EFL63494.1| ribosomal protein S21 [Acetivibrio cellulolyticus CD2]
          Length = 58

 Score = 40.3 bits (93), Expect = 0.085,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             V V++N  ++ AL+  K++    GVL E++ R HYEKPS KR +    A +R  K
Sbjct: 1  MSEVRVKENESLDSALKRFKRQCAKAGVLAEVRKREHYEKPSVKRKKKSEAARKRKFK 58


>gi|238924195|ref|YP_002937711.1| hypothetical protein EUBREC_1833 [Eubacterium rectale ATCC 33656]
 gi|240144244|ref|ZP_04742845.1| ribosomal protein S21 [Roseburia intestinalis L1-82]
 gi|259494885|sp|C4ZAS2|RS21_EUBR3 RecName: Full=30S ribosomal protein S21
 gi|238875870|gb|ACR75577.1| Hypothetical protein EUBREC_1833 [Eubacterium rectale ATCC 33656]
 gi|257203742|gb|EEV02027.1| ribosomal protein S21 [Roseburia intestinalis L1-82]
 gi|291524922|emb|CBK90509.1| SSU ribosomal protein S21P [Eubacterium rectale DSM 17629]
 gi|291529063|emb|CBK94649.1| SSU ribosomal protein S21P [Eubacterium rectale M104/1]
 gi|291536490|emb|CBL09602.1| SSU ribosomal protein S21P [Roseburia intestinalis M50/1]
 gi|291538641|emb|CBL11752.1| SSU ribosomal protein S21P [Roseburia intestinalis XB6B4]
          Length = 58

 Score = 40.3 bits (93), Expect = 0.085,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS KR +    A +R
Sbjct: 1  MSSVIVKENETLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVKRKKKSEAARKR 55


>gi|167746979|ref|ZP_02419106.1| hypothetical protein ANACAC_01691 [Anaerostipes caccae DSM 14662]
 gi|317471792|ref|ZP_07931130.1| ribosomal protein S21 [Anaerostipes sp. 3_2_56FAA]
 gi|167653939|gb|EDR98068.1| hypothetical protein ANACAC_01691 [Anaerostipes caccae DSM 14662]
 gi|316900718|gb|EFV22694.1| ribosomal protein S21 [Anaerostipes sp. 3_2_56FAA]
          Length = 58

 Score = 40.3 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R  K
Sbjct: 1  MSNVIVKENESLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKRKVK 58


>gi|170583085|ref|XP_001896422.1| 28S ribosomal protein S21, mitochondrial [Brugia malayi]
 gi|312067977|ref|XP_003136997.1| 28S ribosomal protein S21 [Loa loa]
 gi|158596349|gb|EDP34706.1| 28S ribosomal protein S21, mitochondrial, putative [Brugia
          malayi]
 gi|307767837|gb|EFO27071.1| 28S ribosomal protein S21 [Loa loa]
          Length = 111

 Score = 40.3 bits (93), Expect = 0.086,   Method: Composition-based stats.
 Identities = 20/68 (29%), Positives = 29/68 (42%)

Query: 4  FNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRV 63
             F  I           VLV +N+V  A  +L + M  EG+L  L+   +Y KP  +R 
Sbjct: 15 IKLFWNIHHAHPRFLNKTVLVVNNDVTAAFHLLNRLMNNEGLLDILRKTRYYRKPYMQRN 74

Query: 64 RLKSEAIR 71
           L  E  +
Sbjct: 75 ELSREISK 82


>gi|225466025|ref|XP_002266973.1| PREDICTED: hypothetical protein [Vitis vinifera]
          Length = 810

 Score = 40.3 bits (93), Expect = 0.087,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 10  IFSEGREISAVYVLVRDNNVEQALRVL----KKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
           +  E R +  +Y + +  N++ A R L    K++++    L+E+K++    +   ++ + 
Sbjct: 334 LRVELRHVRGIYAMAQSENID-ASRKLNDLSKRRLEEADKLKEIKLKEEEARELARKEKE 392

Query: 66  KSEAIRRSRKLMRKIAQREGAPVSRL 91
           K EA +R  +  R+ A++E       
Sbjct: 393 KYEAAKREAEYARECAEKEALQRKEA 418


>gi|69245353|ref|ZP_00603397.1| Ribosomal protein S21 [Enterococcus faecium DO]
 gi|227551975|ref|ZP_03982024.1| ribosomal protein S21 [Enterococcus faecium TX1330]
 gi|257879923|ref|ZP_05659576.1| ribosomal protein S21 [Enterococcus faecium 1,230,933]
 gi|257882773|ref|ZP_05662426.1| ribosomal protein S21 [Enterococcus faecium 1,231,502]
 gi|257884081|ref|ZP_05663734.1| ribosomal protein S21 [Enterococcus faecium 1,231,501]
 gi|257886859|ref|ZP_05666512.1| ribosomal protein S21 [Enterococcus faecium 1,141,733]
 gi|257890438|ref|ZP_05670091.1| ribosomal protein S21 [Enterococcus faecium 1,231,410]
 gi|257893044|ref|ZP_05672697.1| ribosomal protein S21 [Enterococcus faecium 1,231,408]
 gi|257895433|ref|ZP_05675086.1| ribosomal protein S21 [Enterococcus faecium Com12]
 gi|257898038|ref|ZP_05677691.1| ribosomal protein S21 [Enterococcus faecium Com15]
 gi|258616610|ref|ZP_05714380.1| 30S ribosomal protein S21 [Enterococcus faecium DO]
 gi|260559568|ref|ZP_05831748.1| ribosomal protein S21 [Enterococcus faecium C68]
 gi|261208631|ref|ZP_05923068.1| ribosomal protein S21 [Enterococcus faecium TC 6]
 gi|289566109|ref|ZP_06446545.1| 30S ribosomal protein S21 [Enterococcus faecium D344SRF]
 gi|293378300|ref|ZP_06624469.1| ribosomal protein S21 [Enterococcus faecium PC4.1]
 gi|293556355|ref|ZP_06674936.1| ribosomal protein S21 [Enterococcus faecium E1039]
 gi|293559421|ref|ZP_06675960.1| ribosomal protein S21 [Enterococcus faecium E1162]
 gi|293568662|ref|ZP_06679977.1| ribosomal protein S21 [Enterococcus faecium E1071]
 gi|293571614|ref|ZP_06682635.1| ribosomal protein S21 [Enterococcus faecium E980]
 gi|294616311|ref|ZP_06696104.1| ribosomal protein S21 [Enterococcus faecium E1636]
 gi|294617876|ref|ZP_06697486.1| ribosomal protein S21 [Enterococcus faecium E1679]
 gi|294622991|ref|ZP_06701880.1| ribosomal protein S21 [Enterococcus faecium U0317]
 gi|314939548|ref|ZP_07846776.1| ribosomal protein S21 [Enterococcus faecium TX0133a04]
 gi|314942698|ref|ZP_07849524.1| ribosomal protein S21 [Enterococcus faecium TX0133C]
 gi|314948964|ref|ZP_07852330.1| ribosomal protein S21 [Enterococcus faecium TX0082]
 gi|314953312|ref|ZP_07856240.1| ribosomal protein S21 [Enterococcus faecium TX0133A]
 gi|314993391|ref|ZP_07858756.1| ribosomal protein S21 [Enterococcus faecium TX0133B]
 gi|314995741|ref|ZP_07860830.1| ribosomal protein S21 [Enterococcus faecium TX0133a01]
 gi|332686720|ref|YP_004456494.1| 30S ribosomal protein S21p [Melissococcus plutonius ATCC 35311]
 gi|68195883|gb|EAN10318.1| Ribosomal protein S21 [Enterococcus faecium DO]
 gi|227178880|gb|EEI59852.1| ribosomal protein S21 [Enterococcus faecium TX1330]
 gi|257814151|gb|EEV42909.1| ribosomal protein S21 [Enterococcus faecium 1,230,933]
 gi|257818431|gb|EEV45759.1| ribosomal protein S21 [Enterococcus faecium 1,231,502]
 gi|257819919|gb|EEV47067.1| ribosomal protein S21 [Enterococcus faecium 1,231,501]
 gi|257822913|gb|EEV49845.1| ribosomal protein S21 [Enterococcus faecium 1,141,733]
 gi|257826798|gb|EEV53424.1| ribosomal protein S21 [Enterococcus faecium 1,231,410]
 gi|257829423|gb|EEV56030.1| ribosomal protein S21 [Enterococcus faecium 1,231,408]
 gi|257831998|gb|EEV58419.1| ribosomal protein S21 [Enterococcus faecium Com12]
 gi|257835950|gb|EEV61024.1| ribosomal protein S21 [Enterococcus faecium Com15]
 gi|260074236|gb|EEW62558.1| ribosomal protein S21 [Enterococcus faecium C68]
 gi|260077133|gb|EEW64853.1| ribosomal protein S21 [Enterococcus faecium TC 6]
 gi|289162131|gb|EFD09995.1| 30S ribosomal protein S21 [Enterococcus faecium D344SRF]
 gi|291588622|gb|EFF20455.1| ribosomal protein S21 [Enterococcus faecium E1071]
 gi|291590825|gb|EFF22541.1| ribosomal protein S21 [Enterococcus faecium E1636]
 gi|291595894|gb|EFF27177.1| ribosomal protein S21 [Enterococcus faecium E1679]
 gi|291597547|gb|EFF28709.1| ribosomal protein S21 [Enterococcus faecium U0317]
 gi|291601422|gb|EFF31693.1| ribosomal protein S21 [Enterococcus faecium E1039]
 gi|291606635|gb|EFF36030.1| ribosomal protein S21 [Enterococcus faecium E1162]
 gi|291608284|gb|EFF37585.1| ribosomal protein S21 [Enterococcus faecium E980]
 gi|292643164|gb|EFF61305.1| ribosomal protein S21 [Enterococcus faecium PC4.1]
 gi|313590013|gb|EFR68858.1| ribosomal protein S21 [Enterococcus faecium TX0133a01]
 gi|313592056|gb|EFR70901.1| ribosomal protein S21 [Enterococcus faecium TX0133B]
 gi|313594655|gb|EFR73500.1| ribosomal protein S21 [Enterococcus faecium TX0133A]
 gi|313598563|gb|EFR77408.1| ribosomal protein S21 [Enterococcus faecium TX0133C]
 gi|313641184|gb|EFS05764.1| ribosomal protein S21 [Enterococcus faecium TX0133a04]
 gi|313644623|gb|EFS09203.1| ribosomal protein S21 [Enterococcus faecium TX0082]
 gi|332370729|dbj|BAK21685.1| SSU ribosomal protein S21p [Melissococcus plutonius ATCC 35311]
          Length = 58

 Score = 40.3 bits (93), Expect = 0.087,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 32/57 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS +R +    A +R +
Sbjct: 1  MSKTVVRKNESLDDALRRFKRSVSKAGTLQESRKREFYEKPSVRRKKKSEAARKRKK 57


>gi|258593494|emb|CBE69833.1| 30S ribosomal protein S21 [NC10 bacterium 'Dutch sediment']
          Length = 65

 Score = 40.3 bits (93), Expect = 0.088,   Method: Composition-based stats.
 Identities = 24/59 (40%), Positives = 33/59 (55%), Gaps = 1/59 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
             V V++N   E ALR  KK  +  GVL EL+ R HYEKPS +R +    A +++ K 
Sbjct: 1  MASVTVKENEPFEVALRRFKKLCERTGVLTELRKREHYEKPSVRRKKKSIAARKKALKR 59


>gi|260892055|ref|YP_003238152.1| ribosomal protein S21 [Ammonifex degensii KC4]
 gi|260864196|gb|ACX51302.1| ribosomal protein S21 [Ammonifex degensii KC4]
          Length = 58

 Score = 40.3 bits (93), Expect = 0.089,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 29/51 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          ++ +++ ALR  K+  Q  G+L E +   +YEKPS +R +    A RR  +
Sbjct: 8  KNESLDSALRRFKRLCQKAGILAEARRHEYYEKPSARRKKKNEAARRRRSR 58


>gi|241888669|ref|ZP_04775976.1| ribosomal protein S21 [Gemella haemolysans ATCC 10379]
 gi|317495996|ref|ZP_07954358.1| ribosomal protein S21 [Gemella moribillum M424]
 gi|329768015|ref|ZP_08259526.1| 30S ribosomal protein S21 [Gemella haemolysans M341]
 gi|241864692|gb|EER69067.1| ribosomal protein S21 [Gemella haemolysans ATCC 10379]
 gi|316913900|gb|EFV35384.1| ribosomal protein S21 [Gemella moribillum M424]
 gi|328838500|gb|EGF88108.1| 30S ribosomal protein S21 [Gemella haemolysans M341]
          Length = 57

 Score = 40.3 bits (93), Expect = 0.089,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 32/55 (58%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G ++E++ R  YEKPS +R +    A +R
Sbjct: 1  MSKTVVRKNESLEDALRRFKRAVSKNGTIQEVRKREFYEKPSVRRKKKSEAARKR 55


>gi|220929510|ref|YP_002506419.1| 30S ribosomal protein S21 [Clostridium cellulolyticum H10]
 gi|326204669|ref|ZP_08194525.1| ribosomal protein S21 [Clostridium papyrosolvens DSM 2782]
 gi|254813610|sp|B8I406|RS21_CLOCE RecName: Full=30S ribosomal protein S21
 gi|219999838|gb|ACL76439.1| ribosomal protein S21 [Clostridium cellulolyticum H10]
 gi|325985236|gb|EGD46076.1| ribosomal protein S21 [Clostridium papyrosolvens DSM 2782]
          Length = 58

 Score = 40.3 bits (93), Expect = 0.089,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             V V++N  ++ AL+  K+     GVL E++ R HYEKPS KR +    A +R  K
Sbjct: 1  MSEVRVKENESLDSALKRFKRSCAKSGVLAEVRKREHYEKPSVKRKKKSEAARKRKFK 58


>gi|78064821|ref|YP_367590.1| 30S ribosomal protein S21 [Burkholderia sp. 383]
 gi|107024407|ref|YP_622734.1| 30S ribosomal protein S21 [Burkholderia cenocepacia AU 1054]
 gi|115350213|ref|YP_772052.1| 30S ribosomal protein S21 [Burkholderia ambifaria AMMD]
 gi|116688266|ref|YP_833889.1| 30S ribosomal protein S21 [Burkholderia cenocepacia HI2424]
 gi|134294318|ref|YP_001118053.1| 30S ribosomal protein S21 [Burkholderia vietnamiensis G4]
 gi|161523332|ref|YP_001578344.1| 30S ribosomal protein S21 [Burkholderia multivorans ATCC 17616]
 gi|167564520|ref|ZP_02357436.1| 30S ribosomal protein S21 [Burkholderia oklahomensis EO147]
 gi|167571669|ref|ZP_02364543.1| 30S ribosomal protein S21 [Burkholderia oklahomensis C6786]
 gi|167589226|ref|ZP_02381614.1| 30S ribosomal protein S21 [Burkholderia ubonensis Bu]
 gi|170698741|ref|ZP_02889806.1| ribosomal protein S21 [Burkholderia ambifaria IOP40-10]
 gi|170731579|ref|YP_001763526.1| 30S ribosomal protein S21 [Burkholderia cenocepacia MC0-3]
 gi|171320231|ref|ZP_02909289.1| ribosomal protein S21 [Burkholderia ambifaria MEX-5]
 gi|172059235|ref|YP_001806887.1| 30S ribosomal protein S21 [Burkholderia ambifaria MC40-6]
 gi|189351895|ref|YP_001947523.1| 30S ribosomal protein S21 [Burkholderia multivorans ATCC 17616]
 gi|206558521|ref|YP_002229281.1| 30S ribosomal protein S21 [Burkholderia cenocepacia J2315]
 gi|221202117|ref|ZP_03575152.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2M]
 gi|221209075|ref|ZP_03582070.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2]
 gi|221214237|ref|ZP_03587209.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD1]
 gi|238025846|ref|YP_002910077.1| 30S ribosomal protein S21 [Burkholderia glumae BGR1]
 gi|254246748|ref|ZP_04940069.1| 30S ribosomal protein S21 [Burkholderia cenocepacia PC184]
 gi|254250918|ref|ZP_04944236.1| 30S ribosomal protein S2 [Burkholderia dolosa AUO158]
 gi|330815137|ref|YP_004358842.1| 30S ribosomal protein S21 [Burkholderia gladioli BSR3]
 gi|17863800|gb|AAL46935.1| ribosomal subunit S21 [Burkholderia cepacia ATCC 25416]
 gi|17863802|gb|AAL46936.1| ribosomal subunit S21 [Burkholderia gladioli]
 gi|17863804|gb|AAL46937.1| ribosomal subunit S21 [Burkholderia plantarii]
 gi|17863810|gb|AAL46940.1| ribosomal subunit S21 [Burkholderia plantarii]
 gi|17863812|gb|AAL46941.1| ribosomal subunit S21 [Burkholderia vietnamiensis]
 gi|77965566|gb|ABB06946.1| SSU ribosomal protein S21P [Burkholderia sp. 383]
 gi|105894596|gb|ABF77761.1| SSU ribosomal protein S21P [Burkholderia cenocepacia AU 1054]
 gi|115280201|gb|ABI85718.1| SSU ribosomal protein S21P [Burkholderia ambifaria AMMD]
 gi|116646355|gb|ABK06996.1| SSU ribosomal protein S21P [Burkholderia cenocepacia HI2424]
 gi|124871524|gb|EAY63240.1| 30S ribosomal protein S21 [Burkholderia cenocepacia PC184]
 gi|124893527|gb|EAY67407.1| 30S ribosomal protein S2 [Burkholderia dolosa AUO158]
 gi|134137475|gb|ABO53218.1| SSU ribosomal protein S21P [Burkholderia vietnamiensis G4]
 gi|160340761|gb|ABX13847.1| ribosomal protein S21 [Burkholderia multivorans ATCC 17616]
 gi|169814821|gb|ACA89404.1| ribosomal protein S21 [Burkholderia cenocepacia MC0-3]
 gi|170136366|gb|EDT04629.1| ribosomal protein S21 [Burkholderia ambifaria IOP40-10]
 gi|171094520|gb|EDT39576.1| ribosomal protein S21 [Burkholderia ambifaria MEX-5]
 gi|171991752|gb|ACB62671.1| ribosomal protein S21 [Burkholderia ambifaria MC40-6]
 gi|189335917|dbj|BAG44987.1| small subunit ribosomal protein S21 [Burkholderia multivorans
          ATCC 17616]
 gi|198034558|emb|CAR50423.1| 30S ribosomal protein S21 1 [Burkholderia cenocepacia J2315]
 gi|221165892|gb|EED98366.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD1]
 gi|221171070|gb|EEE03522.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2]
 gi|221177911|gb|EEE10323.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2M]
 gi|237875040|gb|ACR27373.1| 30S ribosomal protein S21 [Burkholderia glumae BGR1]
 gi|325520737|gb|EGC99764.1| 30S ribosomal protein S21 [Burkholderia sp. TJI49]
 gi|327367530|gb|AEA58886.1| 30S ribosomal protein S21 [Burkholderia gladioli BSR3]
          Length = 70

 Score = 40.3 bits (93), Expect = 0.089,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 33/62 (53%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   E A+R  ++ ++  G++ EL+ R  YEKP+  R R K+ A++R  K +R     +
Sbjct: 8  ENEPFEVAIRRFRRAIEKNGLIAELRERQSYEKPTAVRKRKKAAAVKRLHKRLRSQMLPK 67

Query: 85 GA 86
            
Sbjct: 68 KL 69


>gi|313891669|ref|ZP_07825276.1| ribosomal protein S21 [Dialister microaerophilus UPII 345-E]
 gi|329122068|ref|ZP_08250676.1| 30S ribosomal protein S21 [Dialister micraerophilus DSM 19965]
 gi|313119947|gb|EFR43132.1| ribosomal protein S21 [Dialister microaerophilus UPII 345-E]
 gi|327466875|gb|EGF12391.1| 30S ribosomal protein S21 [Dialister micraerophilus DSM 19965]
          Length = 58

 Score = 40.3 bits (93), Expect = 0.090,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  +++ ALR  K+  Q  GVL E++ R HYEKPS +R      A +R  K
Sbjct: 8  KGESLDSALRRFKRSCQKAGVLSEVRKREHYEKPSVRRKLKSEAARKRKFK 58


>gi|47093475|ref|ZP_00231238.1| ribosomal protein S21 [Listeria monocytogenes str. 4b H7858]
 gi|47095421|ref|ZP_00233031.1| ribosomal protein S21 [Listeria monocytogenes str. 1/2a F6854]
 gi|258611455|ref|ZP_05232444.2| ribosomal protein S21 [Listeria monocytogenes FSL N3-165]
 gi|258611687|ref|ZP_05241442.2| ribosomal protein S21 [Listeria monocytogenes FSL R2-503]
 gi|258612161|ref|ZP_05268168.2| ribosomal protein S21 [Listeria monocytogenes F6900]
 gi|290894230|ref|ZP_06557199.1| ribosomal protein S21 [Listeria monocytogenes FSL J2-071]
 gi|293596228|ref|ZP_05229473.2| ribosomal protein S21 [Listeria monocytogenes FSL J1-194]
 gi|293596549|ref|ZP_05262155.2| ribosomal protein S21 [Listeria monocytogenes J2818]
 gi|293596957|ref|ZP_05266013.2| ribosomal protein S21 [Listeria monocytogenes HPB2262]
 gi|300765612|ref|ZP_07075591.1| ribosomal protein S21 [Listeria monocytogenes FSL N1-017]
 gi|47016242|gb|EAL07165.1| ribosomal protein S21 [Listeria monocytogenes str. 1/2a F6854]
 gi|47018151|gb|EAL08921.1| ribosomal protein S21 [Listeria monocytogenes str. 4b H7858]
 gi|258600137|gb|EEW13462.1| ribosomal protein S21 [Listeria monocytogenes FSL N3-165]
 gi|258605394|gb|EEW18002.1| ribosomal protein S21 [Listeria monocytogenes FSL R2-503]
 gi|258609064|gb|EEW21672.1| ribosomal protein S21 [Listeria monocytogenes F6900]
 gi|290556227|gb|EFD89772.1| ribosomal protein S21 [Listeria monocytogenes FSL J2-071]
 gi|293584213|gb|EFF96245.1| ribosomal protein S21 [Listeria monocytogenes HPB2262]
 gi|293590115|gb|EFF98449.1| ribosomal protein S21 [Listeria monocytogenes J2818]
 gi|293593709|gb|EFG01470.1| ribosomal protein S21 [Listeria monocytogenes FSL J1-194]
 gi|300513713|gb|EFK40781.1| ribosomal protein S21 [Listeria monocytogenes FSL N1-017]
          Length = 68

 Score = 40.3 bits (93), Expect = 0.093,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 31/60 (51%)

Query: 13 EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
                +  V+ ++ ++E ALR  K+ +   G L+E + R  YEKPS KR +    A +R
Sbjct: 7  GREREMSKTVVRKNESLEDALRRFKRTVSKSGTLQESRKREFYEKPSVKRKKKSEAARKR 66


>gi|330836368|ref|YP_004411009.1| 30S ribosomal protein S21P [Spirochaeta coccoides DSM 17374]
 gi|329748271|gb|AEC01627.1| SSU ribosomal protein S21P [Spirochaeta coccoides DSM 17374]
          Length = 72

 Score = 40.3 bits (93), Expect = 0.094,   Method: Composition-based stats.
 Identities = 23/64 (35%), Positives = 38/64 (59%), Gaps = 1/64 (1%)

Query: 22 VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
          V V DN  +E++++  K+ ++ EG++RE K R +YEKPS    R      RR  K +RK+
Sbjct: 7  VRVDDNEPLEKSIKRFKRMVEKEGIIREWKKREYYEKPSTILNRKNKAMSRRQLKKVRKL 66

Query: 81 AQRE 84
            ++
Sbjct: 67 HNQK 70


>gi|294501298|ref|YP_003564998.1| 30S ribosomal protein S21 [Bacillus megaterium QM B1551]
 gi|295706645|ref|YP_003599720.1| 30S ribosomal protein S21 [Bacillus megaterium DSM 319]
 gi|294351235|gb|ADE71564.1| 30S ribosomal protein S21 [Bacillus megaterium QM B1551]
 gi|294804304|gb|ADF41370.1| 30S ribosomal protein S21 [Bacillus megaterium DSM 319]
          Length = 57

 Score = 40.3 bits (93), Expect = 0.094,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G L+E + R  YEKPS KR +    A +R
Sbjct: 1  MSRTVVRKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSVKRKKKSEAARKR 55


>gi|170699812|ref|ZP_02890844.1| ribosomal protein S21 [Burkholderia ambifaria IOP40-10]
 gi|170135264|gb|EDT03560.1| ribosomal protein S21 [Burkholderia ambifaria IOP40-10]
          Length = 70

 Score = 40.3 bits (93), Expect = 0.094,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 35/61 (57%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREG 85
          +  V+ ALR  ++ ++  G++REL+ R  YEKP+ +R R K+ A+ R R   +++     
Sbjct: 9  NEPVDVALRRFRRDIEKTGLIRELRSRTGYEKPTTQRKREKASAVARQRLRAKRMLPPRK 68

Query: 86 A 86
           
Sbjct: 69 P 69


>gi|83716560|ref|YP_439198.1| 30S ribosomal protein S21 [Burkholderia thailandensis E264]
 gi|167577640|ref|ZP_02370514.1| 30S ribosomal protein S21 [Burkholderia thailandensis TXDOH]
 gi|167615782|ref|ZP_02384417.1| 30S ribosomal protein S21 [Burkholderia thailandensis Bt4]
 gi|257142320|ref|ZP_05590582.1| 30S ribosomal protein S21 [Burkholderia thailandensis E264]
 gi|119367227|sp|Q2T6K1|RS213_BURTA RecName: Full=30S ribosomal protein S21 3
 gi|83650385|gb|ABC34449.1| ribosomal protein S21 [Burkholderia thailandensis E264]
          Length = 70

 Score = 40.3 bits (93), Expect = 0.094,   Method: Composition-based stats.
 Identities = 21/56 (37%), Positives = 36/56 (64%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
          +  VE ALR  ++ ++  G+++EL+ R  YEKP+ +R R K+ A+ R RK +R+  
Sbjct: 9  NEPVEVALRRFRRSIEKTGLIKELRARTSYEKPTTERKRKKAAAVARLRKQVRRSM 64


>gi|255077428|ref|XP_002502355.1| predicted protein [Micromonas sp. RCC299]
 gi|226517620|gb|ACO63613.1| predicted protein [Micromonas sp. RCC299]
          Length = 110

 Score = 40.3 bits (93), Expect = 0.094,   Method: Composition-based stats.
 Identities = 14/58 (24%), Positives = 27/58 (46%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQ 82
           + N E A+R  ++ +   G + E + R ++E P   + R +S   ++     R  AQ
Sbjct: 26 ENENGESAIRRFRRAVMSSGHINETRRRRYFENPQDIKKRKQSTPRKKKGAKPRTAAQ 83


>gi|186477733|ref|YP_001859203.1| 30S ribosomal protein S21 [Burkholderia phymatum STM815]
 gi|184194192|gb|ACC72157.1| ribosomal protein S21 [Burkholderia phymatum STM815]
          Length = 70

 Score = 40.3 bits (93), Expect = 0.094,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 33/62 (53%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   E A+R  ++ ++  G++ EL+ R  YEKP+  R R K+ A++R  K +R     +
Sbjct: 8  ENEPFEVAIRRFRRAIEKNGLIAELRERQAYEKPTTARKRKKAAAVKRLHKRLRSQMLPK 67

Query: 85 GA 86
            
Sbjct: 68 KL 69


>gi|325661655|ref|ZP_08150279.1| 30S ribosomal protein S21 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|331084750|ref|ZP_08333838.1| 30S ribosomal protein S21 [Lachnospiraceae bacterium 9_1_43BFAA]
 gi|325472182|gb|EGC75396.1| 30S ribosomal protein S21 [Lachnospiraceae bacterium 4_1_37FAA]
 gi|330410844|gb|EGG90266.1| 30S ribosomal protein S21 [Lachnospiraceae bacterium 9_1_43BFAA]
          Length = 58

 Score = 40.3 bits (93), Expect = 0.095,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             V+V+DN  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R
Sbjct: 1  MSNVIVKDNETLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKR 55


>gi|210615764|ref|ZP_03290745.1| hypothetical protein CLONEX_02963 [Clostridium nexile DSM 1787]
 gi|239623767|ref|ZP_04666798.1| conserved hypothetical protein [Clostridiales bacterium
          1_7_47_FAA]
 gi|210150100|gb|EEA81109.1| hypothetical protein CLONEX_02963 [Clostridium nexile DSM 1787]
 gi|239521798|gb|EEQ61664.1| conserved hypothetical protein [Clostridiales bacterium
          1_7_47FAA]
          Length = 58

 Score = 40.3 bits (93), Expect = 0.095,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             V+V+DN  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R
Sbjct: 1  MSNVIVKDNETLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKR 55


>gi|160939112|ref|ZP_02086463.1| hypothetical protein CLOBOL_04006 [Clostridium bolteae ATCC
          BAA-613]
 gi|225389079|ref|ZP_03758803.1| hypothetical protein CLOSTASPAR_02825 [Clostridium asparagiforme
          DSM 15981]
 gi|266623019|ref|ZP_06115954.1| ribosomal protein S21 [Clostridium hathewayi DSM 13479]
 gi|283797893|ref|ZP_06347046.1| ribosomal protein S21 [Clostridium sp. M62/1]
 gi|302386452|ref|YP_003822274.1| ribosomal protein S21 [Clostridium saccharolyticum WM1]
 gi|323486957|ref|ZP_08092272.1| LOW QUALITY PROTEIN: 30S ribosomal protein S21 [Clostridium
          symbiosum WAL-14163]
 gi|323692005|ref|ZP_08106253.1| 30S ribosomal protein S21 [Clostridium symbiosum WAL-14673]
 gi|158438075|gb|EDP15835.1| hypothetical protein CLOBOL_04006 [Clostridium bolteae ATCC
          BAA-613]
 gi|225044857|gb|EEG55103.1| hypothetical protein CLOSTASPAR_02825 [Clostridium asparagiforme
          DSM 15981]
 gi|288865218|gb|EFC97516.1| ribosomal protein S21 [Clostridium hathewayi DSM 13479]
 gi|291074357|gb|EFE11721.1| ribosomal protein S21 [Clostridium sp. M62/1]
 gi|291563233|emb|CBL42049.1| SSU ribosomal protein S21P [butyrate-producing bacterium SS3/4]
 gi|295091901|emb|CBK78008.1| SSU ribosomal protein S21P [Clostridium cf. saccharolyticum K10]
 gi|302197080|gb|ADL04651.1| ribosomal protein S21 [Clostridium saccharolyticum WM1]
 gi|323399729|gb|EGA92112.1| LOW QUALITY PROTEIN: 30S ribosomal protein S21 [Clostridium
          symbiosum WAL-14163]
 gi|323503928|gb|EGB19742.1| 30S ribosomal protein S21 [Clostridium symbiosum WAL-14673]
          Length = 58

 Score = 40.3 bits (93), Expect = 0.095,   Method: Composition-based stats.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             V+V+DN  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R
Sbjct: 1  MSNVIVKDNESLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKR 55


>gi|16800574|ref|NP_470842.1| 30S ribosomal protein S21 [Listeria innocua Clip11262]
 gi|16803509|ref|NP_464994.1| 30S ribosomal protein S21 [Listeria monocytogenes EGD-e]
 gi|46907697|ref|YP_014086.1| 30S ribosomal protein S21 [Listeria monocytogenes serotype 4b
          str. F2365]
 gi|116872900|ref|YP_849681.1| 30S ribosomal protein S21 [Listeria welshimeri serovar 6b str.
          SLCC5334]
 gi|217964385|ref|YP_002350063.1| ribosomal protein S21 [Listeria monocytogenes HCC23]
 gi|224500511|ref|ZP_03668860.1| 30S ribosomal protein S21 [Listeria monocytogenes Finland 1988]
 gi|224501591|ref|ZP_03669898.1| 30S ribosomal protein S21 [Listeria monocytogenes FSL R2-561]
 gi|226224070|ref|YP_002758177.1| 30S ribosomal protein S21 [Listeria monocytogenes Clip81459]
 gi|254829772|ref|ZP_05234427.1| 30S ribosomal protein S21 [Listeria monocytogenes 10403S]
 gi|254898365|ref|ZP_05258289.1| 30S ribosomal protein S21 [Listeria monocytogenes J0161]
 gi|254991898|ref|ZP_05274088.1| 30S ribosomal protein S21 [Listeria monocytogenes FSL J2-064]
 gi|255017886|ref|ZP_05290012.1| 30S ribosomal protein S21 [Listeria monocytogenes FSL F2-515]
 gi|255029414|ref|ZP_05301365.1| 30S ribosomal protein S21 [Listeria monocytogenes LO28]
 gi|255521823|ref|ZP_05389060.1| 30S ribosomal protein S21 [Listeria monocytogenes FSL J1-175]
 gi|284801856|ref|YP_003413721.1| 30S ribosomal protein S21 [Listeria monocytogenes 08-5578]
 gi|284994998|ref|YP_003416766.1| 30S ribosomal protein S21 [Listeria monocytogenes 08-5923]
 gi|289434751|ref|YP_003464623.1| 30S ribosomal protein S21 [Listeria seeligeri serovar 1/2b str.
          SLCC3954]
 gi|315282368|ref|ZP_07870794.1| ribosomal protein S21 [Listeria marthii FSL S4-120]
 gi|315303208|ref|ZP_07873864.1| ribosomal protein S21 [Listeria ivanovii FSL F6-596]
 gi|61215962|sp|Q71ZK1|RS21_LISMF RecName: Full=30S ribosomal protein S21
 gi|61236866|sp|P0A4B9|RS21_LISMO RecName: Full=30S ribosomal protein S21
 gi|61236873|sp|P0A4C0|RS21_LISIN RecName: Full=30S ribosomal protein S21
 gi|123458475|sp|A0AIS0|RS21_LISW6 RecName: Full=30S ribosomal protein S21
 gi|254813722|sp|B8DE42|RS21_LISMH RecName: Full=30S ribosomal protein S21
 gi|259494890|sp|C1KVB6|RS21_LISMC RecName: Full=30S ribosomal protein S21
 gi|5689043|dbj|BAA82793.1| 30S ribosomal protein S21 [Listeria monocytogenes]
 gi|16410898|emb|CAC99547.1| 30S ribosomal protein S21 [Listeria monocytogenes EGD-e]
 gi|16413979|emb|CAC96737.1| 30S ribosomal protein S21 [Listeria innocua Clip11262]
 gi|46880966|gb|AAT04263.1| ribosomal protein S21 [Listeria monocytogenes serotype 4b str.
          F2365]
 gi|116741778|emb|CAK20902.1| 30S ribosomal protein S21 [Listeria welshimeri serovar 6b str.
          SLCC5334]
 gi|217333655|gb|ACK39449.1| ribosomal protein S21 [Listeria monocytogenes HCC23]
 gi|225876532|emb|CAS05241.1| 30S ribosomal protein S21 [Listeria monocytogenes serotype 4b
          str. CLIP 80459]
 gi|284057418|gb|ADB68359.1| 30S ribosomal protein S21 [Listeria monocytogenes 08-5578]
 gi|284060465|gb|ADB71404.1| 30S ribosomal protein S21 [Listeria monocytogenes 08-5923]
 gi|289170995|emb|CBH27537.1| 30S ribosomal protein S21 [Listeria seeligeri serovar 1/2b str.
          SLCC3954]
 gi|307571050|emb|CAR84229.1| ribosomal protein S21 [Listeria monocytogenes L99]
 gi|313608745|gb|EFR84565.1| ribosomal protein S21 [Listeria monocytogenes FSL F2-208]
 gi|313613988|gb|EFR87706.1| ribosomal protein S21 [Listeria marthii FSL S4-120]
 gi|313618885|gb|EFR90751.1| ribosomal protein S21 [Listeria innocua FSL S4-378]
 gi|313623732|gb|EFR93876.1| ribosomal protein S21 [Listeria innocua FSL J1-023]
 gi|313628423|gb|EFR96900.1| ribosomal protein S21 [Listeria ivanovii FSL F6-596]
 gi|313633226|gb|EFS00098.1| ribosomal protein S21 [Listeria seeligeri FSL N1-067]
 gi|313637805|gb|EFS03150.1| ribosomal protein S21 [Listeria seeligeri FSL S4-171]
 gi|328474980|gb|EGF45774.1| 30S ribosomal protein S21 [Listeria monocytogenes 220]
 gi|332311911|gb|EGJ25006.1| 30S ribosomal protein S21 [Listeria monocytogenes str. Scott A]
          Length = 57

 Score = 40.3 bits (93), Expect = 0.095,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G L+E + R  YEKPS KR +    A +R
Sbjct: 1  MSKTVVRKNESLEDALRRFKRTVSKSGTLQESRKREFYEKPSVKRKKKSEAARKR 55


>gi|297745064|emb|CBI38656.3| unnamed protein product [Vitis vinifera]
          Length = 784

 Score = 40.3 bits (93), Expect = 0.096,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 42/86 (48%), Gaps = 5/86 (5%)

Query: 10  IFSEGREISAVYVLVRDNNVEQALRVL----KKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
           +  E R +  +Y + +  N++ A R L    K++++    L+E+K++    +   ++ + 
Sbjct: 308 LRVELRHVRGIYAMAQSENID-ASRKLNDLSKRRLEEADKLKEIKLKEEEARELARKEKE 366

Query: 66  KSEAIRRSRKLMRKIAQREGAPVSRL 91
           K EA +R  +  R+ A++E       
Sbjct: 367 KYEAAKREAEYARECAEKEALQRKEA 392


>gi|307152355|ref|YP_003887739.1| 30S ribosomal protein S21 [Cyanothece sp. PCC 7822]
 gi|306982583|gb|ADN14464.1| ribosomal protein S21 [Cyanothece sp. PCC 7822]
          Length = 60

 Score = 40.3 bits (93), Expect = 0.096,   Method: Composition-based stats.
 Identities = 14/49 (28%), Positives = 24/49 (48%), Gaps = 1/49 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLK 66
             V+V  N  +E ALR  K+++   G+  ++K    +E P +K  R  
Sbjct: 1  MTQVVVGQNEAIESALRRFKRQVAKAGIYADIKKHQFFETPQEKHKRKA 49


>gi|218248007|ref|YP_002373378.1| 30S ribosomal protein S21 [Cyanothece sp. PCC 8801]
 gi|257060669|ref|YP_003138557.1| 30S ribosomal protein S21 [Cyanothece sp. PCC 8802]
 gi|218168485|gb|ACK67222.1| ribosomal protein S21 [Cyanothece sp. PCC 8801]
 gi|256590835|gb|ACV01722.1| ribosomal protein S21 [Cyanothece sp. PCC 8802]
          Length = 60

 Score = 40.3 bits (93), Expect = 0.096,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 26/50 (52%), Gaps = 1/50 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKS 67
             V+V  N  +E ALR  K+++   G+  + K    +E P +KR R ++
Sbjct: 1  MTQVVVGQNEPIESALRRFKRQVAKAGIYTDYKKHQFFETPQEKRKRKEA 50


>gi|163751575|ref|ZP_02158797.1| ribosomal protein S21 [Shewanella benthica KT99]
 gi|161328583|gb|EDP99736.1| ribosomal protein S21 [Shewanella benthica KT99]
          Length = 71

 Score = 40.3 bits (93), Expect = 0.098,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L +++ R  YEKP+  R R K+ A++R  K +
Sbjct: 1  MPIIKVRENEPFDVALRRFKRSCEKAGILADVRAREFYEKPTTARKRAKAAAVKRLAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRETARR 67


>gi|289449897|ref|YP_003475601.1| 30S ribosomal protein S21 [Clostridiales genomosp. BVAB3 str.
          UPII9-5]
 gi|289184444|gb|ADC90869.1| ribosomal protein S21 [Clostridiales genomosp. BVAB3 str.
          UPII9-5]
          Length = 57

 Score = 40.3 bits (93), Expect = 0.099,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             V V++N  ++ ALR  K+     GVL E++ R HYEKPS +R +    A +R
Sbjct: 1  MSEVRVKENESLDSALRRFKRSCARSGVLAEVRKREHYEKPSVRRKKKSEAARKR 55


>gi|163781699|ref|ZP_02176699.1| hypothetical protein HG1285_02413 [Hydrogenivirga sp. 128-5-R1-1]
 gi|159882919|gb|EDP76423.1| hypothetical protein HG1285_02413 [Hydrogenivirga sp. 128-5-R1-1]
          Length = 67

 Score = 40.3 bits (93), Expect = 0.099,   Method: Composition-based stats.
 Identities = 21/65 (32%), Positives = 36/65 (55%), Gaps = 1/65 (1%)

Query: 19 AVYVLVRDNNV-EQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V+V D    E+ LR  K+ +  E +L E+K R +YEKPS+++ + +    +R  K +
Sbjct: 1  MAVVIVHDGEPPEKVLRRFKRIVDQEQILTEVKRREYYEKPSERKKKRERARRKRILKAL 60

Query: 78 RKIAQ 82
          +K  Q
Sbjct: 61 KKQQQ 65


>gi|169832191|ref|YP_001718173.1| 30S ribosomal protein S21 [Candidatus Desulforudis audaxviator
          MP104C]
 gi|226694996|sp|B1I693|RS21_DESAP RecName: Full=30S ribosomal protein S21
 gi|169639035|gb|ACA60541.1| ribosomal protein S21 [Candidatus Desulforudis audaxviator
          MP104C]
          Length = 59

 Score = 40.3 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 27/50 (54%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          ++  ++ ALR  K+  Q  GV  E +   HYEKPS KR +    A RR R
Sbjct: 8  KNETLDSALRRFKRTCQRAGVFAEARKHEHYEKPSVKRKKKSEAARRRKR 57


>gi|241895556|ref|ZP_04782852.1| ribosomal protein S21 [Weissella paramesenteroides ATCC 33313]
 gi|241871134|gb|EER74885.1| ribosomal protein S21 [Weissella paramesenteroides ATCC 33313]
          Length = 61

 Score = 40.3 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 32/61 (52%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           A  V+ ++ +++ ALR  K+ +  +G L+E + R  Y KPS +R      A +R  K  
Sbjct: 1  MAKTVVRKNESLDDALRRFKRGVSKDGTLQEYRKREFYIKPSVQRKLKAEAARKRKNKKG 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|238024935|ref|YP_002909167.1| Ribosomal protein S21 [Burkholderia glumae BGR1]
 gi|237879600|gb|ACR31932.1| Ribosomal protein S21 [Burkholderia glumae BGR1]
          Length = 55

 Score = 40.3 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 31/54 (57%)

Query: 33 LRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGA 86
          +R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A++R  K +R     +  
Sbjct: 1  MRRFKRTIEKNGLLTELRAREFYEKPTAERKRKKAAAVKRHYKRIRSQTLPKKL 54


>gi|225572272|ref|ZP_03781136.1| hypothetical protein RUMHYD_00566 [Blautia hydrogenotrophica DSM
          10507]
 gi|260587848|ref|ZP_05853761.1| ribosomal protein S21 [Blautia hansenii DSM 20583]
 gi|331083850|ref|ZP_08332959.1| 30S ribosomal protein S21 [Lachnospiraceae bacterium 6_1_63FAA]
 gi|225040256|gb|EEG50502.1| hypothetical protein RUMHYD_00566 [Blautia hydrogenotrophica DSM
          10507]
 gi|260542113|gb|EEX22682.1| ribosomal protein S21 [Blautia hansenii DSM 20583]
 gi|291545955|emb|CBL19063.1| SSU ribosomal protein S21P [Ruminococcus sp. SR1/5]
 gi|295109897|emb|CBL23850.1| SSU ribosomal protein S21P [Ruminococcus obeum A2-162]
 gi|330403275|gb|EGG82835.1| 30S ribosomal protein S21 [Lachnospiraceae bacterium 6_1_63FAA]
          Length = 58

 Score = 40.3 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R
Sbjct: 1  MSNVIVKENETLDSALRRFKRSCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKR 55


>gi|254362693|ref|ZP_04978779.1| ribosomal protein S21 [Mannheimia haemolytica PHL213]
 gi|153094314|gb|EDN75175.1| ribosomal protein S21 [Mannheimia haemolytica PHL213]
          Length = 65

 Score = 40.3 bits (93), Expect = 0.10,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 30/59 (50%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQR 83
           + + + ALR  K+  +  G+L E++ R  YEKP+  R R K+   +R  K   +   R
Sbjct: 2  ENESFDVALRRFKRSCEKAGILAEVRAREFYEKPTTIRKREKASLAKRLAKRNFRENAR 60


>gi|19112041|ref|NP_595249.1| mitochondrial ribosomal protein subunit Mrp21
          [Schizosaccharomyces pombe 972h-]
 gi|74630403|sp|Q8WZK1|RT21_SCHPO RecName: Full=40S ribosomal protein mrp21, mitochondrial
 gi|5441472|emb|CAB46702.1| mitochondrial ribosomal protein subunit Mrp21
          [Schizosaccharomyces pombe]
          Length = 121

 Score = 40.3 bits (93), Expect = 0.11,   Method: Composition-based stats.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          N++ +A R + +  Q   V R  + +  YEKPS+KR R++SE  R
Sbjct: 55 NSLTRAFRQVDRICQRNNVPRLFRSQRFYEKPSEKRSRVRSERHR 99


>gi|205374150|ref|ZP_03226950.1| 30S ribosomal protein S21 [Bacillus coahuilensis m4-4]
          Length = 56

 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 32/55 (58%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G L+E++ R  YEKPS +R +    A +R
Sbjct: 1  MSKTVVRKNESLEDALRRFKRTVSKTGTLQEVRKREFYEKPSVRRKKKSEAARKR 55


>gi|91785672|ref|YP_560878.1| 30S ribosomal protein S21 [Burkholderia xenovorans LB400]
 gi|170694354|ref|ZP_02885508.1| ribosomal protein S21 [Burkholderia graminis C4D1M]
 gi|187925800|ref|YP_001897442.1| 30S ribosomal protein S21 [Burkholderia phytofirmans PsJN]
 gi|209515735|ref|ZP_03264598.1| ribosomal protein S21 [Burkholderia sp. H160]
 gi|295678096|ref|YP_003606620.1| ribosomal protein S21 [Burkholderia sp. CCGE1002]
 gi|296157494|ref|ZP_06840329.1| ribosomal protein S21 [Burkholderia sp. Ch1-1]
 gi|307731399|ref|YP_003908623.1| 30S ribosomal protein S21 [Burkholderia sp. CCGE1003]
 gi|323527750|ref|YP_004229903.1| 30S ribosomal protein S21 [Burkholderia sp. CCGE1001]
 gi|119367205|sp|Q13SW3|RS211_BURXL RecName: Full=30S ribosomal protein S21 1
 gi|91689626|gb|ABE32826.1| SSU ribosomal protein S21P [Burkholderia xenovorans LB400]
 gi|170140777|gb|EDT08951.1| ribosomal protein S21 [Burkholderia graminis C4D1M]
 gi|187716994|gb|ACD18218.1| ribosomal protein S21 [Burkholderia phytofirmans PsJN]
 gi|209503762|gb|EEA03755.1| ribosomal protein S21 [Burkholderia sp. H160]
 gi|295437939|gb|ADG17109.1| ribosomal protein S21 [Burkholderia sp. CCGE1002]
 gi|295892266|gb|EFG72049.1| ribosomal protein S21 [Burkholderia sp. Ch1-1]
 gi|307585934|gb|ADN59332.1| ribosomal protein S21 [Burkholderia sp. CCGE1003]
 gi|323384752|gb|ADX56843.1| ribosomal protein S21 [Burkholderia sp. CCGE1001]
          Length = 70

 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 18/62 (29%), Positives = 33/62 (53%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   E A+R  ++ ++  G++ EL+ R  YEKP+  R R K+ A++R  K +R     +
Sbjct: 8  ENEPFEVAIRRFRRAIEKNGLIAELRERQSYEKPTTARKRKKAAAVKRLHKRLRSQMLPK 67

Query: 85 GA 86
            
Sbjct: 68 KL 69


>gi|16079595|ref|NP_390419.1| 30S ribosomal protein S21 [Bacillus subtilis subsp. subtilis str.
          168]
 gi|154686801|ref|YP_001421962.1| 30S ribosomal protein S21 [Bacillus amyloliquefaciens FZB42]
 gi|157693041|ref|YP_001487503.1| 30S ribosomal protein S21 [Bacillus pumilus SAFR-032]
 gi|194017671|ref|ZP_03056281.1| ribosomal protein S21 [Bacillus pumilus ATCC 7061]
 gi|221310466|ref|ZP_03592313.1| 30S ribosomal protein S21 [Bacillus subtilis subsp. subtilis str.
          168]
 gi|221314789|ref|ZP_03596594.1| 30S ribosomal protein S21 [Bacillus subtilis subsp. subtilis str.
          NCIB 3610]
 gi|221319712|ref|ZP_03601006.1| 30S ribosomal protein S21 [Bacillus subtilis subsp. subtilis str.
          JH642]
 gi|221323989|ref|ZP_03605283.1| 30S ribosomal protein S21 [Bacillus subtilis subsp. subtilis str.
          SMY]
 gi|296333301|ref|ZP_06875754.1| 30S ribosomal protein S21 [Bacillus subtilis subsp. spizizenii
          ATCC 6633]
 gi|305675194|ref|YP_003866866.1| 30S ribosomal protein S21 [Bacillus subtilis subsp. spizizenii
          str. W23]
 gi|308174329|ref|YP_003921034.1| 30S ribosomal protein S21 [Bacillus amyloliquefaciens DSM 7]
 gi|311069142|ref|YP_003974065.1| 30S ribosomal protein S21 [Bacillus atrophaeus 1942]
 gi|321312025|ref|YP_004204312.1| 30S ribosomal protein S21 [Bacillus subtilis BSn5]
 gi|1710750|sp|P21478|RS21_BACSU RecName: Full=30S ribosomal protein S21; AltName: Full=BS-B
 gi|166224010|sp|A7Z6V5|RS21_BACA2 RecName: Full=30S ribosomal protein S21
 gi|167011222|sp|A8FFC6|RS21_BACP2 RecName: Full=30S ribosomal protein S21
 gi|1303814|dbj|BAA12470.1| YqeX [Bacillus subtilis]
 gi|1890063|dbj|BAA12082.1| YqeX [Bacillus subtilis]
 gi|2634987|emb|CAB14483.1| ribosomal protein S21 [Bacillus subtilis subsp. subtilis str.
          168]
 gi|154352652|gb|ABS74731.1| RpsU [Bacillus amyloliquefaciens FZB42]
 gi|157681799|gb|ABV62943.1| ribosomal protein S21 [Bacillus pumilus SAFR-032]
 gi|194010571|gb|EDW20143.1| ribosomal protein S21 [Bacillus pumilus ATCC 7061]
 gi|291484988|dbj|BAI86063.1| 30S ribosomal protein S21 [Bacillus subtilis subsp. natto
          BEST195]
 gi|296149499|gb|EFG90395.1| 30S ribosomal protein S21 [Bacillus subtilis subsp. spizizenii
          ATCC 6633]
 gi|305413438|gb|ADM38557.1| 30S ribosomal protein S21 [Bacillus subtilis subsp. spizizenii
          str. W23]
 gi|307607193|emb|CBI43564.1| ribosomal protein S21 [Bacillus amyloliquefaciens DSM 7]
 gi|310869659|gb|ADP33134.1| 30S ribosomal protein S21 [Bacillus atrophaeus 1942]
 gi|320018299|gb|ADV93285.1| 30S ribosomal protein S21 [Bacillus subtilis BSn5]
 gi|328554276|gb|AEB24768.1| 30S ribosomal protein S21 [Bacillus amyloliquefaciens TA208]
 gi|328912673|gb|AEB64269.1| 30S ribosomal protein S21 [Bacillus amyloliquefaciens LL3]
          Length = 57

 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G L+E + R  YEKPS KR +    A +R
Sbjct: 1  MSKTVVRKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSVKRKKKSEAARKR 55


>gi|313904035|ref|ZP_07837415.1| ribosomal protein S21 [Eubacterium cellulosolvens 6]
 gi|313471184|gb|EFR66506.1| ribosomal protein S21 [Eubacterium cellulosolvens 6]
          Length = 58

 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 22 VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R
Sbjct: 4  VIVKENETLDSALRRFKRSCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKR 55


>gi|167771622|ref|ZP_02443675.1| hypothetical protein ANACOL_02994 [Anaerotruncus colihominis DSM
          17241]
 gi|167666262|gb|EDS10392.1| hypothetical protein ANACOL_02994 [Anaerotruncus colihominis DSM
          17241]
          Length = 58

 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 29/50 (58%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          + +++ ALR  K+     GVL E++ R HYEKPS KR +    A +R  K
Sbjct: 9  NESLDSALRRFKRSCARSGVLAEVRKREHYEKPSVKRKKKSEAARKRKFK 58


>gi|253566648|ref|ZP_04844101.1| 30S ribosomal protein S21 [Bacteroides sp. 3_2_5]
 gi|251944820|gb|EES85295.1| 30S ribosomal protein S21 [Bacteroides sp. 3_2_5]
          Length = 82

 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 15 REISAVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
               + V V++  N+E+AL+  K+K +  G+++EL+ R  ++KPS  +   K  A+
Sbjct: 16 NNNKMIVVPVKEGENIEKALKKFKRKFEKTGIVKELRSRQQFDKPSVTKRLKKERAV 72


>gi|33863293|ref|NP_894853.1| 30S ribosomal protein S21 [Prochlorococcus marinus str. MIT 9313]
 gi|124022768|ref|YP_001017075.1| 30S ribosomal protein S21 [Prochlorococcus marinus str. MIT 9303]
 gi|81712003|sp|Q7TUX0|RS21_PROMM RecName: Full=30S ribosomal protein S21
 gi|166224052|sp|A2C8K0|RS21_PROM3 RecName: Full=30S ribosomal protein S21
 gi|33640742|emb|CAE21197.1| 30S Ribosomal protein S21 [Prochlorococcus marinus str. MIT 9313]
 gi|123963054|gb|ABM77810.1| 30S Ribosomal protein S21 [Prochlorococcus marinus str. MIT 9303]
          Length = 58

 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 25/51 (49%), Gaps = 1/51 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSE 68
             V V +N  VE ALR  K+ +   G+  +LK   H+E P +K  R   +
Sbjct: 1  MAQVTVGENEGVESALRRFKRAVSKAGIFSDLKRIRHHETPVEKYKRKAQQ 51


>gi|304316650|ref|YP_003851795.1| ribosomal protein S21 [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
 gi|323704195|ref|ZP_08115774.1| ribosomal protein S21 [Thermoanaerobacterium xylanolyticum LX-11]
 gi|302778152|gb|ADL68711.1| ribosomal protein S21 [Thermoanaerobacterium
          thermosaccharolyticum DSM 571]
 gi|323536261|gb|EGB26033.1| ribosomal protein S21 [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 61

 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 30/54 (55%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + +++ ALR  K++    GVL EL+ R HYE PS KR +    A +R  K  +
Sbjct: 8  ENESLDNALRRFKRQCSRSGVLSELRKREHYESPSVKRKKKSEAARKRKYKFGK 61


>gi|229828471|ref|ZP_04454540.1| hypothetical protein GCWU000342_00533 [Shuttleworthia satelles
          DSM 14600]
 gi|229793065|gb|EEP29179.1| hypothetical protein GCWU000342_00533 [Shuttleworthia satelles
          DSM 14600]
          Length = 77

 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 34/61 (55%)

Query: 12 SEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
           E  +  +  ++  + +++ ALR  K+ +   G+ +E++ R HYEKPS +R +    A +
Sbjct: 14 REVEKSMSSIIIKENESLDSALRRFKRSVAKAGIQQEIRKREHYEKPSVRRKKKSEAARK 73

Query: 72 R 72
          R
Sbjct: 74 R 74


>gi|5070223|gb|AAD39078.1|AF084814_1 ribosomal protein S21 [Burkholderia mallei]
 gi|5070226|gb|AAD39080.1|AF084815_1 ribosomal protein S21 [Burkholderia mallei]
 gi|3550353|gb|AAC34679.1| ribosomal protein S21 [Burkholderia pseudomallei]
 gi|3550357|gb|AAC34681.1| ribosomal protein S21 [Burkholderia pseudomallei]
          Length = 63

 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 32/54 (59%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           +   E A+R  ++ ++  G++ EL+ R  YEKP+  R R K+ A++R  K +R
Sbjct: 8  ENEPFEVAIRRFRRAIEKNGLIAELRERQAYEKPTAVRKRKKAAAVKRLHKRLR 61


>gi|147858097|emb|CAN78862.1| hypothetical protein VITISV_021538 [Vitis vinifera]
          Length = 804

 Score = 39.9 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 18/86 (20%), Positives = 41/86 (47%), Gaps = 5/86 (5%)

Query: 10  IFSEGREISAVYVLVRDNNVEQALRVL----KKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
           +  E R +  +Y + +  N++ A R L    K++++    L+E+K++    +   ++ + 
Sbjct: 328 LRVELRHVRGIYAMAQSENID-ASRKLNDLSKRRLEEADKLKEIKLKEEEARELARKEKE 386

Query: 66  KSEAIRRSRKLMRKIAQREGAPVSRL 91
           K EA +R     R+ A++E       
Sbjct: 387 KYEAAKREAXYARECAEKEALQRKEA 412


>gi|225377639|ref|ZP_03754860.1| hypothetical protein ROSEINA2194_03290 [Roseburia inulinivorans
          DSM 16841]
 gi|225210503|gb|EEG92857.1| hypothetical protein ROSEINA2194_03290 [Roseburia inulinivorans
          DSM 16841]
          Length = 58

 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R
Sbjct: 1  MSSVIVKENETLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKR 55


>gi|317131226|ref|YP_004090540.1| ribosomal protein S21 [Ethanoligenens harbinense YUAN-3]
 gi|315469205|gb|ADU25809.1| ribosomal protein S21 [Ethanoligenens harbinense YUAN-3]
          Length = 58

 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 20/50 (40%), Positives = 30/50 (60%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          + +++ ALR  KK+    GVL E++ R HYEKPS KR +    A +R  +
Sbjct: 9  NESLDSALRRFKKQCARSGVLAEVRKREHYEKPSVKRKKKSEAARKRKHR 58


>gi|227872333|ref|ZP_03990687.1| ribosomal protein S21 [Oribacterium sinus F0268]
 gi|238916898|ref|YP_002930415.1| hypothetical protein EUBELI_00967 [Eubacterium eligens ATCC
          27750]
 gi|315651383|ref|ZP_07904408.1| 30S ribosomal protein S21 [Eubacterium saburreum DSM 3986]
 gi|331001778|ref|ZP_08325300.1| 30S ribosomal protein S21 [Lachnospiraceae oral taxon 107 str.
          F0167]
 gi|259494884|sp|C4Z055|RS21_EUBE2 RecName: Full=30S ribosomal protein S21
 gi|227841816|gb|EEJ52092.1| ribosomal protein S21 [Oribacterium sinus F0268]
 gi|238872258|gb|ACR71968.1| Hypothetical protein EUBELI_00967 [Eubacterium eligens ATCC
          27750]
 gi|315486342|gb|EFU76699.1| 30S ribosomal protein S21 [Eubacterium saburreum DSM 3986]
 gi|330412752|gb|EGG92135.1| 30S ribosomal protein S21 [Lachnospiraceae oral taxon 107 str.
          F0167]
          Length = 58

 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R
Sbjct: 1  MSNVIVKENESLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKR 55


>gi|255284430|ref|ZP_05348985.1| ribosomal protein S21 [Bryantella formatexigens DSM 14469]
 gi|331091262|ref|ZP_08340103.1| 30S ribosomal protein S21 [Lachnospiraceae bacterium 2_1_46FAA]
 gi|255265015|gb|EET58220.1| ribosomal protein S21 [Bryantella formatexigens DSM 14469]
 gi|330404709|gb|EGG84248.1| 30S ribosomal protein S21 [Lachnospiraceae bacterium 2_1_46FAA]
          Length = 58

 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R
Sbjct: 1  MSNVIVKENETLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKR 55


>gi|153853059|ref|ZP_01994468.1| hypothetical protein DORLON_00453 [Dorea longicatena DSM 13814]
 gi|260438421|ref|ZP_05792237.1| ribosomal protein S21 [Butyrivibrio crossotus DSM 2876]
 gi|149753845|gb|EDM63776.1| hypothetical protein DORLON_00453 [Dorea longicatena DSM 13814]
 gi|292809007|gb|EFF68212.1| ribosomal protein S21 [Butyrivibrio crossotus DSM 2876]
          Length = 58

 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R
Sbjct: 1  MSNVIVKENESLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKR 55


>gi|153814719|ref|ZP_01967387.1| hypothetical protein RUMTOR_00934 [Ruminococcus torques ATCC
          27756]
 gi|154502473|ref|ZP_02039533.1| hypothetical protein RUMGNA_00286 [Ruminococcus gnavus ATCC
          29149]
 gi|167758105|ref|ZP_02430232.1| hypothetical protein CLOSCI_00443 [Clostridium scindens ATCC
          35704]
 gi|197301769|ref|ZP_03166839.1| hypothetical protein RUMLAC_00495 [Ruminococcus lactaris ATCC
          29176]
 gi|218132185|ref|ZP_03460989.1| hypothetical protein BACPEC_00042 [Bacteroides pectinophilus ATCC
          43243]
 gi|225570653|ref|ZP_03779676.1| hypothetical protein CLOHYLEM_06753 [Clostridium hylemonae DSM
          15053]
 gi|226323188|ref|ZP_03798706.1| hypothetical protein COPCOM_00960 [Coprococcus comes ATCC 27758]
 gi|317500250|ref|ZP_07958479.1| 30S ribosomal protein S21 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|325265419|ref|ZP_08132143.1| ribosomal protein S21 [Clostridium sp. D5]
 gi|331087516|ref|ZP_08336450.1| 30S ribosomal protein S21 [Lachnospiraceae bacterium 3_1_46FAA]
 gi|145847750|gb|EDK24668.1| hypothetical protein RUMTOR_00934 [Ruminococcus torques ATCC
          27756]
 gi|153796869|gb|EDN79289.1| hypothetical protein RUMGNA_00286 [Ruminococcus gnavus ATCC
          29149]
 gi|167664002|gb|EDS08132.1| hypothetical protein CLOSCI_00443 [Clostridium scindens ATCC
          35704]
 gi|197299209|gb|EDY33739.1| hypothetical protein RUMLAC_00495 [Ruminococcus lactaris ATCC
          29176]
 gi|217992906|gb|EEC58906.1| hypothetical protein BACPEC_00042 [Bacteroides pectinophilus ATCC
          43243]
 gi|225160480|gb|EEG73099.1| hypothetical protein CLOHYLEM_06753 [Clostridium hylemonae DSM
          15053]
 gi|225208378|gb|EEG90732.1| hypothetical protein COPCOM_00960 [Coprococcus comes ATCC 27758]
 gi|291550264|emb|CBL26526.1| SSU ribosomal protein S21P [Ruminococcus torques L2-14]
 gi|316898346|gb|EFV20388.1| 30S ribosomal protein S21 [Lachnospiraceae bacterium 8_1_57FAA]
 gi|324029420|gb|EGB90711.1| ribosomal protein S21 [Clostridium sp. D5]
 gi|330406268|gb|EGG85785.1| 30S ribosomal protein S21 [Lachnospiraceae bacterium 3_1_46FAA]
          Length = 58

 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 32/55 (58%), Gaps = 1/55 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
             V+V++N  ++ ALR  K+     G+ +E++ R HYEKPS +R +    A +R
Sbjct: 1  MSNVIVKENETLDSALRRFKRNCAKAGIQQEIRKREHYEKPSVRRKKKSEAARKR 55


>gi|295399223|ref|ZP_06809205.1| ribosomal protein S21 [Geobacillus thermoglucosidasius C56-YS93]
 gi|312110175|ref|YP_003988491.1| ribosomal protein S21 [Geobacillus sp. Y4.1MC1]
 gi|294978689|gb|EFG54285.1| ribosomal protein S21 [Geobacillus thermoglucosidasius C56-YS93]
 gi|311215276|gb|ADP73880.1| ribosomal protein S21 [Geobacillus sp. Y4.1MC1]
          Length = 57

 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 32/55 (58%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  ++ ++ +++ ALR  K+ +   G L+E++ R  YEKPS +R +    A +R
Sbjct: 1  MSKTIVRKNESIDDALRRFKRAVSKTGTLQEIRKREFYEKPSVRRKKKSEAARKR 55


>gi|302338647|ref|YP_003803853.1| ribosomal protein S21 [Spirochaeta smaragdinae DSM 11293]
 gi|301635832|gb|ADK81259.1| ribosomal protein S21 [Spirochaeta smaragdinae DSM 11293]
          Length = 72

 Score = 39.9 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 33/52 (63%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
          +E+A++  K+ ++ EG++RE K R +YEKPS    R K    R+  K +RKI
Sbjct: 15 LEKAIKRFKRMVEKEGIIREWKKREYYEKPSTINNRKKKALERKQMKKLRKI 66


>gi|218288629|ref|ZP_03492906.1| ribosomal protein S21 [Alicyclobacillus acidocaldarius LAA1]
 gi|258511956|ref|YP_003185390.1| 30S ribosomal protein S21 [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
 gi|218241286|gb|EED08461.1| ribosomal protein S21 [Alicyclobacillus acidocaldarius LAA1]
 gi|257478682|gb|ACV59001.1| ribosomal protein S21 [Alicyclobacillus acidocaldarius subsp.
          acidocaldarius DSM 446]
          Length = 60

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 33/51 (64%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          ++ +++ ALR  KK+M  +GVL E++ R HYEKPS  R +    A R+ R+
Sbjct: 8  KNESIDSALRRFKKQMARDGVLAEVRKREHYEKPSVARKKKAQAAQRKRRR 58


>gi|89895869|ref|YP_519356.1| 30S ribosomal protein S21 [Desulfitobacterium hafniense Y51]
 gi|219670298|ref|YP_002460733.1| 30S ribosomal protein S21 [Desulfitobacterium hafniense DCB-2]
 gi|119367256|sp|Q24ST0|RS21_DESHY RecName: Full=30S ribosomal protein S21
 gi|254813613|sp|B8FUM7|RS21_DESHD RecName: Full=30S ribosomal protein S21
 gi|89335317|dbj|BAE84912.1| 30S ribosomal protein S21 [Desulfitobacterium hafniense Y51]
 gi|219540558|gb|ACL22297.1| ribosomal protein S21 [Desulfitobacterium hafniense DCB-2]
          Length = 58

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 29/51 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          ++ +++ ALR  K+  Q  GVL E +   HYEKPS KR +    A +R  K
Sbjct: 8  KNESLDSALRRFKRTCQRAGVLSEARKHEHYEKPSVKRKKKSEAARKRKFK 58


>gi|167751483|ref|ZP_02423610.1| hypothetical protein EUBSIR_02479 [Eubacterium siraeum DSM 15702]
 gi|167655291|gb|EDR99420.1| hypothetical protein EUBSIR_02479 [Eubacterium siraeum DSM 15702]
 gi|291530289|emb|CBK95874.1| SSU ribosomal protein S21P [Eubacterium siraeum 70/3]
 gi|291557104|emb|CBL34221.1| SSU ribosomal protein S21P [Eubacterium siraeum V10Sc8a]
          Length = 58

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 31/51 (60%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          ++ +++ AL+  K+    +GVL E++ R HYEKPS KR +    A +R  K
Sbjct: 8  KNESLDTALKRFKRSCARDGVLAEVRKREHYEKPSVKRKKKSEAARKRKFK 58


>gi|295677387|ref|YP_003605911.1| ribosomal protein S21 [Burkholderia sp. CCGE1002]
 gi|295437230|gb|ADG16400.1| ribosomal protein S21 [Burkholderia sp. CCGE1002]
          Length = 70

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 36/54 (66%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          D  VE ALR  ++ ++  G++ EL++R  YEKP+ +R R K+ A+ R RK +++
Sbjct: 9  DEPVEVALRRFRRAIERTGLIPELRVRTAYEKPTAERKRKKAAAVARLRKQIKR 62


>gi|299822884|ref|ZP_07054770.1| 30S ribosomal protein S21 [Listeria grayi DSM 20601]
 gi|299816413|gb|EFI83651.1| 30S ribosomal protein S21 [Listeria grayi DSM 20601]
          Length = 57

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G L+E + R  YEKPS +R +    A +R
Sbjct: 1  MSKTVVRKNESLEDALRRFKRTVSKSGTLQESRKREFYEKPSVRRKKKSEAARKR 55


>gi|195954311|gb|ACG58863.1| 30S ribosomal protein [Lactobacillus sakei]
          Length = 58

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 29/57 (50%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
              V+  + +++ ALR  K+ +   G ++E + R  YEKPS KR      A +R +
Sbjct: 1  MGKTVVRSNESLDDALRRFKRSVSKVGTIQEYRKREFYEKPSVKRKLKSEAARKRKK 57


>gi|326336162|ref|ZP_08202334.1| 30S ribosomal protein S21 [Capnocytophaga sp. oral taxon 338 str.
          F0234]
 gi|325691671|gb|EGD33638.1| 30S ribosomal protein S21 [Capnocytophaga sp. oral taxon 338 str.
          F0234]
          Length = 91

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 22/65 (33%), Positives = 39/65 (60%), Gaps = 3/65 (4%)

Query: 13 EGREISAVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRV--RLKSEA 69
          E R  + + + V++  N+++AL+  K+K    G++REL+ R H+ KPS  R     ++E 
Sbjct: 22 ERRCYTMLIIPVKEGENIDRALKRYKRKFDRVGIVRELRSRQHFSKPSVLRRNVIQRAEF 81

Query: 70 IRRSR 74
          I+R R
Sbjct: 82 IQRLR 86


>gi|89100458|ref|ZP_01173320.1| 30S ribosomal protein S21 [Bacillus sp. NRRL B-14911]
 gi|89084801|gb|EAR63940.1| 30S ribosomal protein S21 [Bacillus sp. NRRL B-14911]
          Length = 57

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G L+E + R  YEKPS KR +    A +R
Sbjct: 1  MSKTVVKKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSVKRKKKSEAARKR 55


>gi|328957474|ref|YP_004374860.1| 30S ribosomal protein S21 [Carnobacterium sp. 17-4]
 gi|328673798|gb|AEB29844.1| 30S ribosomal protein S21 [Carnobacterium sp. 17-4]
          Length = 57

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  VL ++ +++ ALR  K+ +   G L+E + R  YEKPS KR +    A +R
Sbjct: 1  MSKTVLKKNESLDDALRRFKRSVSKTGTLQEARKREFYEKPSVKRKKKSEAARKR 55


>gi|294139652|ref|YP_003555630.1| 30S ribosomal protein S21 [Shewanella violacea DSS12]
 gi|293326121|dbj|BAJ00852.1| ribosomal protein S21 [Shewanella violacea DSS12]
          Length = 71

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L +++ R +YEKP+  R R K+ A++R  K +
Sbjct: 1  MPIIKVRENEPFDVALRRFKRSCEKAGILADVRAREYYEKPTTARKRAKAAAVKRLAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|163791435|ref|ZP_02185844.1| 30S ribosomal protein S21 [Carnobacterium sp. AT7]
 gi|159873299|gb|EDP67394.1| 30S ribosomal protein S21 [Carnobacterium sp. AT7]
          Length = 57

 Score = 39.9 bits (92), Expect = 0.13,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR +    A +R
Sbjct: 1  MSKTVIKKNESLDDALRRFKRSVSKTGTLQEARKREFYEKPSVKRKKKSEAARKR 55


>gi|329894614|ref|ZP_08270420.1| SSU ribosomal protein S21p [gamma proteobacterium IMCC3088]
 gi|328922968|gb|EGG30296.1| SSU ribosomal protein S21p [gamma proteobacterium IMCC3088]
          Length = 71

 Score = 39.9 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 33/60 (55%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   + ALR  K+  +  GVL E++ R HYEKP+  R R  + A++R  K + +  ++ 
Sbjct: 8  ENEPFDVALRRFKRSCEKAGVLAEVRKREHYEKPTTLRKRAAAAAVKRHLKKVSRENRKR 67


>gi|238027418|ref|YP_002911649.1| 30S ribosomal protein S21 [Burkholderia glumae BGR1]
 gi|237876612|gb|ACR28945.1| 30S ribosomal protein S21 [Burkholderia glumae BGR1]
          Length = 70

 Score = 39.9 bits (92), Expect = 0.14,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 34/54 (62%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          D  VE ALR  ++ ++  G++ EL+ R  YEKP+ +R R K+ A+ R  K +++
Sbjct: 9  DEPVEVALRRFRRGIERTGLIPELRARAAYEKPTAERKRKKAAAVARLNKQIKR 62


>gi|332654293|ref|ZP_08420037.1| ribosomal protein S21 [Ruminococcaceae bacterium D16]
 gi|332517379|gb|EGJ46984.1| ribosomal protein S21 [Ruminococcaceae bacterium D16]
          Length = 60

 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 22/58 (37%), Positives = 31/58 (53%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             V VR+N  +E AL+  K+     GVL E++ R HYE PS KR +    A +  +K
Sbjct: 1  MSEVRVRENESLESALKRFKRSCAKSGVLAEVRKREHYESPSVKRRKKSEAARKNRKK 58


>gi|78043650|ref|YP_359282.1| 30S ribosomal protein S21 [Carboxydothermus hydrogenoformans
          Z-2901]
 gi|119367242|sp|Q3AF02|RS21_CARHZ RecName: Full=30S ribosomal protein S21
 gi|77995765|gb|ABB14664.1| ribosomal protein S21 [Carboxydothermus hydrogenoformans Z-2901]
          Length = 59

 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 16/50 (32%), Positives = 30/50 (60%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          ++ +++ ALR  K+  Q  G++ E++ R HYEKPS +R +      ++ R
Sbjct: 8  KNESLDSALRRFKRSCQKAGLMAEMRKREHYEKPSVRRKKKAQARNKKKR 57


>gi|160946503|ref|ZP_02093712.1| hypothetical protein PEPMIC_00467 [Parvimonas micra ATCC 33270]
 gi|158447619|gb|EDP24614.1| hypothetical protein PEPMIC_00467 [Parvimonas micra ATCC 33270]
          Length = 59

 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + +++ AL+  K++    GVL E + R HYEKPS KR +    A R+ +K
Sbjct: 8  ENESLDNALKRFKRQCARAGVLSEYRKREHYEKPSVKRKKKSEAARRKKKK 58


>gi|212633974|ref|YP_002310499.1| 30S ribosomal protein S21 [Shewanella piezotolerans WP3]
 gi|226695050|sp|B8CJF0|RS21_SHEPW RecName: Full=30S ribosomal protein S21
 gi|212555458|gb|ACJ27912.1| Ribosomal protein S21 [Shewanella piezotolerans WP3]
          Length = 71

 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L +++ R  YEKP+  R R K+ AI+R  K +
Sbjct: 1  MPIIKVRENEPFDVALRRFKRSCEKAGILADVRAREFYEKPTTARKRAKAAAIKRLAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|24372868|ref|NP_716910.1| 30S ribosomal protein S21 [Shewanella oneidensis MR-1]
 gi|91794182|ref|YP_563833.1| 30S ribosomal protein S21 [Shewanella denitrificans OS217]
 gi|113971240|ref|YP_735033.1| 30S ribosomal protein S21 [Shewanella sp. MR-4]
 gi|114048478|ref|YP_739028.1| 30S ribosomal protein S21 [Shewanella sp. MR-7]
 gi|114564157|ref|YP_751671.1| 30S ribosomal protein S21 [Shewanella frigidimarina NCIMB 400]
 gi|117921522|ref|YP_870714.1| 30S ribosomal protein S21 [Shewanella sp. ANA-3]
 gi|120599854|ref|YP_964428.1| 30S ribosomal protein S21 [Shewanella sp. W3-18-1]
 gi|126173386|ref|YP_001049535.1| 30S ribosomal protein S21 [Shewanella baltica OS155]
 gi|127511932|ref|YP_001093129.1| 30S ribosomal protein S21 [Shewanella loihica PV-4]
 gi|146292210|ref|YP_001182634.1| 30S ribosomal protein S21 [Shewanella putrefaciens CN-32]
 gi|152999724|ref|YP_001365405.1| 30S ribosomal protein S21 [Shewanella baltica OS185]
 gi|157960789|ref|YP_001500823.1| 30S ribosomal protein S21 [Shewanella pealeana ATCC 700345]
 gi|160874343|ref|YP_001553659.1| 30S ribosomal protein S21 [Shewanella baltica OS195]
 gi|167622946|ref|YP_001673240.1| 30S ribosomal protein S21 [Shewanella halifaxensis HAW-EB4]
 gi|217974323|ref|YP_002359074.1| 30S ribosomal protein S21 [Shewanella baltica OS223]
 gi|304409309|ref|ZP_07390929.1| ribosomal protein S21 [Shewanella baltica OS183]
 gi|307303667|ref|ZP_07583420.1| ribosomal protein S21 [Shewanella baltica BA175]
 gi|81744841|sp|Q8EHD7|RS21_SHEON RecName: Full=30S ribosomal protein S21
 gi|119367306|sp|Q12KB6|RS21_SHEDO RecName: Full=30S ribosomal protein S21
 gi|119367307|sp|Q07YT2|RS21_SHEFN RecName: Full=30S ribosomal protein S21
 gi|119367308|sp|Q0HG41|RS21_SHESM RecName: Full=30S ribosomal protein S21
 gi|119367309|sp|Q0HSD4|RS21_SHESR RecName: Full=30S ribosomal protein S21
 gi|166224068|sp|A3D1Q3|RS21_SHEB5 RecName: Full=30S ribosomal protein S21
 gi|166225194|sp|A6WKK3|RS21_SHEB8 RecName: Full=30S ribosomal protein S21
 gi|166225195|sp|A3QBM2|RS21_SHELP RecName: Full=30S ribosomal protein S21
 gi|166225196|sp|A4Y4F2|RS21_SHEPC RecName: Full=30S ribosomal protein S21
 gi|166225197|sp|A0KZT9|RS21_SHESA RecName: Full=30S ribosomal protein S21
 gi|166225198|sp|A1RMH9|RS21_SHESW RecName: Full=30S ribosomal protein S21
 gi|189044913|sp|A9L514|RS21_SHEB9 RecName: Full=30S ribosomal protein S21
 gi|189044914|sp|B0TIN6|RS21_SHEHH RecName: Full=30S ribosomal protein S21
 gi|189044915|sp|A8H151|RS21_SHEPA RecName: Full=30S ribosomal protein S21
 gi|254813730|sp|B8EBV6|RS21_SHEB2 RecName: Full=30S ribosomal protein S21
 gi|24346983|gb|AAN54355.1|AE015573_2 ribosomal protein S21 [Shewanella oneidensis MR-1]
 gi|91716184|gb|ABE56110.1| SSU ribosomal protein S21P [Shewanella denitrificans OS217]
 gi|113885924|gb|ABI39976.1| SSU ribosomal protein S21P [Shewanella sp. MR-4]
 gi|113889920|gb|ABI43971.1| SSU ribosomal protein S21P [Shewanella sp. MR-7]
 gi|114335450|gb|ABI72832.1| SSU ribosomal protein S21P [Shewanella frigidimarina NCIMB 400]
 gi|117613854|gb|ABK49308.1| SSU ribosomal protein S21P [Shewanella sp. ANA-3]
 gi|120559947|gb|ABM25874.1| SSU ribosomal protein S21P [Shewanella sp. W3-18-1]
 gi|125996591|gb|ABN60666.1| SSU ribosomal protein S21P [Shewanella baltica OS155]
 gi|126637227|gb|ABO22870.1| SSU ribosomal protein S21P [Shewanella loihica PV-4]
 gi|145563900|gb|ABP74835.1| SSU ribosomal protein S21P [Shewanella putrefaciens CN-32]
 gi|151364342|gb|ABS07342.1| ribosomal protein S21 [Shewanella baltica OS185]
 gi|157845789|gb|ABV86288.1| ribosomal protein S21 [Shewanella pealeana ATCC 700345]
 gi|160859865|gb|ABX48399.1| ribosomal protein S21 [Shewanella baltica OS195]
 gi|167352968|gb|ABZ75581.1| ribosomal protein S21 [Shewanella halifaxensis HAW-EB4]
 gi|217499458|gb|ACK47651.1| ribosomal protein S21 [Shewanella baltica OS223]
 gi|304351827|gb|EFM16225.1| ribosomal protein S21 [Shewanella baltica OS183]
 gi|306912565|gb|EFN42988.1| ribosomal protein S21 [Shewanella baltica BA175]
 gi|315266578|gb|ADT93431.1| ribosomal protein S21 [Shewanella baltica OS678]
 gi|319425510|gb|ADV53584.1| ribosomal protein S21 [Shewanella putrefaciens 200]
          Length = 71

 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L +++ R  YEKP+  R R K+ A++R  K +
Sbjct: 1  MPIIKVRENEPFDVALRRFKRSCEKAGILADVRAREFYEKPTTARKRAKAAAVKRLAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|212638683|ref|YP_002315203.1| 30S ribosomal protein S21 [Anoxybacillus flavithermus WK1]
 gi|212560163|gb|ACJ33218.1| Ribosomal protein S21 [Anoxybacillus flavithermus WK1]
          Length = 71

 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 18/66 (27%), Positives = 32/66 (48%)

Query: 7  FRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLK 66
            G         +  ++ ++ ++E ALR  K+ +   G L+E + R  YEKPS +R +  
Sbjct: 4  ISGFVRREGSRMSKTIVRKNESLEDALRRFKRAVSKTGTLQEARKREFYEKPSVRRKKKS 63

Query: 67 SEAIRR 72
            A +R
Sbjct: 64 EAARKR 69


>gi|119367283|sp|Q8EPW9|RS21_OCEIH RecName: Full=30S ribosomal protein S21
          Length = 58

 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 29/48 (60%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++ ++E ALR  K+ +   G L+E + R HYEKPS KR +    A +R
Sbjct: 9  KNESLEDALRRFKRSVSKSGTLQEYRKREHYEKPSVKRKKKSEAARKR 56


>gi|23099417|ref|NP_692883.1| 30S ribosomal protein S21 [Oceanobacillus iheyensis HTE831]
 gi|22777646|dbj|BAC13918.1| 30S ribosomal protein S21 [Oceanobacillus iheyensis HTE831]
          Length = 72

 Score = 39.5 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 19/48 (39%), Positives = 29/48 (60%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++ ++E ALR  K+ +   G L+E + R HYEKPS KR +    A +R
Sbjct: 23 KNESLEDALRRFKRSVSKSGTLQEYRKREHYEKPSVKRKKKSEAARKR 70


>gi|311031626|ref|ZP_07709716.1| 30S ribosomal protein S21 [Bacillus sp. m3-13]
          Length = 57

 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G L+E + R  YEKPS +R +    A +R
Sbjct: 1  MSKTVVRKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSVRRKKKSEAARKR 55


>gi|52786467|ref|YP_092296.1| 30S ribosomal protein S21 [Bacillus licheniformis ATCC 14580]
 gi|161760686|ref|YP_079879.2| 30S ribosomal protein S21 [Bacillus licheniformis ATCC 14580]
 gi|319644954|ref|ZP_07999187.1| 30S ribosomal protein S21 [Bacillus sp. BT1B_CT2]
 gi|81690978|sp|Q65H61|RS21_BACLD RecName: Full=30S ribosomal protein S21
 gi|52348969|gb|AAU41603.1| RpsU [Bacillus licheniformis ATCC 14580]
 gi|145903063|gb|AAU24241.2| ribosomal protein S21 [Bacillus licheniformis ATCC 14580]
 gi|317392763|gb|EFV73557.1| 30S ribosomal protein S21 [Bacillus sp. BT1B_CT2]
          Length = 57

 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G L+E + R  YEKPS +R +    A +R
Sbjct: 1  MSKTVVRKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSVRRKKKSEAARKR 55


>gi|239827768|ref|YP_002950392.1| 30S ribosomal protein S21 [Geobacillus sp. WCH70]
 gi|259494888|sp|C5D4T4|RS21_GEOSW RecName: Full=30S ribosomal protein S21
 gi|239808061|gb|ACS25126.1| ribosomal protein S21 [Geobacillus sp. WCH70]
          Length = 57

 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 32/55 (58%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  ++ ++ +++ ALR  K+ +   G L+E++ R  YEKPS +R +    A +R
Sbjct: 1  MSKTIVRKNESIDDALRRFKRAVSKTGTLQEVRKREFYEKPSVRRKKKSEAARKR 55


>gi|56421032|ref|YP_148350.1| 30S ribosomal protein S21 [Geobacillus kaustophilus HTA426]
 gi|196248964|ref|ZP_03147664.1| ribosomal protein S21 [Geobacillus sp. G11MC16]
 gi|261418485|ref|YP_003252167.1| 30S ribosomal protein S21 [Geobacillus sp. Y412MC61]
 gi|297529337|ref|YP_003670612.1| ribosomal protein S21 [Geobacillus sp. C56-T3]
 gi|319767554|ref|YP_004133055.1| ribosomal protein S21 [Geobacillus sp. Y412MC52]
 gi|61215779|sp|Q5KX04|RS21_GEOKA RecName: Full=30S ribosomal protein S21
 gi|56380874|dbj|BAD76782.1| 30S ribosomal protein S21 [Geobacillus kaustophilus HTA426]
 gi|196211840|gb|EDY06599.1| ribosomal protein S21 [Geobacillus sp. G11MC16]
 gi|261374942|gb|ACX77685.1| ribosomal protein S21 [Geobacillus sp. Y412MC61]
 gi|297252589|gb|ADI26035.1| ribosomal protein S21 [Geobacillus sp. C56-T3]
 gi|317112420|gb|ADU94912.1| ribosomal protein S21 [Geobacillus sp. Y412MC52]
          Length = 57

 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 32/55 (58%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  ++ ++ +++ ALR  K+ +   G L+E++ R  YEKPS +R +    A +R
Sbjct: 1  MSKTIVRKNESIDDALRRFKRAVSKTGTLQEVRKREFYEKPSVRRKKKSEAARKR 55


>gi|18266840|sp|P23829|RS21_BACST RecName: Full=30S ribosomal protein S21
          Length = 56

 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 32/55 (58%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  ++ ++ +++ ALR  K+ +   G L+E++ R  YEKPS +R +    A +R
Sbjct: 1  MSKTIVRKNESIDDALRRFKRAVSKTGTLQEVRKREFYEKPSVRRKKKSEAARKR 55


>gi|161760533|ref|NP_622616.2| 30S ribosomal protein S21 [Thermoanaerobacter tengcongensis MB4]
 gi|24212280|sp|Q8RB59|RS21_THETN RecName: Full=30S ribosomal protein S21
          Length = 61

 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 20/54 (37%), Positives = 30/54 (55%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + +++ ALR  +++    GVL EL+ R HYE PS KR +    A +R  K  R
Sbjct: 8  ENESLDSALRRFRRQCSKAGVLSELRKREHYESPSVKRKKKAEAARKRKYKYGR 61


>gi|146296838|ref|YP_001180609.1| ribosomal protein S21 [Caldicellulosiruptor saccharolyticus DSM
          8903]
 gi|222529259|ref|YP_002573141.1| 30S ribosomal protein S21 [Caldicellulosiruptor bescii DSM 6725]
 gi|302871931|ref|YP_003840567.1| ribosomal protein S21 [Caldicellulosiruptor obsidiansis OB47]
 gi|312127670|ref|YP_003992544.1| 30S ribosomal protein S21 [Caldicellulosiruptor hydrothermalis
          108]
 gi|312135084|ref|YP_004002422.1| 30S ribosomal protein S21 [Caldicellulosiruptor owensensis OL]
 gi|312622495|ref|YP_004024108.1| 30S ribosomal protein S21 [Caldicellulosiruptor kronotskyensis
          2002]
 gi|312793447|ref|YP_004026370.1| 30S ribosomal protein S21 [Caldicellulosiruptor kristjanssonii
          177R1B]
 gi|312876036|ref|ZP_07736025.1| ribosomal protein S21 [Caldicellulosiruptor lactoaceticus 6A]
 gi|166224015|sp|A4XKI3|RS21_CALS8 RecName: Full=30S ribosomal protein S21
 gi|254813078|sp|B9MRR4|RS21_ANATD RecName: Full=30S ribosomal protein S21
 gi|145410414|gb|ABP67418.1| SSU ribosomal protein S21P [Caldicellulosiruptor saccharolyticus
          DSM 8903]
 gi|222456106|gb|ACM60368.1| ribosomal protein S21 [Caldicellulosiruptor bescii DSM 6725]
 gi|302574790|gb|ADL42581.1| ribosomal protein S21 [Caldicellulosiruptor obsidiansis OB47]
 gi|311775135|gb|ADQ04622.1| ribosomal protein S21 [Caldicellulosiruptor owensensis OL]
 gi|311777689|gb|ADQ07175.1| ribosomal protein S21 [Caldicellulosiruptor hydrothermalis 108]
 gi|311797234|gb|EFR13574.1| ribosomal protein S21 [Caldicellulosiruptor lactoaceticus 6A]
 gi|312180587|gb|ADQ40757.1| ribosomal protein S21 [Caldicellulosiruptor kristjanssonii
          177R1B]
 gi|312202962|gb|ADQ46289.1| ribosomal protein S21 [Caldicellulosiruptor kronotskyensis 2002]
          Length = 58

 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 30/51 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + +++ ALR  KKK    GVL EL+ R HYE PS +R +    A RR R+
Sbjct: 8  ENESLDSALRRFKKKCAEAGVLAELRKREHYESPSVRRKKKSEAARRRKRR 58


>gi|186681441|ref|YP_001864637.1| 30S ribosomal protein S21 [Nostoc punctiforme PCC 73102]
 gi|186463893|gb|ACC79694.1| ribosomal protein S21 [Nostoc punctiforme PCC 73102]
          Length = 62

 Score = 39.5 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 19/61 (31%), Positives = 34/61 (55%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V+V DN  +E ALR  K+++   G+  +++   H+E P +KR R +    R+S++  
Sbjct: 1  MTQVIVGDNEHIESALRRFKREVSKAGIFPDMRKHRHFETPLEKRKRKEVAKHRQSKRSF 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|125973863|ref|YP_001037773.1| SSU ribosomal protein S21P [Clostridium thermocellum ATCC 27405]
 gi|256004317|ref|ZP_05429299.1| ribosomal protein S21 [Clostridium thermocellum DSM 2360]
 gi|281418024|ref|ZP_06249044.1| ribosomal protein S21 [Clostridium thermocellum JW20]
 gi|166224027|sp|A3DF51|RS21_CLOTH RecName: Full=30S ribosomal protein S21
 gi|125714088|gb|ABN52580.1| SSU ribosomal protein S21P [Clostridium thermocellum ATCC 27405]
 gi|255991751|gb|EEU01851.1| ribosomal protein S21 [Clostridium thermocellum DSM 2360]
 gi|281409426|gb|EFB39684.1| ribosomal protein S21 [Clostridium thermocellum JW20]
 gi|316939939|gb|ADU73973.1| ribosomal protein S21 [Clostridium thermocellum DSM 1313]
          Length = 58

 Score = 39.5 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 32/58 (55%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             V V++N  ++ AL+  K++    GVL E++ R HYE PS +R +    A +R  K
Sbjct: 1  MSEVRVKENESLDSALKRFKRQCAKAGVLAEVRKREHYESPSVRRKKKSEAARKRRYK 58


>gi|319651606|ref|ZP_08005733.1| 30S ribosomal protein S21 [Bacillus sp. 2_A_57_CT2]
 gi|317396673|gb|EFV77384.1| 30S ribosomal protein S21 [Bacillus sp. 2_A_57_CT2]
          Length = 57

 Score = 39.5 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G L+E + R  YEKPS KR +    A +R
Sbjct: 1  MSKTVVRKNESLEDALRRFKRSVSKTGTLQEARKREFYEKPSIKRKKKSEAARKR 55


>gi|257066653|ref|YP_003152909.1| 30S ribosomal protein S21 [Anaerococcus prevotii DSM 20548]
 gi|256798533|gb|ACV29188.1| ribosomal protein S21 [Anaerococcus prevotii DSM 20548]
          Length = 60

 Score = 39.5 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 30/53 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           + +++ A++  K++    GVL E + R HYEKPS  R +    A R++RK  
Sbjct: 8  ENESIDSAIKRFKRQCARSGVLSEYRRREHYEKPSVIRKKKNDAAKRKNRKNR 60


>gi|199599325|ref|ZP_03212723.1| Ribosomal protein S21 [Lactobacillus rhamnosus HN001]
 gi|229552361|ref|ZP_04441086.1| ribosomal protein S21 [Lactobacillus rhamnosus LMS2-1]
 gi|258508551|ref|YP_003171302.1| 30S ribosomal protein S21 [Lactobacillus rhamnosus GG]
 gi|258539732|ref|YP_003174231.1| 30S ribosomal protein S21 [Lactobacillus rhamnosus Lc 705]
 gi|199589764|gb|EDY97872.1| Ribosomal protein S21 [Lactobacillus rhamnosus HN001]
 gi|229314263|gb|EEN80236.1| ribosomal protein S21 [Lactobacillus rhamnosus LMS2-1]
 gi|257148478|emb|CAR87451.1| SSU/30S ribosomal protein S21P [Lactobacillus rhamnosus GG]
 gi|257151408|emb|CAR90380.1| SSU/30S ribosomal protein S21P [Lactobacillus rhamnosus Lc 705]
 gi|259649858|dbj|BAI42020.1| 30S ribosomal protein S21 [Lactobacillus rhamnosus GG]
 gi|328480077|gb|EGF49068.1| 30S ribosomal protein S21 [Lactobacillus rhamnosus MTCC 5462]
          Length = 58

 Score = 39.5 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 30/57 (52%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           A  V+ ++ +++ ALR  K+ +   G L E + R  YEKPS +R      A +R +
Sbjct: 1  MAKTVVKKNESLDDALRRFKRTVSKSGTLAEYRKREFYEKPSVRRKLKSEAARKRKK 57


>gi|116495004|ref|YP_806738.1| 30S ribosomal protein S21 [Lactobacillus casei ATCC 334]
 gi|191638510|ref|YP_001987676.1| 30S ribosomal protein S21 [Lactobacillus casei BL23]
 gi|227534988|ref|ZP_03965037.1| ribosomal protein S21 [Lactobacillus paracasei subsp. paracasei
          ATCC 25302]
 gi|239631401|ref|ZP_04674432.1| ribosomal protein S21 [Lactobacillus paracasei subsp. paracasei
          8700:2]
 gi|301066567|ref|YP_003788590.1| 30S ribosomal protein L21 [Lactobacillus casei str. Zhang]
 gi|122263579|sp|Q038S6|RS21_LACC3 RecName: Full=30S ribosomal protein S21
 gi|226695020|sp|B3WEL7|RS21_LACCB RecName: Full=30S ribosomal protein S21
 gi|116105154|gb|ABJ70296.1| SSU ribosomal protein S21P [Lactobacillus casei ATCC 334]
 gi|190712812|emb|CAQ66818.1| 30S ribosomal protein S21 [Lactobacillus casei BL23]
 gi|227187379|gb|EEI67446.1| ribosomal protein S21 [Lactobacillus paracasei subsp. paracasei
          ATCC 25302]
 gi|239525866|gb|EEQ64867.1| ribosomal protein S21 [Lactobacillus paracasei subsp. paracasei
          8700:2]
 gi|300438974|gb|ADK18740.1| Ribosomal protein S21 [Lactobacillus casei str. Zhang]
 gi|327382546|gb|AEA54022.1| Conserved domain protein [Lactobacillus casei LC2W]
 gi|327385743|gb|AEA57217.1| Conserved domain protein [Lactobacillus casei BD-II]
          Length = 58

 Score = 39.5 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 30/57 (52%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           A  V+ ++ +++ ALR  K+ +   G L E + R  YEKPS +R      A +R +
Sbjct: 1  MAKTVVKKNESLDDALRRFKRTVSKSGTLAEYRKREFYEKPSVRRKLKSEAARKRKK 57


>gi|259046837|ref|ZP_05737238.1| conserved domain protein [Granulicatella adiacens ATCC 49175]
 gi|260583643|ref|ZP_05851391.1| 30S ribosomal protein S21 [Granulicatella elegans ATCC 700633]
 gi|259036460|gb|EEW37715.1| conserved domain protein [Granulicatella adiacens ATCC 49175]
 gi|260158269|gb|EEW93337.1| 30S ribosomal protein S21 [Granulicatella elegans ATCC 700633]
          Length = 57

 Score = 39.5 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 17/55 (30%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS +R +    A +R
Sbjct: 1  MSKTVVRKNESLDDALRRFKRTVSKTGTLQEARKREFYEKPSVRRKKKSEAARKR 55


>gi|227510283|ref|ZP_03940332.1| 30S ribosomal protein S21 [Lactobacillus brevis subsp.
          gravesensis ATCC 27305]
 gi|227513290|ref|ZP_03943339.1| 30S ribosomal protein S21 [Lactobacillus buchneri ATCC 11577]
 gi|227524434|ref|ZP_03954483.1| 30S ribosomal protein S21 [Lactobacillus hilgardii ATCC 8290]
 gi|331701375|ref|YP_004398334.1| 30S ribosomal protein S21 [Lactobacillus buchneri NRRL B-30929]
 gi|227083491|gb|EEI18803.1| 30S ribosomal protein S21 [Lactobacillus buchneri ATCC 11577]
 gi|227088393|gb|EEI23705.1| 30S ribosomal protein S21 [Lactobacillus hilgardii ATCC 8290]
 gi|227189935|gb|EEI70002.1| 30S ribosomal protein S21 [Lactobacillus brevis subsp.
          gravesensis ATCC 27305]
 gi|329128718|gb|AEB73271.1| 30S ribosomal protein S21 [Lactobacillus buchneri NRRL B-30929]
          Length = 63

 Score = 39.5 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 28/52 (53%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
           A  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR      A
Sbjct: 1  MAKTVVRKNESLDDALRRFKRTVSKSGTLQEYRKREFYEKPSVKRKLKSEAA 52


>gi|325478605|gb|EGC81717.1| ribosomal protein S21 [Anaerococcus prevotii ACS-065-V-Col13]
          Length = 60

 Score = 39.5 bits (91), Expect = 0.17,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 30/53 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           + +++ A++  K++    GVL E + R HYEKPS  R +    A R++RK  
Sbjct: 8  ENESIDSAIKRFKRQCARSGVLSEYRRREHYEKPSVIRKKKNDAAKRKNRKNK 60


>gi|297584651|ref|YP_003700431.1| 30S ribosomal protein S21 [Bacillus selenitireducens MLS10]
 gi|297143108|gb|ADH99865.1| ribosomal protein S21 [Bacillus selenitireducens MLS10]
          Length = 57

 Score = 39.5 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 31/48 (64%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++ +++ ALR  KK M  EG ++E++ R HYEKPS KR +    A +R
Sbjct: 8  KNESIDAALRRFKKSMSKEGTMQEVRKRKHYEKPSIKRKKKSEAARKR 55


>gi|126700063|ref|YP_001088960.1| 30S ribosomal protein S21 [Clostridium difficile 630]
 gi|254976040|ref|ZP_05272512.1| 30S ribosomal protein S21 [Clostridium difficile QCD-66c26]
 gi|255093428|ref|ZP_05322906.1| 30S ribosomal protein S21 [Clostridium difficile CIP 107932]
 gi|255101606|ref|ZP_05330583.1| 30S ribosomal protein S21 [Clostridium difficile QCD-63q42]
 gi|255307475|ref|ZP_05351646.1| 30S ribosomal protein S21 [Clostridium difficile ATCC 43255]
 gi|255315173|ref|ZP_05356756.1| 30S ribosomal protein S21 [Clostridium difficile QCD-76w55]
 gi|255517842|ref|ZP_05385518.1| 30S ribosomal protein S21 [Clostridium difficile QCD-97b34]
 gi|255650958|ref|ZP_05397860.1| 30S ribosomal protein S21 [Clostridium difficile QCD-37x79]
 gi|255656427|ref|ZP_05401836.1| 30S ribosomal protein S21 [Clostridium difficile QCD-23m63]
 gi|260684027|ref|YP_003215312.1| 30S ribosomal protein S21 [Clostridium difficile CD196]
 gi|260687687|ref|YP_003218821.1| 30S ribosomal protein S21 [Clostridium difficile R20291]
 gi|296450126|ref|ZP_06891887.1| 30S ribosomal protein S21 [Clostridium difficile NAP08]
 gi|296878507|ref|ZP_06902512.1| 30S ribosomal protein S21 [Clostridium difficile NAP07]
 gi|306520837|ref|ZP_07407184.1| 30S ribosomal protein S21 [Clostridium difficile QCD-32g58]
 gi|119367247|sp|Q182D5|RS21_CLOD6 RecName: Full=30S ribosomal protein S21
 gi|115251500|emb|CAJ69333.1| 30S ribosomal protein S21 [Clostridium difficile]
 gi|260210190|emb|CBA64394.1| 30S ribosomal protein S21 [Clostridium difficile CD196]
 gi|260213704|emb|CBE05583.1| 30S ribosomal protein S21 [Clostridium difficile R20291]
 gi|296260889|gb|EFH07723.1| 30S ribosomal protein S21 [Clostridium difficile NAP08]
 gi|296430314|gb|EFH16156.1| 30S ribosomal protein S21 [Clostridium difficile NAP07]
          Length = 59

 Score = 39.5 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
             V VR+N  ++ ALR  K++    G++ E++ R HY+KPS KR +    A R++ K 
Sbjct: 1  MSEVRVRENETLDSALRRFKRQCAMSGIMSEVRKREHYDKPSVKRKKKAEAARRKNAKK 59


>gi|288555732|ref|YP_003427667.1| 30S ribosomal protein S21 [Bacillus pseudofirmus OF4]
 gi|288546892|gb|ADC50775.1| 30S ribosomal protein S21 [Bacillus pseudofirmus OF4]
          Length = 57

 Score = 39.5 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 30/48 (62%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++ +++ ALR  K+ +  EG L E+K R HYEKPS KR +    A +R
Sbjct: 8  KNESIDAALRRFKRSLSKEGTLAEVKKRKHYEKPSVKRKKKSEAARKR 55


>gi|268608895|ref|ZP_06142622.1| ribosomal protein S21 [Ruminococcus flavefaciens FD-1]
          Length = 57

 Score = 39.5 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 30/48 (62%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++ +++ AL+  K+    +GV+ E++ R HYEKPS KR +    A +R
Sbjct: 8  KNESLDTALKRFKRSCAKDGVIAEVRKREHYEKPSVKRKKKSEAARKR 55


>gi|243834|gb|AAB21178.1| ribosomal protein S21 [Bacillus stearothermophilus, Peptide, 55
          aa]
          Length = 55

 Score = 39.5 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 31/52 (59%)

Query: 21 YVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           ++ ++ +++ ALR  K+ +   G L+E++ R  YEKPS +R +    A +R
Sbjct: 3  TIVRKNESIDDALRRFKRAVSKTGTLQEVRKREFYEKPSVRRKKKSEAARKR 54


>gi|77412520|ref|ZP_00788818.1| ribosomal protein S21-related protein [Streptococcus agalactiae
          CJB111]
 gi|77161434|gb|EAO72447.1| ribosomal protein S21-related protein [Streptococcus agalactiae
          CJB111]
          Length = 54

 Score = 39.5 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 30/53 (56%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          V+ ++ +++ ALR  K+ +   G L+E + R  YEK S KR R    A +R +
Sbjct: 1  VVRKNESLDDALRRFKRSVTKAGTLQESRKREFYEKXSVKRKRKSEAARKRKK 53


>gi|229916335|ref|YP_002884981.1| 30S ribosomal protein S21 [Exiguobacterium sp. AT1b]
 gi|229467764|gb|ACQ69536.1| ribosomal protein S21 [Exiguobacterium sp. AT1b]
          Length = 57

 Score = 39.5 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          ++ ++E ALR  K+ +  +G L E++ R HYEKPS KR      A +R +
Sbjct: 7  KNESLEDALRRFKRGVSKDGTLAEVRKRRHYEKPSVKRKLKSEAARKRKK 56


>gi|209559151|ref|YP_002285623.1| SSU ribosomal protein S21p [Streptococcus pyogenes NZ131]
 gi|226695057|sp|B5XKR6|RS21_STRPZ RecName: Full=30S ribosomal protein S21
 gi|209540352|gb|ACI60928.1| SSU ribosomal protein S21p [Streptococcus pyogenes NZ131]
          Length = 58

 Score = 39.5 bits (91), Expect = 0.18,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 31/57 (54%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEK S KR R    A +R +
Sbjct: 1  MSKTVVRKNESLDDALRRFKRSVTKAGTLQESRKREFYEKLSVKRKRKSEAARKRKK 57


>gi|30264380|ref|NP_846757.1| 30S ribosomal protein S21 [Bacillus anthracis str. Ames]
 gi|47529831|ref|YP_021180.1| 30S ribosomal protein S21 [Bacillus anthracis str. 'Ames
          Ancestor']
 gi|47567874|ref|ZP_00238582.1| ribosomal protein S21 [Bacillus cereus G9241]
 gi|49187204|ref|YP_030456.1| 30S ribosomal protein S21 [Bacillus anthracis str. Sterne]
 gi|49481318|ref|YP_038364.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          konkukian str. 97-27]
 gi|52141193|ref|YP_085635.1| 30S ribosomal protein S21 [Bacillus cereus E33L]
 gi|65321682|ref|ZP_00394641.1| COG0828: Ribosomal protein S21 [Bacillus anthracis str. A2012]
 gi|161511020|ref|NP_980683.2| 30S ribosomal protein S21 [Bacillus cereus ATCC 10987]
 gi|163942065|ref|YP_001646949.1| 30S ribosomal protein S21 [Bacillus weihenstephanensis KBAB4]
 gi|165872077|ref|ZP_02216717.1| ribosomal protein S21 [Bacillus anthracis str. A0488]
 gi|167634674|ref|ZP_02392994.1| ribosomal protein S21 [Bacillus anthracis str. A0442]
 gi|167638596|ref|ZP_02396872.1| ribosomal protein S21 [Bacillus anthracis str. A0193]
 gi|170687366|ref|ZP_02878583.1| ribosomal protein S21 [Bacillus anthracis str. A0465]
 gi|170707372|ref|ZP_02897826.1| ribosomal protein S21 [Bacillus anthracis str. A0389]
 gi|177653259|ref|ZP_02935511.1| ribosomal protein S21 [Bacillus anthracis str. A0174]
 gi|190566879|ref|ZP_03019795.1| ribosomal protein S21 [Bacillus anthracis Tsiankovskii-I]
 gi|196034315|ref|ZP_03101724.1| ribosomal protein S21 [Bacillus cereus W]
 gi|196039188|ref|ZP_03106494.1| ribosomal protein S21 [Bacillus cereus NVH0597-99]
 gi|206969643|ref|ZP_03230597.1| 30S ribosomal protein S21 [Bacillus cereus AH1134]
 gi|206978422|ref|ZP_03239291.1| 30S ribosomal protein S21 [Bacillus cereus H3081.97]
 gi|217961799|ref|YP_002340369.1| 30S ribosomal protein S21 [Bacillus cereus AH187]
 gi|218233655|ref|YP_002369117.1| 30S ribosomal protein S21 [Bacillus cereus B4264]
 gi|218899477|ref|YP_002447888.1| ribosomal protein S21 [Bacillus cereus G9842]
 gi|218905446|ref|YP_002453280.1| ribosomal protein S21 [Bacillus cereus AH820]
 gi|222097754|ref|YP_002531811.1| 30S ribosomal protein s21 [Bacillus cereus Q1]
 gi|225866290|ref|YP_002751668.1| 30S ribosomal protein S21 [Bacillus cereus 03BB102]
 gi|227817085|ref|YP_002817094.1| 30S ribosomal protein S21 [Bacillus anthracis str. CDC 684]
 gi|228902834|ref|ZP_04066978.1| 30S ribosomal protein S21 [Bacillus thuringiensis IBL 4222]
 gi|228910146|ref|ZP_04073965.1| 30S ribosomal protein S21 [Bacillus thuringiensis IBL 200]
 gi|228916941|ref|ZP_04080502.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
 gi|228923062|ref|ZP_04086354.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          huazhongensis BGSC 4BD1]
 gi|228929353|ref|ZP_04092377.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          pondicheriensis BGSC 4BA1]
 gi|228935629|ref|ZP_04098443.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          andalousiensis BGSC 4AW1]
 gi|228941476|ref|ZP_04104026.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          berliner ATCC 10792]
 gi|228948022|ref|ZP_04110307.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|228954594|ref|ZP_04116618.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
 gi|228960577|ref|ZP_04122225.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          pakistani str. T13001]
 gi|228967378|ref|ZP_04128412.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar sotto
          str. T04001]
 gi|228974406|ref|ZP_04134974.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228981001|ref|ZP_04141303.1| 30S ribosomal protein S21 [Bacillus thuringiensis Bt407]
 gi|228987560|ref|ZP_04147678.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
 gi|228993051|ref|ZP_04152974.1| 30S ribosomal protein S21 [Bacillus pseudomycoides DSM 12442]
 gi|228999101|ref|ZP_04158683.1| 30S ribosomal protein S21 [Bacillus mycoides Rock3-17]
 gi|229006649|ref|ZP_04164283.1| 30S ribosomal protein S21 [Bacillus mycoides Rock1-4]
 gi|229013529|ref|ZP_04170663.1| 30S ribosomal protein S21 [Bacillus mycoides DSM 2048]
 gi|229019533|ref|ZP_04176350.1| 30S ribosomal protein S21 [Bacillus cereus AH1273]
 gi|229025775|ref|ZP_04182174.1| 30S ribosomal protein S21 [Bacillus cereus AH1272]
 gi|229031958|ref|ZP_04187944.1| 30S ribosomal protein S21 [Bacillus cereus AH1271]
 gi|229051302|ref|ZP_04194820.1| 30S ribosomal protein S21 [Bacillus cereus AH676]
 gi|229062007|ref|ZP_04199333.1| 30S ribosomal protein S21 [Bacillus cereus AH603]
 gi|229071813|ref|ZP_04205027.1| 30S ribosomal protein S21 [Bacillus cereus F65185]
 gi|229075983|ref|ZP_04208956.1| 30S ribosomal protein S21 [Bacillus cereus Rock4-18]
 gi|229081570|ref|ZP_04214067.1| 30S ribosomal protein S21 [Bacillus cereus Rock4-2]
 gi|229086879|ref|ZP_04219038.1| 30S ribosomal protein S21 [Bacillus cereus Rock3-44]
 gi|229093379|ref|ZP_04224484.1| 30S ribosomal protein S21 [Bacillus cereus Rock3-42]
 gi|229098780|ref|ZP_04229718.1| 30S ribosomal protein S21 [Bacillus cereus Rock3-29]
 gi|229104940|ref|ZP_04235596.1| 30S ribosomal protein S21 [Bacillus cereus Rock3-28]
 gi|229111782|ref|ZP_04241329.1| 30S ribosomal protein S21 [Bacillus cereus Rock1-15]
 gi|229117806|ref|ZP_04247170.1| 30S ribosomal protein S21 [Bacillus cereus Rock1-3]
 gi|229123848|ref|ZP_04253041.1| 30S ribosomal protein S21 [Bacillus cereus 95/8201]
 gi|229129588|ref|ZP_04258557.1| 30S ribosomal protein S21 [Bacillus cereus BDRD-Cer4]
 gi|229135134|ref|ZP_04263936.1| 30S ribosomal protein S21 [Bacillus cereus BDRD-ST196]
 gi|229141047|ref|ZP_04269589.1| 30S ribosomal protein S21 [Bacillus cereus BDRD-ST26]
 gi|229148156|ref|ZP_04276462.1| 30S ribosomal protein S21 [Bacillus cereus BDRD-ST24]
 gi|229152511|ref|ZP_04280702.1| 30S ribosomal protein S21 [Bacillus cereus m1550]
 gi|229157923|ref|ZP_04285996.1| 30S ribosomal protein S21 [Bacillus cereus ATCC 4342]
 gi|229163254|ref|ZP_04291209.1| 30S ribosomal protein S21 [Bacillus cereus R309803]
 gi|229169057|ref|ZP_04296773.1| 30S ribosomal protein S21 [Bacillus cereus AH621]
 gi|229174984|ref|ZP_04302503.1| 30S ribosomal protein S21 [Bacillus cereus MM3]
 gi|229180586|ref|ZP_04307928.1| 30S ribosomal protein S21 [Bacillus cereus 172560W]
 gi|229186549|ref|ZP_04313710.1| 30S ribosomal protein S21 [Bacillus cereus BGSC 6E1]
 gi|229192519|ref|ZP_04319481.1| 30S ribosomal protein S21 [Bacillus cereus ATCC 10876]
 gi|229198437|ref|ZP_04325141.1| 30S ribosomal protein S21 [Bacillus cereus m1293]
 gi|229601945|ref|YP_002868598.1| 30S ribosomal protein S21 [Bacillus anthracis str. A0248]
 gi|254684066|ref|ZP_05147926.1| 30S ribosomal protein S21 [Bacillus anthracis str. CNEVA-9066]
 gi|254721900|ref|ZP_05183689.1| 30S ribosomal protein S21 [Bacillus anthracis str. A1055]
 gi|254736414|ref|ZP_05194120.1| 30S ribosomal protein S21 [Bacillus anthracis str. Western North
          America USA6153]
 gi|254741452|ref|ZP_05199139.1| 30S ribosomal protein S21 [Bacillus anthracis str. Kruger B]
 gi|254750890|ref|ZP_05202929.1| 30S ribosomal protein S21 [Bacillus anthracis str. Vollum]
 gi|254757782|ref|ZP_05209809.1| 30S ribosomal protein S21 [Bacillus anthracis str. Australia 94]
 gi|296504803|ref|YP_003666503.1| SSU ribosomal protein S21P [Bacillus thuringiensis BMB171]
 gi|300118701|ref|ZP_07056429.1| 30S ribosomal protein S21 [Bacillus cereus SJ1]
 gi|301055801|ref|YP_003794012.1| 30S ribosomal protein S21 [Bacillus anthracis CI]
 gi|61215849|sp|Q634N2|RS21_BACCZ RecName: Full=30S ribosomal protein S21
 gi|61215929|sp|Q6HDL2|RS21_BACHK RecName: Full=30S ribosomal protein S21
 gi|61215977|sp|Q730M6|RS21_BACC1 RecName: Full=30S ribosomal protein S21
 gi|61216037|sp|Q81LS7|RS21_BACAN RecName: Full=30S ribosomal protein S21
 gi|226694972|sp|B7JN34|RS21_BACC0 RecName: Full=30S ribosomal protein S21
 gi|226694973|sp|B7IYG2|RS21_BACC2 RecName: Full=30S ribosomal protein S21
 gi|226694974|sp|B7HCT4|RS21_BACC4 RecName: Full=30S ribosomal protein S21
 gi|226694975|sp|B7HPK8|RS21_BACC7 RecName: Full=30S ribosomal protein S21
 gi|226694976|sp|A9VHT6|RS21_BACWK RecName: Full=30S ribosomal protein S21
 gi|254813079|sp|C3P8L5|RS21_BACAA RecName: Full=30S ribosomal protein S21
 gi|254813080|sp|C3L5R2|RS21_BACAC RecName: Full=30S ribosomal protein S21
 gi|254813081|sp|C1ESK3|RS21_BACC3 RecName: Full=30S ribosomal protein S21
 gi|254813082|sp|B9IY76|RS21_BACCQ RecName: Full=30S ribosomal protein S21
 gi|30259038|gb|AAP28243.1| 30S ribosomal protein S21 [Bacillus anthracis str. Ames]
 gi|47504979|gb|AAT33655.1| ribosomal protein S21 [Bacillus anthracis str. 'Ames Ancestor']
 gi|47555551|gb|EAL13894.1| ribosomal protein S21 [Bacillus cereus G9241]
 gi|49181131|gb|AAT56507.1| ribosomal protein S21 [Bacillus anthracis str. Sterne]
 gi|49332874|gb|AAT63520.1| ribosomal protein S21 (30S ribosomal protein S21) [Bacillus
          thuringiensis serovar konkukian str. 97-27]
 gi|51974662|gb|AAU16212.1| ribosomal protein S21 (30S ribosomal protein S21) [Bacillus
          cereus E33L]
 gi|163864262|gb|ABY45321.1| ribosomal protein S21 [Bacillus weihenstephanensis KBAB4]
 gi|164712208|gb|EDR17745.1| ribosomal protein S21 [Bacillus anthracis str. A0488]
 gi|167513444|gb|EDR88814.1| ribosomal protein S21 [Bacillus anthracis str. A0193]
 gi|167530126|gb|EDR92861.1| ribosomal protein S21 [Bacillus anthracis str. A0442]
 gi|170127616|gb|EDS96489.1| ribosomal protein S21 [Bacillus anthracis str. A0389]
 gi|170668561|gb|EDT19307.1| ribosomal protein S21 [Bacillus anthracis str. A0465]
 gi|172081541|gb|EDT66613.1| ribosomal protein S21 [Bacillus anthracis str. A0174]
 gi|190561870|gb|EDV15839.1| ribosomal protein S21 [Bacillus anthracis Tsiankovskii-I]
 gi|195992857|gb|EDX56816.1| ribosomal protein S21 [Bacillus cereus W]
 gi|196029815|gb|EDX68416.1| ribosomal protein S21 [Bacillus cereus NVH0597-99]
 gi|206735331|gb|EDZ52499.1| 30S ribosomal protein S21 [Bacillus cereus AH1134]
 gi|206743378|gb|EDZ54816.1| 30S ribosomal protein S21 [Bacillus cereus H3081.97]
 gi|217066015|gb|ACJ80265.1| ribosomal protein S21 [Bacillus cereus AH187]
 gi|218161612|gb|ACK61604.1| ribosomal protein S21 [Bacillus cereus B4264]
 gi|218538884|gb|ACK91282.1| ribosomal protein S21 [Bacillus cereus AH820]
 gi|218544019|gb|ACK96413.1| ribosomal protein S21 [Bacillus cereus G9842]
 gi|221241812|gb|ACM14522.1| ribosomal protein S21 (30S ribosomal protein S21) [Bacillus
          cereus Q1]
 gi|225789543|gb|ACO29760.1| 30S ribosomal protein S21 [Bacillus cereus 03BB102]
 gi|227005480|gb|ACP15223.1| 30S ribosomal protein S21 [Bacillus anthracis str. CDC 684]
 gi|228584940|gb|EEK43054.1| 30S ribosomal protein S21 [Bacillus cereus m1293]
 gi|228590943|gb|EEK48800.1| 30S ribosomal protein S21 [Bacillus cereus ATCC 10876]
 gi|228596808|gb|EEK54467.1| 30S ribosomal protein S21 [Bacillus cereus BGSC 6E1]
 gi|228603010|gb|EEK60489.1| 30S ribosomal protein S21 [Bacillus cereus 172560W]
 gi|228608445|gb|EEK65748.1| 30S ribosomal protein S21 [Bacillus cereus MM3]
 gi|228614466|gb|EEK71575.1| 30S ribosomal protein S21 [Bacillus cereus AH621]
 gi|228620317|gb|EEK77188.1| 30S ribosomal protein S21 [Bacillus cereus R309803]
 gi|228625531|gb|EEK82285.1| 30S ribosomal protein S21 [Bacillus cereus ATCC 4342]
 gi|228630942|gb|EEK87580.1| 30S ribosomal protein S21 [Bacillus cereus m1550]
 gi|228635296|gb|EEK91820.1| 30S ribosomal protein S21 [Bacillus cereus BDRD-ST24]
 gi|228642325|gb|EEK98614.1| 30S ribosomal protein S21 [Bacillus cereus BDRD-ST26]
 gi|228648363|gb|EEL04396.1| 30S ribosomal protein S21 [Bacillus cereus BDRD-ST196]
 gi|228653856|gb|EEL09725.1| 30S ribosomal protein S21 [Bacillus cereus BDRD-Cer4]
 gi|228659562|gb|EEL15209.1| 30S ribosomal protein S21 [Bacillus cereus 95/8201]
 gi|228665603|gb|EEL21081.1| 30S ribosomal protein S21 [Bacillus cereus Rock1-3]
 gi|228671656|gb|EEL26953.1| 30S ribosomal protein S21 [Bacillus cereus Rock1-15]
 gi|228678434|gb|EEL32655.1| 30S ribosomal protein S21 [Bacillus cereus Rock3-28]
 gi|228684624|gb|EEL38564.1| 30S ribosomal protein S21 [Bacillus cereus Rock3-29]
 gi|228689973|gb|EEL43776.1| 30S ribosomal protein S21 [Bacillus cereus Rock3-42]
 gi|228696389|gb|EEL49215.1| 30S ribosomal protein S21 [Bacillus cereus Rock3-44]
 gi|228701726|gb|EEL54215.1| 30S ribosomal protein S21 [Bacillus cereus Rock4-2]
 gi|228707095|gb|EEL59295.1| 30S ribosomal protein S21 [Bacillus cereus Rock4-18]
 gi|228711292|gb|EEL63253.1| 30S ribosomal protein S21 [Bacillus cereus F65185]
 gi|228717316|gb|EEL68989.1| 30S ribosomal protein S21 [Bacillus cereus AH603]
 gi|228722060|gb|EEL73487.1| 30S ribosomal protein S21 [Bacillus cereus AH676]
 gi|228729348|gb|EEL80339.1| 30S ribosomal protein S21 [Bacillus cereus AH1271]
 gi|228735483|gb|EEL86079.1| 30S ribosomal protein S21 [Bacillus cereus AH1272]
 gi|228741789|gb|EEL91972.1| 30S ribosomal protein S21 [Bacillus cereus AH1273]
 gi|228747766|gb|EEL97635.1| 30S ribosomal protein S21 [Bacillus mycoides DSM 2048]
 gi|228754510|gb|EEM03921.1| 30S ribosomal protein S21 [Bacillus mycoides Rock1-4]
 gi|228760718|gb|EEM09682.1| 30S ribosomal protein S21 [Bacillus mycoides Rock3-17]
 gi|228766699|gb|EEM15339.1| 30S ribosomal protein S21 [Bacillus pseudomycoides DSM 12442]
 gi|228772158|gb|EEM20606.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          tochigiensis BGSC 4Y1]
 gi|228778661|gb|EEM26926.1| 30S ribosomal protein S21 [Bacillus thuringiensis Bt407]
 gi|228785242|gb|EEM33253.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          thuringiensis str. T01001]
 gi|228792304|gb|EEM39872.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar sotto
          str. T04001]
 gi|228799090|gb|EEM46059.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          pakistani str. T13001]
 gi|228805040|gb|EEM51635.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          kurstaki str. T03a001]
 gi|228811608|gb|EEM57944.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          monterrey BGSC 4AJ1]
 gi|228818126|gb|EEM64201.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          berliner ATCC 10792]
 gi|228823989|gb|EEM69807.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          andalousiensis BGSC 4AW1]
 gi|228830304|gb|EEM75917.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          pondicheriensis BGSC 4BA1]
 gi|228836560|gb|EEM81909.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          huazhongensis BGSC 4BD1]
 gi|228842662|gb|EEM87749.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          pulsiensis BGSC 4CC1]
 gi|228849429|gb|EEM94264.1| 30S ribosomal protein S21 [Bacillus thuringiensis IBL 200]
 gi|228856790|gb|EEN01306.1| 30S ribosomal protein S21 [Bacillus thuringiensis IBL 4222]
 gi|229266353|gb|ACQ47990.1| 30S ribosomal protein S21 [Bacillus anthracis str. A0248]
 gi|296325855|gb|ADH08783.1| SSU ribosomal protein S21P [Bacillus thuringiensis BMB171]
 gi|298723950|gb|EFI64664.1| 30S ribosomal protein S21 [Bacillus cereus SJ1]
 gi|300377970|gb|ADK06874.1| 30S ribosomal protein S21 [Bacillus cereus biovar anthracis str.
          CI]
 gi|324328213|gb|ADY23473.1| 30S ribosomal protein S21 [Bacillus thuringiensis serovar
          finitimus YBT-020]
 gi|326942092|gb|AEA17988.1| SSU ribosomal protein S21P [Bacillus thuringiensis serovar
          chinensis CT-43]
          Length = 57

 Score = 39.1 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ ++E ALR  K+ +   G L E + R  YEKPS KR +    A +R
Sbjct: 1  MSKTVVRKNESLEDALRRFKRSVSKTGTLAEARKREFYEKPSVKRKKKSEAARKR 55


>gi|116618402|ref|YP_818773.1| SSU ribosomal protein S21P [Leuconostoc mesenteroides subsp.
          mesenteroides ATCC 8293]
 gi|122271398|sp|Q03WM2|RS21_LEUMM RecName: Full=30S ribosomal protein S21
 gi|116097249|gb|ABJ62400.1| SSU ribosomal protein S21P [Leuconostoc mesenteroides subsp.
          mesenteroides ATCC 8293]
          Length = 61

 Score = 39.1 bits (90), Expect = 0.18,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 34/61 (55%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           A  ++ ++ +++ ALR  K+ +  +G L+E + R +Y KPS  R      A +R++K  
Sbjct: 1  MAKVIVRKNESLDDALRRFKRGVSKDGTLQEYRKREYYVKPSVARKLKSEAAQKRNKKKG 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|206900604|ref|YP_002251044.1| ribosomal protein S21 [Dictyoglomus thermophilum H-6-12]
 gi|217967712|ref|YP_002353218.1| ribosomal protein S21 [Dictyoglomus turgidum DSM 6724]
 gi|226694998|sp|B5YET6|RS21_DICT6 RecName: Full=30S ribosomal protein S21
 gi|226694999|sp|B8E0F9|RS21_DICTD RecName: Full=30S ribosomal protein S21
 gi|206739707|gb|ACI18765.1| ribosomal protein S21 [Dictyoglomus thermophilum H-6-12]
 gi|217336811|gb|ACK42604.1| ribosomal protein S21 [Dictyoglomus turgidum DSM 6724]
          Length = 56

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 18/40 (45%), Positives = 30/40 (75%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVR 64
          +D +++ AL+  KKK+Q +GVL +++   +YEKPS+KR R
Sbjct: 8  KDESLDSALKRFKKKLQEDGVLADIRRHEYYEKPSEKRNR 47


>gi|167464602|ref|ZP_02329691.1| hypothetical protein Plarl_18952 [Paenibacillus larvae subsp.
          larvae BRL-230010]
          Length = 57

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 30/48 (62%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++  ++ ALR  K+ +  +GVL E+K R HYEKPS KR +    A +R
Sbjct: 8  KNETIDAALRRFKRSIAKDGVLAEIKKRKHYEKPSVKRKKKSEAARKR 55


>gi|146281108|ref|YP_001171261.1| 30S ribosomal protein S21 [Pseudomonas stutzeri A1501]
 gi|146309040|ref|YP_001189505.1| 30S ribosomal protein S21 [Pseudomonas mendocina ymp]
 gi|330505278|ref|YP_004382147.1| 30S ribosomal protein S21 [Pseudomonas mendocina NK-01]
 gi|166224057|sp|A4XZK7|RS21_PSEMY RecName: Full=30S ribosomal protein S21
 gi|166224059|sp|A4VHG8|RS21_PSEU5 RecName: Full=30S ribosomal protein S21
 gi|145569313|gb|ABP78419.1| ribosomal protein S21 [Pseudomonas stutzeri A1501]
 gi|145577241|gb|ABP86773.1| SSU ribosomal protein S21P [Pseudomonas mendocina ymp]
 gi|327479261|gb|AEA82571.1| 30S ribosomal protein S21 [Pseudomonas stutzeri DSM 4166]
 gi|328919564|gb|AEB60395.1| 30S ribosomal protein S21 [Pseudomonas mendocina NK-01]
          Length = 71

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+  +  GVL E++ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAERKRKAAAAVKRHAKKV 60

Query: 78 RKIAQR 83
          ++  +R
Sbjct: 61 QREQRR 66


>gi|227824687|ref|ZP_03989519.1| predicted protein [Acidaminococcus sp. D21]
 gi|226905186|gb|EEH91104.1| predicted protein [Acidaminococcus sp. D21]
          Length = 58

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 30/51 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  +++ ALR  K+  Q  GVL E++ R HYEKPS KR +    A +R  +
Sbjct: 8  KTESIDSALRRFKRATQKAGVLSEVRKREHYEKPSVKRKKKSEAARKRKSR 58


>gi|164686287|ref|ZP_02210317.1| hypothetical protein CLOBAR_02725 [Clostridium bartlettii DSM
          16795]
 gi|210623867|ref|ZP_03294102.1| hypothetical protein CLOHIR_02053 [Clostridium hiranonis DSM
          13275]
 gi|289423880|ref|ZP_06425673.1| ribosomal protein S21 [Peptostreptococcus anaerobius 653-L]
 gi|307244178|ref|ZP_07526293.1| ribosomal protein S21 [Peptostreptococcus stomatis DSM 17678]
 gi|164601889|gb|EDQ95354.1| hypothetical protein CLOBAR_02725 [Clostridium bartlettii DSM
          16795]
 gi|210153293|gb|EEA84299.1| hypothetical protein CLOHIR_02053 [Clostridium hiranonis DSM
          13275]
 gi|289155657|gb|EFD04329.1| ribosomal protein S21 [Peptostreptococcus anaerobius 653-L]
 gi|306492328|gb|EFM64366.1| ribosomal protein S21 [Peptostreptococcus stomatis DSM 17678]
          Length = 59

 Score = 39.1 bits (90), Expect = 0.19,   Method: Composition-based stats.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
             V VR+N  ++ ALR  K++    G++ E++ R HY+KPS KR +    A R++ K 
Sbjct: 1  MSEVRVRENESLDSALRRFKRQCAMSGIMSEVRKREHYDKPSVKRKKKAEAARRKNAKR 59


>gi|325971471|ref|YP_004247662.1| 30S ribosomal protein S21 [Spirochaeta sp. Buddy]
 gi|324026709|gb|ADY13468.1| 30S ribosomal protein S21 [Spirochaeta sp. Buddy]
          Length = 69

 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 23/68 (33%), Positives = 40/68 (58%), Gaps = 1/68 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
            +V V DN  +E++++  K+ ++ EG++RE K R ++EKPS    R K    R+  K +
Sbjct: 1  MAFVKVDDNEPLEKSIKRFKRMVEKEGIIREWKKREYFEKPSTILNRKKKALARKQMKKV 60

Query: 78 RKIAQREG 85
          RK+   +G
Sbjct: 61 RKLHGTKG 68


>gi|307266429|ref|ZP_07547965.1| ribosomal protein S21 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326389858|ref|ZP_08211422.1| ribosomal protein S21 [Thermoanaerobacter ethanolicus JW 200]
 gi|306918537|gb|EFN48775.1| ribosomal protein S21 [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325994126|gb|EGD52554.1| ribosomal protein S21 [Thermoanaerobacter ethanolicus JW 200]
          Length = 61

 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 30/54 (55%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + +++ ALR  +++    GVL EL+ R HYE PS KR +    A +R  K  +
Sbjct: 8  ENESLDNALRRFRRQCSKAGVLSELRKREHYESPSVKRKKKSEAARKRKYKYNK 61


>gi|289578125|ref|YP_003476752.1| ribosomal protein S21 [Thermoanaerobacter italicus Ab9]
 gi|297544400|ref|YP_003676702.1| 30S ribosomal protein S21 [Thermoanaerobacter mathranii subsp.
          mathranii str. A3]
 gi|289527838|gb|ADD02190.1| ribosomal protein S21 [Thermoanaerobacter italicus Ab9]
 gi|296842175|gb|ADH60691.1| ribosomal protein S21 [Thermoanaerobacter mathranii subsp.
          mathranii str. A3]
          Length = 61

 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 19/54 (35%), Positives = 30/54 (55%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + +++ ALR  +++    GVL EL+ R HYE PS KR +    A +R  K  +
Sbjct: 8  ENESLDNALRRFRRQCSKAGVLSELRKREHYESPSVKRKKKSEAARKRKYKYNK 61


>gi|26987131|ref|NP_742556.1| 30S ribosomal protein S21 [Pseudomonas putida KT2440]
 gi|104779689|ref|YP_606187.1| 30S ribosomal protein S21 [Pseudomonas entomophila L48]
 gi|148545675|ref|YP_001265777.1| 30S ribosomal protein S21 [Pseudomonas putida F1]
 gi|167031436|ref|YP_001666667.1| 30S ribosomal protein S21 [Pseudomonas putida GB-1]
 gi|170723970|ref|YP_001751658.1| 30S ribosomal protein S21 [Pseudomonas putida W619]
 gi|325273043|ref|ZP_08139353.1| 30S ribosomal protein S21 [Pseudomonas sp. TJI-51]
 gi|60399061|sp|P0A165|RS21_PSEPK RecName: Full=30S ribosomal protein S21
 gi|60399064|sp|P0A166|RS21_PSEPU RecName: Full=30S ribosomal protein S21
 gi|166224056|sp|Q1IG32|RS21_PSEE4 RecName: Full=30S ribosomal protein S21
 gi|166224058|sp|A5VXI3|RS21_PSEP1 RecName: Full=30S ribosomal protein S21
 gi|189044909|sp|B0KJ81|RS21_PSEPG RecName: Full=30S ribosomal protein S21
 gi|226695039|sp|B1JDY6|RS21_PSEPW RecName: Full=30S ribosomal protein S21
 gi|24981762|gb|AAN66020.1|AE016231_3 ribosomal protein S21 [Pseudomonas putida KT2440]
 gi|2731760|gb|AAC38071.1| 30S subunit ribosomal protein S21 [Pseudomonas putida]
 gi|95108676|emb|CAK13370.1| 30S ribosomal protein S21 [Pseudomonas entomophila L48]
 gi|148509733|gb|ABQ76593.1| SSU ribosomal protein S21P [Pseudomonas putida F1]
 gi|166857924|gb|ABY96331.1| ribosomal protein S21 [Pseudomonas putida GB-1]
 gi|169761973|gb|ACA75289.1| ribosomal protein S21 [Pseudomonas putida W619]
 gi|313496755|gb|ADR58121.1| RpsU [Pseudomonas putida BIRD-1]
 gi|324101816|gb|EGB99352.1| 30S ribosomal protein S21 [Pseudomonas sp. TJI-51]
          Length = 71

 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+  +  GVL E++ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPAVKVKENEPFDVALRRFKRSCEKAGVLAEVRSREFYEKPTAERKRKAAAAVKRHAKKV 60

Query: 78 RKIAQR 83
          ++  +R
Sbjct: 61 QREQRR 66


>gi|313884135|ref|ZP_07817901.1| ribosomal protein S21 [Eremococcus coleocola ACS-139-V-Col8]
 gi|312620582|gb|EFR32005.1| ribosomal protein S21 [Eremococcus coleocola ACS-139-V-Col8]
          Length = 57

 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 19/55 (34%), Positives = 30/55 (54%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+  + +++ ALR  K+ +   G LRE + R  YEKPS KR +    A +R
Sbjct: 1  MSKTVVRDNESLDDALRRFKRNVSKTGTLREARKREFYEKPSVKRKKKSEAARKR 55


>gi|238926161|ref|ZP_04657921.1| 30S ribosomal protein S21 [Selenomonas flueggei ATCC 43531]
 gi|255659205|ref|ZP_05404614.1| ribosomal protein S21 [Mitsuokella multacida DSM 20544]
 gi|292670970|ref|ZP_06604396.1| 30S ribosomal protein S21 [Selenomonas noxia ATCC 43541]
 gi|304436683|ref|ZP_07396652.1| 30S ribosomal protein S21 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
 gi|313896380|ref|ZP_07829933.1| ribosomal protein S21 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320529151|ref|ZP_08030243.1| ribosomal protein S21 [Selenomonas artemidis F0399]
 gi|238885841|gb|EEQ49479.1| 30S ribosomal protein S21 [Selenomonas flueggei ATCC 43531]
 gi|260848657|gb|EEX68664.1| ribosomal protein S21 [Mitsuokella multacida DSM 20544]
 gi|292647591|gb|EFF65563.1| 30S ribosomal protein S21 [Selenomonas noxia ATCC 43541]
 gi|304370379|gb|EFM24035.1| 30S ribosomal protein S21 [Selenomonas sp. oral taxon 149 str.
          67H29BP]
 gi|312975179|gb|EFR40641.1| ribosomal protein S21 [Selenomonas sp. oral taxon 137 str. F0430]
 gi|320138781|gb|EFW30671.1| ribosomal protein S21 [Selenomonas artemidis F0399]
          Length = 60

 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          ++ +++ ALR  K+  Q  G L E++ R HYEKPS +R +    A +R  +
Sbjct: 9  KNESIDSALRRFKRMSQKAGTLAEVRKREHYEKPSVRRKKKSEAARKRKYR 59


>gi|326411124|gb|ADZ68188.1| 30S ribosomal protein S21 [Brucella melitensis M28]
          Length = 55

 Score = 39.1 bits (90), Expect = 0.20,   Method: Composition-based stats.
 Identities = 35/51 (68%), Positives = 41/51 (80%)

Query: 40 MQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSR 90
          MQ EG+ RE+KMRGHYEKPS+KR R K+EA+RR+RKL RK AQREG    R
Sbjct: 1  MQREGIFREMKMRGHYEKPSEKRAREKAEAVRRARKLARKRAQREGLIGGR 51


>gi|317057731|ref|YP_004106198.1| 30S ribosomal protein S21 [Ruminococcus albus 7]
 gi|325677905|ref|ZP_08157547.1| ribosomal protein S21 [Ruminococcus albus 8]
 gi|315450000|gb|ADU23564.1| ribosomal protein S21 [Ruminococcus albus 7]
 gi|324110459|gb|EGC04633.1| ribosomal protein S21 [Ruminococcus albus 8]
          Length = 57

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 29/48 (60%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++  ++ AL+  K+    +GV+ E++ R HYEKPS KR +    A +R
Sbjct: 8  KNETLDTALKRFKRSCARDGVIAEVRKREHYEKPSVKRKKKSEAARKR 55


>gi|170017030|ref|YP_001727949.1| ribosomal protein S21 [Leuconostoc citreum KM20]
 gi|296112004|ref|YP_003622386.1| ribosomal protein S21 [Leuconostoc kimchii IMSNU 11154]
 gi|326692506|ref|ZP_08229511.1| 30S ribosomal protein S21 [Leuconostoc argentinum KCTC 3773]
 gi|226695024|sp|B1MYA3|RS21_LEUCK RecName: Full=30S ribosomal protein S21
 gi|169803887|gb|ACA82505.1| Ribosomal protein S21 [Leuconostoc citreum KM20]
 gi|295833536|gb|ADG41417.1| ribosomal protein S21 [Leuconostoc kimchii IMSNU 11154]
          Length = 61

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 33/61 (54%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           A  ++ ++ +++ ALR  K+ +  +G L+E + R  Y KPS  R      A +R++K  
Sbjct: 1  MAKVIVRKNESLDDALRRFKRGVSKDGTLQEYRKREFYVKPSVARKLKSEAAQKRNKKKG 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|134300329|ref|YP_001113825.1| 30S ribosomal protein S21 [Desulfotomaculum reducens MI-1]
 gi|172044329|sp|A4J7E7|RS21_DESRM RecName: Full=30S ribosomal protein S21
 gi|134053029|gb|ABO51000.1| SSU ribosomal protein S21P [Desulfotomaculum reducens MI-1]
          Length = 59

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 27/48 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++  ++ ALR  K+  Q  GVL E +   +YEKPS KR +    A +R
Sbjct: 8  KNETLDSALRRFKRSCQKAGVLAEARKHEYYEKPSVKRKKKSEAARKR 55


>gi|323141890|ref|ZP_08076751.1| ribosomal protein S21 [Phascolarctobacterium sp. YIT 12067]
 gi|322413637|gb|EFY04495.1| ribosomal protein S21 [Phascolarctobacterium sp. YIT 12067]
          Length = 65

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 29/51 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          ++  ++ ALR  K+  Q  G+L E++ R HYEKPS  R +    A +R  +
Sbjct: 15 KNETLDSALRRFKRATQKAGILSEVRKREHYEKPSVARKKKSEAARKRKTR 65


>gi|317128307|ref|YP_004094589.1| ribosomal protein S21 [Bacillus cellulosilyticus DSM 2522]
 gi|315473255|gb|ADU29858.1| ribosomal protein S21 [Bacillus cellulosilyticus DSM 2522]
          Length = 57

 Score = 39.1 bits (90), Expect = 0.21,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 30/48 (62%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++ +++ ALR  K+ M  EG L E++ R HYEKPS KR +    A +R
Sbjct: 8  KNESIDAALRRFKRTMSKEGTLAEVRKRKHYEKPSIKRKKKSEAARKR 55


>gi|227486730|ref|ZP_03917046.1| ribosomal protein S21 [Anaerococcus lactolyticus ATCC 51172]
 gi|227235318|gb|EEI85333.1| ribosomal protein S21 [Anaerococcus lactolyticus ATCC 51172]
          Length = 60

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 30/53 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           + +++ A++  K++    GVL E + R HYEKPS  + +    A R++RK  
Sbjct: 8  ENESIDSAIKRFKRQCARSGVLSEYRRREHYEKPSVIKKKKNDAAKRKNRKRK 60


>gi|145589881|ref|YP_001156478.1| ribosomal protein S21 [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
 gi|171464019|ref|YP_001798132.1| ribosomal protein S21 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
 gi|189044908|sp|A4SZK0|RS21_POLSQ RecName: Full=30S ribosomal protein S21
 gi|226695034|sp|B1XVZ1|RS21_POLNS RecName: Full=30S ribosomal protein S21
 gi|145048287|gb|ABP34914.1| SSU ribosomal protein S21P [Polynucleobacter necessarius subsp.
          asymbioticus QLW-P1DMWA-1]
 gi|171193557|gb|ACB44518.1| ribosomal protein S21 [Polynucleobacter necessarius subsp.
          necessarius STIR1]
          Length = 70

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 23/69 (33%), Positives = 37/69 (53%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V +R+N   E ALR  K+ ++  G+L +L+ R  YEKP+ +R R K+ A +R  K +
Sbjct: 1  MTTVRLRENEPFEVALRRFKRTIEKNGLLTDLRAREFYEKPTAERKRKKAAAAKRHYKRI 60

Query: 78 RKIAQREGA 86
          R     +  
Sbjct: 61 RSQMLPKKL 69


>gi|89255866|ref|YP_513228.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica LVS]
 gi|115314355|ref|YP_763078.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica OSU18]
 gi|156501849|ref|YP_001427915.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica FTNF002-00]
 gi|167010092|ref|ZP_02275023.1| ribosomal protein S21 [Francisella tularensis subsp. holarctica
          FSC200]
 gi|254367230|ref|ZP_04983258.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica 257]
 gi|290953338|ref|ZP_06557959.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|295313427|ref|ZP_06804033.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|119367207|sp|Q2A4X4|RS211_FRATH RecName: Full=30S ribosomal protein S21 1
 gi|119367208|sp|Q0BN93|RS211_FRATO RecName: Full=30S ribosomal protein S21 1
 gi|89143697|emb|CAJ78896.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica LVS]
 gi|115129254|gb|ABI82441.1| ribosomal protein S21 [Francisella tularensis subsp. holarctica
          OSU18]
 gi|134253048|gb|EBA52142.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica 257]
 gi|156252452|gb|ABU60958.1| ribosomal protein S21 [Francisella tularensis subsp. holarctica
          FTNF002-00]
          Length = 65

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 32/51 (62%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           + +LR  K+  +  G+ +EL+ R HY KP++KR   K +A++R+R   R+
Sbjct: 12 FDISLRNFKRACEKAGIKQELRDRQHYVKPTEKRKIAKRQAVKRARISQRR 62


>gi|42519250|ref|NP_965180.1| 30S ribosomal protein S21 [Lactobacillus johnsonii NCC 533]
 gi|227890113|ref|ZP_04007918.1| 30S ribosomal protein S21 [Lactobacillus johnsonii ATCC 33200]
 gi|238853409|ref|ZP_04643788.1| ribosomal protein S21 [Lactobacillus gasseri 202-4]
 gi|268319368|ref|YP_003293024.1| ribosomal protein S21 [Lactobacillus johnsonii FI9785]
 gi|282851782|ref|ZP_06261145.1| ribosomal protein S21 [Lactobacillus gasseri 224-1]
 gi|300361847|ref|ZP_07058024.1| 30S ribosomal protein S21 [Lactobacillus gasseri JV-V03]
 gi|311110598|ref|ZP_07711995.1| ribosomal protein S21 [Lactobacillus gasseri MV-22]
 gi|61215994|sp|Q74IY5|RS21_LACJO RecName: Full=30S ribosomal protein S21
 gi|41583538|gb|AAS09146.1| hypothetical protein LJ_1325 [Lactobacillus johnsonii NCC 533]
 gi|227849557|gb|EEJ59643.1| 30S ribosomal protein S21 [Lactobacillus johnsonii ATCC 33200]
 gi|238833981|gb|EEQ26239.1| ribosomal protein S21 [Lactobacillus gasseri 202-4]
 gi|262397743|emb|CAX66757.1| ribosomal protein S21 [Lactobacillus johnsonii FI9785]
 gi|282557024|gb|EFB62623.1| ribosomal protein S21 [Lactobacillus gasseri 224-1]
 gi|300354466|gb|EFJ70337.1| 30S ribosomal protein S21 [Lactobacillus gasseri JV-V03]
 gi|311065752|gb|EFQ46092.1| ribosomal protein S21 [Lactobacillus gasseri MV-22]
 gi|329667240|gb|AEB93188.1| 30S ribosomal protein S21 [Lactobacillus johnsonii DPC 6026]
          Length = 58

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 29/57 (50%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           A  ++  + +++ ALR  K+ +   G L+E + R  YEKPS KR      A +R  
Sbjct: 1  MAKTIVHENESIDDALRRFKRSVSRSGTLQEYRKREFYEKPSVKRKLKSEAARKRRH 57


>gi|326803481|ref|YP_004321299.1| ribosomal protein S21 [Aerococcus urinae ACS-120-V-Col10a]
 gi|326651365|gb|AEA01548.1| ribosomal protein S21 [Aerococcus urinae ACS-120-V-Col10a]
          Length = 57

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 31/55 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  V+ ++ +++ ALR  K+ +   G LRE + R +YEKPS  R +    A +R
Sbjct: 1  MSKTVVRKNESIDDALRRFKRSVSKSGTLREARKREYYEKPSVCRKKKSEAARKR 55


>gi|256830228|ref|YP_003158956.1| 30S riboosomal protein S21 [Desulfomicrobium baculatum DSM 4028]
 gi|256579404|gb|ACU90540.1| ribosomal protein S21 [Desulfomicrobium baculatum DSM 4028]
          Length = 60

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 15/31 (48%), Positives = 22/31 (70%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPS 59
           + +LR  KK+++  G+L ELK R H+EKPS
Sbjct: 7  FDYSLRKFKKQVEKAGILSELKKRQHFEKPS 37


>gi|281422268|ref|ZP_06253267.1| ribosomal protein S21 [Prevotella copri DSM 18205]
 gi|281403773|gb|EFB34453.1| ribosomal protein S21 [Prevotella copri DSM 18205]
          Length = 63

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  Y+KPS  +      AI
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRARQQYDKPSVLKRLKMEHAI 53


>gi|15639745|ref|NP_219195.1| 30S ribosomal protein S21 [Treponema pallidum subsp. pallidum
          str. Nichols]
 gi|189025983|ref|YP_001933755.1| 30S ribosomal protein S21 [Treponema pallidum subsp. pallidum
          SS14]
 gi|6094169|sp|O83739|RS21_TREPA RecName: Full=30S ribosomal protein S21
 gi|226695063|sp|B2S3Z7|RS21_TREPS RecName: Full=30S ribosomal protein S21
 gi|3323064|gb|AAC65725.1| ribosomal protein S21 (rpsU) [Treponema pallidum subsp. pallidum
          str. Nichols]
 gi|189018558|gb|ACD71176.1| ribosomal protein S21 [Treponema pallidum subsp. pallidum SS14]
 gi|291060120|gb|ADD72855.1| ribosomal protein S21 [Treponema pallidum subsp. pallidum str.
          Chicago]
          Length = 69

 Score = 39.1 bits (90), Expect = 0.22,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 34/58 (58%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           N+E+A++  K++++ EG++RE K +  YEKPS    R K    R+  K  RK++   
Sbjct: 10 ENLEKAIKRFKRQVEKEGIIREWKKKEFYEKPSTLLNRKKKALRRKLMKKGRKVSDSR 67


>gi|251796235|ref|YP_003010966.1| 30S ribosomal protein S21 [Paenibacillus sp. JDR-2]
 gi|253576073|ref|ZP_04853405.1| 30S ribosomal protein S21 [Paenibacillus sp. oral taxon 786 str.
          D14]
 gi|261405604|ref|YP_003241845.1| 30S ribosomal protein S21 [Paenibacillus sp. Y412MC10]
 gi|304403949|ref|ZP_07385611.1| ribosomal protein S21 [Paenibacillus curdlanolyticus YK9]
 gi|308069941|ref|YP_003871546.1| ribosomal protein S21 [Paenibacillus polymyxa E681]
 gi|310643052|ref|YP_003947810.1| hypothetical protein PPSC2_c3614 [Paenibacillus polymyxa SC2]
 gi|315645972|ref|ZP_07899093.1| 30S ribosomal protein S21 [Paenibacillus vortex V453]
 gi|329924068|ref|ZP_08279331.1| ribosomal protein S21 [Paenibacillus sp. HGF5]
 gi|247543861|gb|ACT00880.1| ribosomal protein S21 [Paenibacillus sp. JDR-2]
 gi|251844416|gb|EES72432.1| 30S ribosomal protein S21 [Paenibacillus sp. oral taxon 786 str.
          D14]
 gi|261282067|gb|ACX64038.1| ribosomal protein S21 [Paenibacillus sp. Y412MC10]
 gi|304346927|gb|EFM12759.1| ribosomal protein S21 [Paenibacillus curdlanolyticus YK9]
 gi|305859220|gb|ADM71008.1| ribosomal protein S21 [Paenibacillus polymyxa E681]
 gi|309248002|gb|ADO57569.1| hypothetical protein PPSC2_c3614 [Paenibacillus polymyxa SC2]
 gi|315278733|gb|EFU42047.1| 30S ribosomal protein S21 [Paenibacillus vortex V453]
 gi|328940907|gb|EGG37215.1| ribosomal protein S21 [Paenibacillus sp. HGF5]
          Length = 57

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 20/48 (41%), Positives = 30/48 (62%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++  ++ ALR  K+ +  +GVL E+K R HYEKPS KR +    A +R
Sbjct: 8  KNETIDAALRRFKRSIAKDGVLAEVKKRKHYEKPSVKRKKKSEAARKR 55


>gi|107028342|ref|YP_625437.1| ribosomal protein S21 [Burkholderia cenocepacia AU 1054]
 gi|116686338|ref|YP_839585.1| ribosomal protein S21 [Burkholderia cenocepacia HI2424]
 gi|119367214|sp|Q1BIU1|RS212_BURCA RecName: Full=30S ribosomal protein S21 2
 gi|105897506|gb|ABF80464.1| SSU ribosomal protein S21P [Burkholderia cenocepacia AU 1054]
 gi|116652053|gb|ABK12692.1| SSU ribosomal protein S21P [Burkholderia cenocepacia HI2424]
          Length = 70

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 35/60 (58%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREG 85
          +  ++ ALR  ++ ++  G++REL+ R  YEKP+ +R R K+ A+ R R   +++     
Sbjct: 9  NEPIDVALRRFRRDIEKTGLIRELRARTGYEKPTTERKRKKASAVARQRLQAKRLLPPRK 68


>gi|167037784|ref|YP_001665362.1| 30S ribosomal protein S21 [Thermoanaerobacter pseudethanolicus
          ATCC 33223]
 gi|167039976|ref|YP_001662961.1| 30S ribosomal protein S21 [Thermoanaerobacter sp. X514]
 gi|256751978|ref|ZP_05492848.1| ribosomal protein S21 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300914066|ref|ZP_07131382.1| ribosomal protein S21 [Thermoanaerobacter sp. X561]
 gi|307724701|ref|YP_003904452.1| 30S ribosomal protein S21 [Thermoanaerobacter sp. X513]
 gi|320116199|ref|YP_004186358.1| 30S ribosomal protein S21 [Thermoanaerobacter brockii subsp.
          finnii Ako-1]
 gi|226695060|sp|B0KA63|RS21_THEP3 RecName: Full=30S ribosomal protein S21
 gi|226695061|sp|B0K6Z9|RS21_THEPX RecName: Full=30S ribosomal protein S21
 gi|166854216|gb|ABY92625.1| ribosomal protein S21 [Thermoanaerobacter sp. X514]
 gi|166856618|gb|ABY95026.1| ribosomal protein S21 [Thermoanaerobacter pseudethanolicus ATCC
          33223]
 gi|256749183|gb|EEU62217.1| ribosomal protein S21 [Thermoanaerobacter ethanolicus CCSD1]
 gi|300889001|gb|EFK84147.1| ribosomal protein S21 [Thermoanaerobacter sp. X561]
 gi|307581762|gb|ADN55161.1| ribosomal protein S21 [Thermoanaerobacter sp. X513]
 gi|319929290|gb|ADV79975.1| ribosomal protein S21 [Thermoanaerobacter brockii subsp. finnii
          Ako-1]
          Length = 61

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 30/54 (55%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + +++ ALR  +++    GVL E++ R HYE PS KR +    A +R  K  +
Sbjct: 8  ENESLDNALRRFRRQCSKAGVLSEVRKREHYESPSVKRKKKSEAARKRKYKYNK 61


>gi|119508861|ref|ZP_01628013.1| Ribosomal protein S21 [Nodularia spumigena CCY9414]
 gi|119466390|gb|EAW47275.1| Ribosomal protein S21 [Nodularia spumigena CCY9414]
          Length = 69

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 29/53 (54%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          VL  +  ++ ALR  K+++   G+L ++K   H+E P +KR R    A R  R
Sbjct: 16 VLGENEGIDSALRRFKRQVSKAGILADVKFHRHFETPLEKRKRKLVLARRNRR 68


>gi|75910552|ref|YP_324848.1| 30S ribosomal protein S21 [Anabaena variabilis ATCC 29413]
 gi|119367200|sp|Q3M4Y3|RS211_ANAVT RecName: Full=30S ribosomal protein S21 1
 gi|75704277|gb|ABA23953.1| SSU ribosomal protein S21P [Anabaena variabilis ATCC 29413]
          Length = 58

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 29/47 (61%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
           + +++ A+R  KKK+Q  G+L E+K R  YEKPS +R R    A +
Sbjct: 8  ENESIDSAIRRFKKKIQKAGILSEVKRRERYEKPSLRRKRKAEAARK 54


>gi|17229447|ref|NP_485995.1| 30S ribosomal protein S21 [Nostoc sp. PCC 7120]
 gi|20978594|sp|Q8YVM0|RS21C_ANASP RecName: Full=30S ribosomal protein S21 C
 gi|17131045|dbj|BAB73654.1| 30S ribosomal protein S21 [Nostoc sp. PCC 7120]
          Length = 58

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 19/47 (40%), Positives = 29/47 (61%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
           + +++ A+R  KKK+Q  G+L E+K R  YEKPS +R R    A +
Sbjct: 8  ENESIDSAIRRFKKKIQKAGILSEVKRRERYEKPSLRRKRKAEAARK 54


>gi|15613917|ref|NP_242220.1| 30S ribosomal protein S21 [Bacillus halodurans C-125]
 gi|13959519|sp|Q9KD65|RS21_BACHD RecName: Full=30S ribosomal protein S21
 gi|10173970|dbj|BAB05073.1| 30S ribosomal protein S21 [Bacillus halodurans C-125]
          Length = 57

 Score = 39.1 bits (90), Expect = 0.23,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++ +++ ALR  K+ +  EG L E++ R HYEKPS +R +    A +R
Sbjct: 8  KNESIDAALRRFKRSLSKEGTLAEVRKRKHYEKPSVRRKKKSEAARKR 55


>gi|220908166|ref|YP_002483477.1| 30S ribosomal protein S21 [Cyanothece sp. PCC 7425]
 gi|219864777|gb|ACL45116.1| ribosomal protein S21 [Cyanothece sp. PCC 7425]
          Length = 57

 Score = 39.1 bits (90), Expect = 0.24,   Method: Composition-based stats.
 Identities = 20/47 (42%), Positives = 29/47 (61%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          + ++E ALR  KKK+   G+L E+K R  YEKPS +R R    + +R
Sbjct: 9  NESIESALRRFKKKILKAGILSEVKRRERYEKPSLRRKRKAEASRKR 55


>gi|295695429|ref|YP_003588667.1| ribosomal protein S21 [Bacillus tusciae DSM 2912]
 gi|295411031|gb|ADG05523.1| ribosomal protein S21 [Bacillus tusciae DSM 2912]
          Length = 59

 Score = 38.7 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 31/51 (60%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          ++ +++ ALR  K+    +G+L E+K R HYEKPS  R +    A ++ RK
Sbjct: 8  KNESLDSALRRFKRATAKDGILAEVKKRKHYEKPSVARKKKSEAARKKRRK 58


>gi|224510722|pdb|3FIH|U Chain U, Ternary Complex-Bound E.Coli 70s Ribosome. This Entry
          Consists Of The 30s Subunit, Trnas And The Ternary
          Complex.
 gi|294662237|pdb|2WWL|U Chain U, E.Coli 70s Ribosome Stalled During Translation Of Tnac
          Leader Peptide. This File Contains The 30s, The P-Site
          Trna And The Tnac Leader Peptide (Part 1 Of 2).
 gi|308387985|pdb|3OFO|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 30s Subunit Of The
          First 70s Ribosome.
 gi|308388006|pdb|3OFP|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
          Erythromycin. This File Contains The 30s Subunit Of The
          Second 70s Ribosome.
 gi|309320043|pdb|3OFA|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 30s Subunit Of
          The First 70s Ribosome.
 gi|309320064|pdb|3OFB|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
          Chloramphenicol. This File Contains The 30s Subunit Of
          The Second 70s Ribosome.
 gi|309320147|pdb|3OFX|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 30s Subunit Of The
          First 70s Ribosome.
 gi|309320168|pdb|3OFY|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
          Clindamycin. This File Contains The 30s Subunit Of The
          Second 70s Ribosome
 gi|315113632|pdb|3OAQ|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 30s Subunit Of
          The First 70s Ribosome.
 gi|315113653|pdb|3OAR|U Chain U, Crystal Structure Of The E. Coli Ribosome Bound To
          Telithromycin. This File Contains The 30s Subunit Of
          The Second 70s Ribosome
          Length = 51

 Score = 38.7 bits (89), Expect = 0.24,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 32/51 (62%), Gaps = 1/51 (1%)

Query: 22 VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
          + VR+N   + ALR  K+  +  GVL E++ R  YEKP+ +R R K+ A++
Sbjct: 1  IKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVK 51


>gi|323702406|ref|ZP_08114071.1| ribosomal protein S21 [Desulfotomaculum nigrificans DSM 574]
 gi|323532712|gb|EGB22586.1| ribosomal protein S21 [Desulfotomaculum nigrificans DSM 574]
          Length = 59

 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 27/48 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++  ++ ALR  K+  Q  GVL E +   HYEKPS +R +    A +R
Sbjct: 8  KNETLDSALRRFKRNCQKAGVLAEARRHEHYEKPSVRRKKKSEAARKR 55


>gi|291542648|emb|CBL15758.1| SSU ribosomal protein S21P [Ruminococcus bromii L2-63]
          Length = 58

 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 29/51 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + ++E ALR  KK+    GV+ E++ R  YEKPS KR +    A +R  +
Sbjct: 8  ENESLESALRRFKKQCARAGVIAEVRKREAYEKPSVKRKKKSEAARKRKYR 58


>gi|227431705|ref|ZP_03913735.1| ribosomal protein S21 [Leuconostoc mesenteroides subsp. cremoris
          ATCC 19254]
 gi|227352529|gb|EEJ42725.1| ribosomal protein S21 [Leuconostoc mesenteroides subsp. cremoris
          ATCC 19254]
          Length = 61

 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 34/61 (55%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           A  ++ ++ +++ ALR  K+ +  +G L+E + R +Y KPS  R      A +R++K  
Sbjct: 1  MAKVIVRKNESLDDALRRFKRGVSKDGTLQEYRKREYYVKPSVARKMKSEAAQKRNKKKG 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|307152136|ref|YP_003887520.1| 30S ribosomal protein S21 [Cyanothece sp. PCC 7822]
 gi|306982364|gb|ADN14245.1| ribosomal protein S21 [Cyanothece sp. PCC 7822]
          Length = 62

 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 12/44 (27%), Positives = 25/44 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSE 68
          +  ++E ALR  KK++   G+ +++K    +E P +K  R ++ 
Sbjct: 8  QSESLESALRRFKKQVAKAGIYQDIKKHQFFETPQEKEKRKEAA 51


>gi|332982490|ref|YP_004463931.1| 30S ribosomal protein S21P [Mahella australiensis 50-1 BON]
 gi|332700168|gb|AEE97109.1| SSU ribosomal protein S21P [Mahella australiensis 50-1 BON]
          Length = 58

 Score = 38.7 bits (89), Expect = 0.25,   Method: Composition-based stats.
 Identities = 20/51 (39%), Positives = 31/51 (60%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          V+  + +++ ALR  KK+    GVL E++ R HY+KPS KR +    A +R
Sbjct: 6  VVGENESLDSALRRFKKECAKAGVLSEIRKREHYDKPSVKRKKKSEAARKR 56


>gi|307109193|gb|EFN57431.1| hypothetical protein CHLNCDRAFT_142894 [Chlorella variabilis]
          Length = 138

 Score = 38.7 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 14/75 (18%), Positives = 32/75 (42%), Gaps = 10/75 (13%)

Query: 13  EGREISAVYVLVRDNNV-EQALRVLKKKMQGEG---------VLRELKMRGHYEKPSQKR 62
           + R    V V+V D+   + AL+  ++++   G         V+ E++ R ++E     +
Sbjct: 32  KSRSTYQVQVVVGDDEPQDNALKRFRREVMSAGKHRTHRSFCVIPEVRRRRYFENSVDAK 91

Query: 63  VRLKSEAIRRSRKLM 77
            R   E+    ++  
Sbjct: 92  KRKHKESRMAMKRQQ 106


>gi|269926171|ref|YP_003322794.1| ribosomal protein S21 [Thermobaculum terrenum ATCC BAA-798]
 gi|269789831|gb|ACZ41972.1| ribosomal protein S21 [Thermobaculum terrenum ATCC BAA-798]
          Length = 66

 Score = 38.7 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V+V +N   E ALR   KK+Q  G+L E + R HYEKPS +R R ++   R+    +
Sbjct: 1  MAEVVVGENESFESALRRFNKKVQQAGILSEARRREHYEKPSVRRKRKEAARRRKIEAKL 60

Query: 78 RKIAQR 83
          ++   R
Sbjct: 61 KQQQSR 66


>gi|251771804|gb|EES52379.1| ribosomal protein S21 [Leptospirillum ferrodiazotrophum]
          Length = 65

 Score = 38.7 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 18/43 (41%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
             V V++N   E AL+  KK+ +  G+L ++K R HYEKPS 
Sbjct: 1  MTGVRVKENESFESALKRFKKQCEKAGILSDVKKREHYEKPSV 43


>gi|227499807|ref|ZP_03929902.1| ribosomal protein S21 [Anaerococcus tetradius ATCC 35098]
 gi|227218111|gb|EEI83379.1| ribosomal protein S21 [Anaerococcus tetradius ATCC 35098]
          Length = 60

 Score = 38.7 bits (89), Expect = 0.27,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + +++ A++  K++    GVL E + R HYEKPS  R +    A R++RK
Sbjct: 8  ENESIDSAIKRFKRQCARSGVLSEYRKREHYEKPSVIRKKKNDAAKRKNRK 58


>gi|56963434|ref|YP_175165.1| 30S ribosomal protein S21 [Bacillus clausii KSM-K16]
 gi|61215809|sp|Q5WHF1|RS21_BACSK RecName: Full=30S ribosomal protein S21
 gi|56909677|dbj|BAD64204.1| 30S ribosomal protein S21 [Bacillus clausii KSM-K16]
          Length = 57

 Score = 38.7 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++ +++ ALR  K+ +  EG L E++ R H+EKPS KR +    A +R
Sbjct: 8  KNESIDAALRRFKRSLSKEGTLAEVRKRKHFEKPSVKRKKKSEAARKR 55


>gi|198284077|ref|YP_002220398.1| 30S ribosomal protein S21 [Acidithiobacillus ferrooxidans ATCC
          53993]
 gi|218668051|ref|YP_002426732.1| ribosomal protein S21 [Acidithiobacillus ferrooxidans ATCC 23270]
 gi|226694963|sp|B7J6A7|RS21_ACIF2 RecName: Full=30S ribosomal protein S21
 gi|226694964|sp|B5ELK7|RS21_ACIF5 RecName: Full=30S ribosomal protein S21
 gi|198248598|gb|ACH84191.1| ribosomal protein S21 [Acidithiobacillus ferrooxidans ATCC 53993]
 gi|218520264|gb|ACK80850.1| ribosomal protein S21 [Acidithiobacillus ferrooxidans ATCC 23270]
          Length = 71

 Score = 38.7 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 25/66 (37%), Positives = 39/66 (59%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   E ALR  K+  +  GVL E++ R  YEKP+++R R  + A +R+ K M
Sbjct: 1  MPTVRVKENEPFEVALRRFKRSCEKAGVLTEVRRREFYEKPTEERKRKAAAARKRALKRM 60

Query: 78 RKIAQR 83
          R+ + R
Sbjct: 61 RRQSMR 66


>gi|116623461|ref|YP_825617.1| 30S ribosomal protein S21 [Candidatus Solibacter usitatus
          Ellin6076]
 gi|116226623|gb|ABJ85332.1| SSU ribosomal protein S21P [Candidatus Solibacter usitatus
          Ellin6076]
          Length = 77

 Score = 38.7 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 30/57 (52%), Gaps = 1/57 (1%)

Query: 14 GREISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
          G       V +++   +E ALR  K+K+Q E +++E+K    Y KP +K    ++ A
Sbjct: 8  GGVFRLAEVKLQEGETLENALRRFKRKVQQEDIIKEVKRHSFYLKPGEKLRAKQALA 64


>gi|242033311|ref|XP_002464050.1| hypothetical protein SORBIDRAFT_01g011340 [Sorghum bicolor]
 gi|241917904|gb|EER91048.1| hypothetical protein SORBIDRAFT_01g011340 [Sorghum bicolor]
          Length = 111

 Score = 38.7 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 24/73 (32%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 13  EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMR-GHYEKPSQKRVRLKSEAIR 71
           + ++   + V VRD N+E+AL V+++KM+  G+ R ++ R  H+ K S+KRV  +   ++
Sbjct: 30  QVQQARGIVVQVRDGNLERALSVMERKMRSSGMERLIRARTTHHVKDSEKRVLARKALMQ 89

Query: 72  RSRKLMRKIAQRE 84
           R R        RE
Sbjct: 90  RVRSQELGKKLRE 102


>gi|172056852|ref|YP_001813312.1| 30S ribosomal protein S21 [Exiguobacterium sibiricum 255-15]
 gi|171989373|gb|ACB60295.1| ribosomal protein S21 [Exiguobacterium sibiricum 255-15]
          Length = 57

 Score = 38.7 bits (89), Expect = 0.28,   Method: Composition-based stats.
 Identities = 19/50 (38%), Positives = 30/50 (60%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          ++ ++E ALR  K+ +  +G L E++ R HYEKPS KR      A +R +
Sbjct: 7  KNESLEDALRRFKRGVSKDGTLAEVRKRKHYEKPSVKRKLKSEAARKRKK 56


>gi|258516356|ref|YP_003192578.1| 30S ribosomal protein S21 [Desulfotomaculum acetoxidans DSM 771]
 gi|257780061|gb|ACV63955.1| ribosomal protein S21 [Desulfotomaculum acetoxidans DSM 771]
          Length = 65

 Score = 38.7 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 17/41 (41%), Positives = 24/41 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
          ++  ++ ALR  K+  Q  GVL E +   HYEKPS KR + 
Sbjct: 8  KNETLDSALRRFKRTCQKAGVLAEARKHEHYEKPSVKRKKK 48


>gi|256545325|ref|ZP_05472689.1| conserved domain protein [Anaerococcus vaginalis ATCC 51170]
 gi|256399006|gb|EEU12619.1| conserved domain protein [Anaerococcus vaginalis ATCC 51170]
          Length = 59

 Score = 38.7 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
           + +++ A++  K++    GVL E + R HYEKPS KR +    A R+ R+ 
Sbjct: 8  ENESIDSAIKRFKRQCARSGVLTEYRKREHYEKPSLKRKKKSEAAKRKKRRK 59


>gi|282882843|ref|ZP_06291448.1| ribosomal protein S21 [Peptoniphilus lacrimalis 315-B]
 gi|300814180|ref|ZP_07094463.1| ribosomal protein S21 [Peptoniphilus sp. oral taxon 836 str.
          F0141]
 gi|281297254|gb|EFA89745.1| ribosomal protein S21 [Peptoniphilus lacrimalis 315-B]
 gi|300511837|gb|EFK39054.1| ribosomal protein S21 [Peptoniphilus sp. oral taxon 836 str.
          F0141]
          Length = 59

 Score = 38.7 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 32/51 (62%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + +++ AL+  K++    GVL+E++ R HYEKPS +R +   EA R+  +
Sbjct: 8  ENESLDNALKRFKRQCANSGVLKEVRKREHYEKPSVRRKKKSEEARRKKHR 58


>gi|284048081|ref|YP_003398420.1| ribosomal protein S21 [Acidaminococcus fermentans DSM 20731]
 gi|283952302|gb|ADB47105.1| ribosomal protein S21 [Acidaminococcus fermentans DSM 20731]
          Length = 58

 Score = 38.7 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          +  +++ ALR  K+  Q  GVL E++ R HYEKPS +R +    A +R  +
Sbjct: 8  KTESLDSALRRFKRATQKAGVLSEVRKREHYEKPSVRRKKKSEAARKRKSR 58


>gi|152976739|ref|YP_001376256.1| 30S ribosomal protein S21 [Bacillus cereus subsp. cytotoxis NVH
          391-98]
 gi|189044890|sp|A7GT03|RS21_BACCN RecName: Full=30S ribosomal protein S21
 gi|152025491|gb|ABS23261.1| ribosomal protein S21 [Bacillus cytotoxicus NVH 391-98]
          Length = 57

 Score = 38.7 bits (89), Expect = 0.29,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 30/55 (54%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           +  ++ ++ ++E ALR  K+ +   G L E + R  YEKPS KR +    A +R
Sbjct: 1  MSKTIVRKNESLEDALRRFKRSVSKTGTLAEARKREFYEKPSVKRKKKSEAARKR 55


>gi|254447644|ref|ZP_05061110.1| ribosomal protein S21 [gamma proteobacterium HTCC5015]
 gi|198262987|gb|EDY87266.1| ribosomal protein S21 [gamma proteobacterium HTCC5015]
          Length = 79

 Score = 38.7 bits (89), Expect = 0.30,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 35/67 (52%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V+++   E ALR  K+  +  GV+ E + R  YEKP+ KR R K+ A +R  K +
Sbjct: 9  MPDVRVKEHEPFEAALRRFKRSCEKAGVVTEARRREFYEKPTAKRKRTKAAAAKRHAKRL 68

Query: 78 RKIAQRE 84
           K   R 
Sbjct: 69 YKEQARR 75


>gi|58337487|ref|YP_194072.1| 30S ribosomal protein S21 [Lactobacillus acidophilus NCFM]
 gi|104774148|ref|YP_619128.1| 30S ribosomal protein S21 [Lactobacillus delbrueckii subsp.
          bulgaricus ATCC 11842]
 gi|116514238|ref|YP_813144.1| 30S ribosomal protein S21 [Lactobacillus delbrueckii subsp.
          bulgaricus ATCC BAA-365]
 gi|161507655|ref|YP_001577609.1| 30S ribosomal protein S21 [Lactobacillus helveticus DPC 4571]
 gi|227878698|ref|ZP_03996612.1| 30S ribosomal protein S21 [Lactobacillus crispatus JV-V01]
 gi|227892555|ref|ZP_04010360.1| 30S ribosomal protein S21 [Lactobacillus ultunensis DSM 16047]
 gi|227904123|ref|ZP_04021928.1| 30S ribosomal protein S21 [Lactobacillus acidophilus ATCC 4796]
 gi|238854663|ref|ZP_04644993.1| ribosomal protein S21 [Lactobacillus jensenii 269-3]
 gi|256843292|ref|ZP_05548780.1| 30S ribosomal protein S21 [Lactobacillus crispatus 125-2-CHN]
 gi|256850351|ref|ZP_05555779.1| 30S ribosomal protein S21 [Lactobacillus crispatus MV-1A-US]
 gi|256851192|ref|ZP_05556581.1| ribosomal protein S21 [Lactobacillus jensenii 27-2-CHN]
 gi|259500582|ref|ZP_05743484.1| 30S ribosomal protein S21 [Lactobacillus iners DSM 13335]
 gi|260660616|ref|ZP_05861531.1| ribosomal protein S21 [Lactobacillus jensenii 115-3-CHN]
 gi|260664394|ref|ZP_05865246.1| ribosomal protein S21 [Lactobacillus jensenii SJ-7A-US]
 gi|262046501|ref|ZP_06019463.1| 30S ribosomal protein S21 [Lactobacillus crispatus MV-3A-US]
 gi|282932946|ref|ZP_06338343.1| ribosomal protein S21 [Lactobacillus jensenii 208-1]
 gi|282934658|ref|ZP_06339901.1| ribosomal protein S21 [Lactobacillus jensenii 208-1]
 gi|293380653|ref|ZP_06626704.1| 30S ribosomal protein S21 [Lactobacillus crispatus 214-1]
 gi|295424891|ref|ZP_06817606.1| 30S ribosomal protein S21 [Lactobacillus amylolyticus DSM 11664]
 gi|295693067|ref|YP_003601677.1| 30S ribosomal protein s21 [Lactobacillus crispatus ST1]
 gi|297206057|ref|ZP_06923452.1| 30S ribosomal protein S21 [Lactobacillus jensenii JV-V16]
 gi|300812197|ref|ZP_07092639.1| ribosomal protein S21 [Lactobacillus delbrueckii subsp.
          bulgaricus PB2003/044-T3-4]
 gi|302191273|ref|ZP_07267527.1| 30S ribosomal protein S21 [Lactobacillus iners AB-1]
 gi|309803152|ref|ZP_07697249.1| ribosomal protein S21 [Lactobacillus iners LactinV 11V1-d]
 gi|309805286|ref|ZP_07699338.1| ribosomal protein S21 [Lactobacillus iners LactinV 09V1-c]
 gi|309806583|ref|ZP_07700580.1| ribosomal protein S21 [Lactobacillus iners LactinV 03V1-b]
 gi|309807574|ref|ZP_07701526.1| ribosomal protein S21 [Lactobacillus iners LactinV 01V1-a]
 gi|309810153|ref|ZP_07703998.1| ribosomal protein S21 [Lactobacillus iners SPIN 2503V10-D]
 gi|312871777|ref|ZP_07731865.1| ribosomal protein S21 [Lactobacillus iners LEAF 3008A-a]
 gi|312872907|ref|ZP_07732967.1| ribosomal protein S21 [Lactobacillus iners LEAF 2062A-h1]
 gi|312874163|ref|ZP_07734197.1| ribosomal protein S21 [Lactobacillus iners LEAF 2052A-d]
 gi|312875669|ref|ZP_07735670.1| ribosomal protein S21 [Lactobacillus iners LEAF 2053A-b]
 gi|312978183|ref|ZP_07789927.1| ribosomal protein S21 [Lactobacillus crispatus CTV-05]
 gi|313472202|ref|ZP_07812694.1| ribosomal protein S21 [Lactobacillus jensenii 1153]
 gi|315038518|ref|YP_004032086.1| 30S ribosomal protein S21 [Lactobacillus amylovorus GRL 1112]
 gi|315653582|ref|ZP_07906502.1| 30S ribosomal protein S21 [Lactobacillus iners ATCC 55195]
 gi|325912083|ref|ZP_08174481.1| ribosomal protein S21 [Lactobacillus iners UPII 143-D]
 gi|325912579|ref|ZP_08174962.1| ribosomal protein S21 [Lactobacillus iners UPII 60-B]
 gi|325956938|ref|YP_004292350.1| 30S ribosomal protein S21 [Lactobacillus acidophilus 30SC]
 gi|329920089|ref|ZP_08276920.1| ribosomal protein S21 [Lactobacillus iners SPIN 1401G]
 gi|75507587|sp|Q5FJT3|RS21_LACAC RecName: Full=30S ribosomal protein S21
 gi|119367266|sp|Q1G9W2|RS21_LACDA RecName: Full=30S ribosomal protein S21
 gi|122275030|sp|Q04A16|RS21_LACDB RecName: Full=30S ribosomal protein S21
 gi|172048293|sp|A8YVN1|RS21_LACH4 RecName: Full=30S ribosomal protein S21
 gi|58254804|gb|AAV43041.1| 30S ribosomal protein S21 [Lactobacillus acidophilus NCFM]
 gi|103423229|emb|CAI98057.1| 30S ribosomal protein S21 [Lactobacillus delbrueckii subsp.
          bulgaricus ATCC 11842]
 gi|116093553|gb|ABJ58706.1| SSU ribosomal protein S21P [Lactobacillus delbrueckii subsp.
          bulgaricus ATCC BAA-365]
 gi|160348644|gb|ABX27318.1| 30S ribosomal protein S21 [Lactobacillus helveticus DPC 4571]
 gi|227861713|gb|EEJ69318.1| 30S ribosomal protein S21 [Lactobacillus crispatus JV-V01]
 gi|227865676|gb|EEJ73097.1| 30S ribosomal protein S21 [Lactobacillus ultunensis DSM 16047]
 gi|227868142|gb|EEJ75563.1| 30S ribosomal protein S21 [Lactobacillus acidophilus ATCC 4796]
 gi|238832453|gb|EEQ24760.1| ribosomal protein S21 [Lactobacillus jensenii 269-3]
 gi|239529582|gb|EEQ68583.1| ribosomal protein S21 [Lactobacillus jensenii 1153]
 gi|256614712|gb|EEU19913.1| 30S ribosomal protein S21 [Lactobacillus crispatus 125-2-CHN]
 gi|256616254|gb|EEU21442.1| ribosomal protein S21 [Lactobacillus jensenii 27-2-CHN]
 gi|256712748|gb|EEU27741.1| 30S ribosomal protein S21 [Lactobacillus crispatus MV-1A-US]
 gi|259167966|gb|EEW52461.1| 30S ribosomal protein S21 [Lactobacillus iners DSM 13335]
 gi|260548338|gb|EEX24313.1| ribosomal protein S21 [Lactobacillus jensenii 115-3-CHN]
 gi|260561459|gb|EEX27431.1| ribosomal protein S21 [Lactobacillus jensenii SJ-7A-US]
 gi|260573372|gb|EEX29930.1| 30S ribosomal protein S21 [Lactobacillus crispatus MV-3A-US]
 gi|281301233|gb|EFA93534.1| ribosomal protein S21 [Lactobacillus jensenii 208-1]
 gi|281302981|gb|EFA95186.1| ribosomal protein S21 [Lactobacillus jensenii 208-1]
 gi|290922781|gb|EFD99732.1| 30S ribosomal protein S21 [Lactobacillus crispatus 214-1]
 gi|295031173|emb|CBL50652.1| 30S ribosomal protein S21 [Lactobacillus crispatus ST1]
 gi|295065457|gb|EFG56350.1| 30S ribosomal protein S21 [Lactobacillus amylolyticus DSM 11664]
 gi|297149183|gb|EFH29481.1| 30S ribosomal protein S21 [Lactobacillus jensenii JV-V16]
 gi|300496833|gb|EFK31913.1| ribosomal protein S21 [Lactobacillus delbrueckii subsp.
          bulgaricus PB2003/044-T3-4]
 gi|308164660|gb|EFO66910.1| ribosomal protein S21 [Lactobacillus iners LactinV 11V1-d]
 gi|308165520|gb|EFO67751.1| ribosomal protein S21 [Lactobacillus iners LactinV 09V1-c]
 gi|308167003|gb|EFO69185.1| ribosomal protein S21 [Lactobacillus iners LactinV 03V1-b]
 gi|308169180|gb|EFO71246.1| ribosomal protein S21 [Lactobacillus iners LactinV 01V1-a]
 gi|308169425|gb|EFO71473.1| ribosomal protein S21 [Lactobacillus iners SPIN 2503V10-D]
 gi|310894901|gb|EFQ43971.1| ribosomal protein S21 [Lactobacillus crispatus CTV-05]
 gi|311088923|gb|EFQ47366.1| ribosomal protein S21 [Lactobacillus iners LEAF 2053A-b]
 gi|311090233|gb|EFQ48643.1| ribosomal protein S21 [Lactobacillus iners LEAF 2052A-d]
 gi|311091429|gb|EFQ49813.1| ribosomal protein S21 [Lactobacillus iners LEAF 2062A-h1]
 gi|311092719|gb|EFQ51075.1| ribosomal protein S21 [Lactobacillus iners LEAF 3008A-a]
 gi|312276651|gb|ADQ59291.1| 30S ribosomal protein S21 [Lactobacillus amylovorus GRL 1112]
 gi|315488944|gb|EFU78586.1| 30S ribosomal protein S21 [Lactobacillus iners ATCC 55195]
 gi|323466379|gb|ADX70066.1| Ribosomal protein S21 [Lactobacillus helveticus H10]
 gi|325125928|gb|ADY85258.1| 30S ribosomal protein S21 [Lactobacillus delbrueckii subsp.
          bulgaricus 2038]
 gi|325333503|gb|ADZ07411.1| 30S ribosomal protein S21 [Lactobacillus acidophilus 30SC]
 gi|325476033|gb|EGC79201.1| ribosomal protein S21 [Lactobacillus iners UPII 143-D]
 gi|325478000|gb|EGC81129.1| ribosomal protein S21 [Lactobacillus iners UPII 60-B]
 gi|325686035|gb|EGD28093.1| 30S ribosomal protein S21 [Lactobacillus delbrueckii subsp.
          lactis DSM 20072]
 gi|327183714|gb|AEA32161.1| 30S ribosomal protein S21 [Lactobacillus amylovorus GRL 1118]
 gi|328465886|gb|EGF37069.1| 30S ribosomal protein S21 [Lactobacillus helveticus MTCC 5463]
 gi|328936543|gb|EGG32987.1| ribosomal protein S21 [Lactobacillus iners SPIN 1401G]
          Length = 58

 Score = 38.7 bits (89), Expect = 0.30,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 29/57 (50%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           A  ++  + +++ ALR  K+ +   G L+E + R  YEKPS +R      A +R  
Sbjct: 1  MAKTIVHENESIDDALRRFKRSVSRSGTLQEYRKREFYEKPSVRRKLKSEAARKRRH 57


>gi|328954518|ref|YP_004371852.1| 30S ribosomal protein S21 [Desulfobacca acetoxidans DSM 11109]
 gi|328454842|gb|AEB10671.1| 30S ribosomal protein S21 [Desulfobacca acetoxidans DSM 11109]
          Length = 66

 Score = 38.7 bits (89), Expect = 0.30,   Method: Composition-based stats.
 Identities = 26/63 (41%), Positives = 38/63 (60%), Gaps = 1/63 (1%)

Query: 22 VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
          V V+ N   E AL+  KK+ +  G+L E++ R HYEKPS KR +    A +R+ K +RK+
Sbjct: 4  VRVKANEPFEIALKRFKKQCEKAGILSEIRKREHYEKPSIKRKKKALAAKKRALKRIRKL 63

Query: 81 AQR 83
            R
Sbjct: 64 GAR 66


>gi|282857134|ref|ZP_06266380.1| ribosomal protein S21 [Pyramidobacter piscolens W5455]
 gi|282585069|gb|EFB90391.1| ribosomal protein S21 [Pyramidobacter piscolens W5455]
          Length = 59

 Score = 38.7 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 21/55 (38%), Positives = 30/55 (54%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
              V   + ++E  LR  K+ +   GVLRE + + HYEKPS+ R R + E  RR
Sbjct: 1  MTTVVRKDNESIEDVLRRFKRDVSKAGVLREARKKEHYEKPSEARKRKRQELSRR 55


>gi|256823388|ref|YP_003147351.1| 30S ribosomal protein S21 [Kangiella koreensis DSM 16069]
 gi|256796927|gb|ACV27583.1| ribosomal protein S21 [Kangiella koreensis DSM 16069]
          Length = 71

 Score = 38.7 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V+DN   + ALR  K+  +  G+L E++ R +YEKP+  R R K+ A++R+ K +
Sbjct: 1  MPSVRVKDNEPFDVALRRFKRSCEKAGILAEVRKREYYEKPTSVRKREKAAAVKRAAKKV 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|115454741|ref|NP_001050971.1| Os03g0694700 [Oryza sativa Japonica Group]
 gi|108710535|gb|ABF98330.1| expressed protein [Oryza sativa Japonica Group]
 gi|113549442|dbj|BAF12885.1| Os03g0694700 [Oryza sativa Japonica Group]
 gi|215766393|dbj|BAG98621.1| unnamed protein product [Oryza sativa Japonica Group]
          Length = 105

 Score = 38.7 bits (89), Expect = 0.31,   Method: Composition-based stats.
 Identities = 22/73 (30%), Positives = 40/73 (54%), Gaps = 3/73 (4%)

Query: 15 REISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRG---HYEKPSQKRVRLKSEAIR 71
          ++   + V V+D N+E+AL V+ +KM+  G+ R ++ R    H+ K S+KRV  +   ++
Sbjct: 24 QQARGIVVHVKDGNLERALGVMARKMRSSGIERLIRARSQIHHHVKDSEKRVLARKALMQ 83

Query: 72 RSRKLMRKIAQRE 84
          R R        R+
Sbjct: 84 RVRSQELGKKLRD 96


>gi|197295095|ref|YP_002153636.1| 30S ribosomal protein S21 [Burkholderia cenocepacia J2315]
 gi|195944574|emb|CAR57178.1| 30S ribosomal protein S21 3 [Burkholderia cenocepacia J2315]
          Length = 70

 Score = 38.3 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 35/60 (58%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREG 85
          +  ++ ALR  ++ ++  G++REL+ R  YEKP+ +R R K+ A+ R R   +++     
Sbjct: 9  NEPIDVALRRFRRDIEKTGLIRELRSRTSYEKPTTERKRKKASAVARQRLQTKRLLPPRK 68


>gi|170078348|ref|YP_001734986.1| ribosomal protein S21 [Synechococcus sp. PCC 7002]
 gi|226695059|sp|B1XPL6|RS21_SYNP2 RecName: Full=30S ribosomal protein S21
 gi|169886017|gb|ACA99730.1| ribosomal protein S21 [Synechococcus sp. PCC 7002]
          Length = 58

 Score = 38.3 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 30/52 (57%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
          V+ ++ N+E ALR  K+++   G+  ++K R H+E P +KR R      ++ 
Sbjct: 5  VVGQNENIESALRRFKRQVSKAGIFADIKRRRHFETPIEKRKRKAVARRKKR 56


>gi|72382898|ref|YP_292253.1| 30S ribosomal protein S21 [Prochlorococcus marinus str. NATL2A]
 gi|124026640|ref|YP_001015755.1| 30S ribosomal protein S21 [Prochlorococcus marinus str. NATL1A]
 gi|119367289|sp|Q46IX8|RS21_PROMT RecName: Full=30S ribosomal protein S21
 gi|166224051|sp|A2C4T1|RS21_PROM1 RecName: Full=30S ribosomal protein S21
 gi|72002748|gb|AAZ58550.1| SSU ribosomal protein S21P [Prochlorococcus marinus str. NATL2A]
 gi|123961708|gb|ABM76491.1| Hypothetical protein NATL1_19351 [Prochlorococcus marinus str.
          NATL1A]
          Length = 58

 Score = 38.3 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
             V V +N  +E ALR  K+++   G+  ELK   H+E P +K  R 
Sbjct: 1  MTQVTVGENEGIESALRRFKRQVSKAGIFGELKRLRHHETPVEKYKRK 48


>gi|159903721|ref|YP_001551065.1| 30S ribosomal protein S21 [Prochlorococcus marinus str. MIT 9211]
 gi|159888897|gb|ABX09111.1| Hypothetical protein P9211_11801 [Prochlorococcus marinus str.
          MIT 9211]
          Length = 58

 Score = 38.3 bits (88), Expect = 0.31,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 25/48 (52%), Gaps = 1/48 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
             V V +N  +E ALR  K+++   G+  ELK   H+E P +K  R 
Sbjct: 1  MTQVTVGENEGIESALRRFKRQVSKAGIFGELKRLRHHETPVEKYKRK 48


>gi|256058871|ref|ZP_05449087.1| 30S ribosomal protein S21 [Brucella neotomae 5K33]
          Length = 55

 Score = 38.3 bits (88), Expect = 0.33,   Method: Composition-based stats.
 Identities = 36/51 (70%), Positives = 42/51 (82%)

Query: 40 MQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSR 90
          MQ EG+ RE+KMRGHYEKPS+KR R K+EA+RR+RKL RK AQREG   SR
Sbjct: 1  MQREGIFREMKMRGHYEKPSEKRAREKAEAVRRARKLARKRAQREGLIGSR 51


>gi|188585817|ref|YP_001917362.1| SSU ribosomal protein S21P [Natranaerobius thermophilus
          JW/NM-WN-LF]
 gi|226695028|sp|B2A1N7|RS21_NATTJ RecName: Full=30S ribosomal protein S21
 gi|179350504|gb|ACB84774.1| SSU ribosomal protein S21P [Natranaerobius thermophilus
          JW/NM-WN-LF]
          Length = 57

 Score = 38.3 bits (88), Expect = 0.34,   Method: Composition-based stats.
 Identities = 21/50 (42%), Positives = 29/50 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          ++  ++ ALR  KK+    GVL E K R HYEKPS+KR R  +E     +
Sbjct: 8  KNETLDSALRRFKKQCSKSGVLSEAKKRKHYEKPSEKRKRKATEKRNSRK 57


>gi|212527032|ref|XP_002143673.1| stress response protein Nst1, putative [Penicillium marneffei ATCC
           18224]
 gi|210073071|gb|EEA27158.1| stress response protein Nst1, putative [Penicillium marneffei ATCC
           18224]
          Length = 1258

 Score = 38.3 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 10/61 (16%), Positives = 27/61 (44%), Gaps = 3/61 (4%)

Query: 35  VLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQH 94
            L+K+ + +  L+E + R       +++ R + E  R+ R+  ++    E     +  + 
Sbjct: 644 RLRKEAEKQKRLQEERERQAEI---ERKQREQKERERKKREDAKRKEVEEREAKEKRLRD 700

Query: 95  R 95
           +
Sbjct: 701 K 701


>gi|227529157|ref|ZP_03959206.1| ribosomal protein S21 [Lactobacillus vaginalis ATCC 49540]
 gi|227351001|gb|EEJ41292.1| ribosomal protein S21 [Lactobacillus vaginalis ATCC 49540]
          Length = 62

 Score = 38.3 bits (88), Expect = 0.35,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR      A
Sbjct: 1  MSKTVVRKNESLDDALRRFKRTVSRNGTLQEYRKREFYEKPSVKRKLKSEAA 52


>gi|301059704|ref|ZP_07200604.1| ribosomal protein S21 [delta proteobacterium NaphS2]
 gi|300446181|gb|EFK10046.1| ribosomal protein S21 [delta proteobacterium NaphS2]
          Length = 61

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 43/60 (71%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V+VRDN +E+A++ LK+K+  EG   E+K R  Y+KPS ++ + +++A +R RK +R+
Sbjct: 1  MKVIVRDNQIEKAIKDLKRKLTKEGFFSEIKERRFYDKPSVQKKKKQAKAAKRRRKKIRR 60


>gi|260655523|ref|ZP_05861011.1| ribosomal protein S21 [Jonquetella anthropi E3_33 E1]
 gi|260629971|gb|EEX48165.1| ribosomal protein S21 [Jonquetella anthropi E3_33 E1]
          Length = 59

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 20/58 (34%), Positives = 31/58 (53%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
              V   + ++E  LR  K+ +   GVLRE + + HYEKPS+ + R + E  RR  +
Sbjct: 1  MTTVVRKENESIEDVLRRFKRDVSKTGVLREARKKEHYEKPSEAKKRKRQELSRRRAR 58


>gi|42521864|ref|NP_967244.1| 30S ribosomal protein S21 [Bdellovibrio bacteriovorus HD100]
 gi|61215949|sp|Q6MR60|RS21_BDEBA RecName: Full=30S ribosomal protein S21
 gi|39574394|emb|CAE77898.1| Ribosomal protein S21 [Bdellovibrio bacteriovorus HD100]
          Length = 66

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 32/62 (51%), Gaps = 1/62 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V ++D    E A R  KK  +  G+L E+K R ++EKPS +  +    A +R+ K  
Sbjct: 1  MAMVKIKDGESFESAFRKFKKSCEKAGILSEVKKRENFEKPSVRLKKKSIAARKRAVKKS 60

Query: 78 RK 79
          RK
Sbjct: 61 RK 62


>gi|206890398|ref|YP_002248855.1| ribosomal protein S21 [Thermodesulfovibrio yellowstonii DSM
          11347]
 gi|226695062|sp|B5YKU0|RS21_THEYD RecName: Full=30S ribosomal protein S21
 gi|206742336|gb|ACI21393.1| ribosomal protein S21 [Thermodesulfovibrio yellowstonii DSM
          11347]
          Length = 65

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 23/48 (47%), Positives = 32/48 (66%), Gaps = 1/48 (2%)

Query: 19 AVYVLVRD-NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
             V VRD ++ E AL++ KK+ + EG+L E+K R HYEKPS KR + 
Sbjct: 1  MPSVNVRDMDSFEAALKMFKKQCEREGILSEIKKREHYEKPSVKRKKK 48


>gi|148543959|ref|YP_001271329.1| 30S ribosomal protein S21 [Lactobacillus reuteri DSM 20016]
 gi|184153354|ref|YP_001841695.1| 30S ribosomal protein S21 [Lactobacillus reuteri JCM 1112]
 gi|194467781|ref|ZP_03073767.1| ribosomal protein S21 [Lactobacillus reuteri 100-23]
 gi|227364872|ref|ZP_03848918.1| ribosomal protein S21 [Lactobacillus reuteri MM2-3]
 gi|227544922|ref|ZP_03974971.1| ribosomal protein S21 [Lactobacillus reuteri CF48-3A]
 gi|300910050|ref|ZP_07127510.1| 30S ribosomal protein S21 [Lactobacillus reuteri SD2112]
 gi|312869112|ref|ZP_07729286.1| ribosomal protein S21 [Lactobacillus oris PB013-T2-3]
 gi|325682503|ref|ZP_08162020.1| 30S ribosomal protein S21 [Lactobacillus reuteri MM4-1A]
 gi|167011226|sp|A5VJG8|RS21_LACRD RecName: Full=30S ribosomal protein S21
 gi|226695022|sp|B2G6Y3|RS21_LACRJ RecName: Full=30S ribosomal protein S21
 gi|148530993|gb|ABQ82992.1| SSU ribosomal protein S21P [Lactobacillus reuteri DSM 20016]
 gi|183224698|dbj|BAG25215.1| 30S ribosomal protein S21 [Lactobacillus reuteri JCM 1112]
 gi|194452634|gb|EDX41532.1| ribosomal protein S21 [Lactobacillus reuteri 100-23]
 gi|227070076|gb|EEI08453.1| ribosomal protein S21 [Lactobacillus reuteri MM2-3]
 gi|227185089|gb|EEI65160.1| ribosomal protein S21 [Lactobacillus reuteri CF48-3A]
 gi|300892698|gb|EFK86058.1| 30S ribosomal protein S21 [Lactobacillus reuteri SD2112]
 gi|311095358|gb|EFQ53628.1| ribosomal protein S21 [Lactobacillus oris PB013-T2-3]
 gi|324978342|gb|EGC15292.1| 30S ribosomal protein S21 [Lactobacillus reuteri MM4-1A]
          Length = 63

 Score = 38.3 bits (88), Expect = 0.36,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR      A
Sbjct: 1  MSKTVVRKNESLDDALRRFKRSVSRNGTLQEYRKREFYEKPSVKRKLKSEAA 52


>gi|300173436|ref|YP_003772602.1| 30S ribosomal protein S21 [Leuconostoc gasicomitatum LMG 18811]
 gi|299887815|emb|CBL91783.1| 30S ribosomal protein S21 [Leuconostoc gasicomitatum LMG 18811]
          Length = 61

 Score = 38.3 bits (88), Expect = 0.37,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 33/61 (54%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           A  ++ +  +++ ALR  K+ +  +G L+E + R +Y KPS  R      A +R++K  
Sbjct: 1  MAKVIVRKSESLDDALRRFKRGVSKDGTLQEYRKREYYVKPSVARKLKSEAAQKRNKKKG 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|298206606|ref|YP_003714785.1| ribosomal protein S21 [Croceibacter atlanticus HTCC2559]
 gi|83849236|gb|EAP87104.1| ribosomal protein S21 [Croceibacter atlanticus HTCC2559]
          Length = 81

 Score = 38.3 bits (88), Expect = 0.37,   Method: Composition-based stats.
 Identities = 18/54 (33%), Positives = 30/54 (55%), Gaps = 1/54 (1%)

Query: 18 SAVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
          S + + V+D  N+++AL+  K+K    G +REL+ R  + KPS  R     +A 
Sbjct: 17 SMLIIPVKDGENIDRALKRFKRKFDKTGTMRELRRRQQFNKPSVVRRAEIQKAE 70


>gi|161522408|ref|YP_001585337.1| ribosomal protein S21 [Burkholderia multivorans ATCC 17616]
 gi|189348716|ref|YP_001941912.1| small subunit ribosomal protein S21 [Burkholderia multivorans
          ATCC 17616]
 gi|160345961|gb|ABX19045.1| ribosomal protein S21 [Burkholderia multivorans ATCC 17616]
 gi|189338854|dbj|BAG47922.1| small subunit ribosomal protein S21 [Burkholderia multivorans
          ATCC 17616]
          Length = 70

 Score = 38.3 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 28/44 (63%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
          +  ++ ALR  ++ ++  G++REL+ R  YEKP+  R R K+ A
Sbjct: 9  NEPIDVALRRFRRDIEKTGLIRELRSRTSYEKPTAMRKRKKASA 52


>gi|325846559|ref|ZP_08169474.1| ribosomal protein S21 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
 gi|325481317|gb|EGC84358.1| ribosomal protein S21 [Anaerococcus hydrogenalis ACS-025-V-Sch4]
          Length = 71

 Score = 38.3 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 17/48 (35%), Positives = 28/48 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           + +++ A++  K++    GVL E + R HYEKPS KR +    A R+
Sbjct: 8  ENESIDSAIKRFKRQCARSGVLTEYRKREHYEKPSLKRKKKSEAAKRK 55


>gi|134294965|ref|YP_001118700.1| SSU ribosomal protein S21P [Burkholderia vietnamiensis G4]
 gi|134138122|gb|ABO53865.1| SSU ribosomal protein S21P [Burkholderia vietnamiensis G4]
          Length = 70

 Score = 38.3 bits (88), Expect = 0.38,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 35/61 (57%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREG 85
          D  VE ALR  ++ ++  G++REL+ R  YEKP+ +R R K+ A+ R R   +++     
Sbjct: 9  DEPVEVALRRFRRNIEKTGLIRELRSRTGYEKPTTERKRKKASAVSRQRLRAKRMLPPRK 68

Query: 86 A 86
           
Sbjct: 69 L 69


>gi|306821675|ref|ZP_07455272.1| 30S ribosomal protein S21 [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
 gi|310659091|ref|YP_003936812.1| 30S ribosomal protein s21 [Clostridium sticklandii DSM 519]
 gi|304550257|gb|EFM38251.1| 30S ribosomal protein S21 [Eubacterium yurii subsp. margaretiae
          ATCC 43715]
 gi|308825869|emb|CBH21907.1| 30S ribosomal protein S21 [Clostridium sticklandii]
          Length = 58

 Score = 38.3 bits (88), Expect = 0.39,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 18 SAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
           A  V V++N  ++ AL+  K++    GV+ E++ R HY+KPS 
Sbjct: 1  MATEVKVKENESLDSALKRFKRQCALSGVMSEVRKREHYDKPSV 44


>gi|295111202|emb|CBL27952.1| SSU ribosomal protein S21P [Synergistetes bacterium SGP1]
          Length = 65

 Score = 38.3 bits (88), Expect = 0.39,   Method: Composition-based stats.
 Identities = 22/55 (40%), Positives = 33/55 (60%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
           N+E  LR  KK++   G LRE + R HYEKPS  +   ++EA R+ + + R+ A
Sbjct: 10 ENIEDTLRRFKKEVAKVGTLREARKREHYEKPSDAKKLKRAEAARKRKSMRRRNA 64


>gi|160934411|ref|ZP_02081798.1| hypothetical protein CLOLEP_03284 [Clostridium leptum DSM 753]
 gi|156867084|gb|EDO60456.1| hypothetical protein CLOLEP_03284 [Clostridium leptum DSM 753]
          Length = 58

 Score = 38.3 bits (88), Expect = 0.39,   Method: Composition-based stats.
 Identities = 18/50 (36%), Positives = 29/50 (58%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
          + +++ ALR  KK+    GV+ E++ R  YEKPS +R +    A +R  K
Sbjct: 9  NESLDSALRRFKKQCARAGVIAEVRKREAYEKPSVRRKKKSEAARKRKFK 58


>gi|254569872|ref|XP_002492046.1| hypothetical protein [Pichia pastoris GS115]
 gi|238031843|emb|CAY69766.1| hypothetical protein PAS_chr2-2_0465 [Pichia pastoris GS115]
 gi|328351463|emb|CCA37862.1| 37S ribosomal protein MRP21, mitochondrial [Pichia pastoris CBS
           7435]
          Length = 138

 Score = 38.3 bits (88), Expect = 0.39,   Method: Composition-based stats.
 Identities = 19/73 (26%), Positives = 34/73 (46%), Gaps = 1/73 (1%)

Query: 19  AVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSE-AIRRSRKLM 77
              V V D N+ QAL+ L   ++   V +E + +  Y +PS+ +  L+ E   RR  K  
Sbjct: 64  GRTVDVIDGNIGQALKQLNNLVRSNNVAQERRKQRFYLRPSKAKAELRMERNKRRFGKGF 123

Query: 78  RKIAQREGAPVSR 90
           +++ Q       +
Sbjct: 124 KRLLQIVNEAKRK 136


>gi|313888923|ref|ZP_07822583.1| ribosomal protein S21 [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312845096|gb|EFR32497.1| ribosomal protein S21 [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 59

 Score = 38.3 bits (88), Expect = 0.40,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 32/51 (62%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + +++ AL+  K++    GVL+E++ R HYEKPS +R +   EA R+  +
Sbjct: 8  ENESLDNALKRFKRQCATSGVLKEVRKREHYEKPSVRRKKKSEEARRKKHR 58


>gi|307546063|ref|YP_003898542.1| 30S ribosomal protein S21 [Halomonas elongata DSM 2581]
 gi|307218087|emb|CBV43357.1| 30S ribosomal protein S21 [Halomonas elongata DSM 2581]
          Length = 71

 Score = 38.3 bits (88), Expect = 0.40,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VRDN   + ALR  K+  +  GVL E++ R  YEKP+ +R R  + A++R  K +
Sbjct: 1  MPSVKVRDNEPFDVALRRFKRSCEKAGVLSEVRRREQYEKPTAERKRKAAAAVKRHAKKL 60

Query: 78 RKIAQR 83
          ++  +R
Sbjct: 61 QRERKR 66


>gi|260101325|ref|ZP_05751562.1| 30S ribosomal protein S21 [Lactobacillus helveticus DSM 20075]
 gi|260084910|gb|EEW69030.1| 30S ribosomal protein S21 [Lactobacillus helveticus DSM 20075]
          Length = 58

 Score = 38.3 bits (88), Expect = 0.40,   Method: Composition-based stats.
 Identities = 17/57 (29%), Positives = 28/57 (49%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           A  ++  + +++ ALR  K+ +   G L+E + R  YEKPS +R      A  R  
Sbjct: 1  MAKTIVHENESIDDALRRFKRSVSRSGTLQEYRKREFYEKPSVRRKLKSEAARNRRH 57


>gi|325529197|gb|EGD06164.1| 30S ribosomal protein S21 [Burkholderia sp. TJI49]
          Length = 70

 Score = 38.3 bits (88), Expect = 0.40,   Method: Composition-based stats.
 Identities = 19/60 (31%), Positives = 35/60 (58%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREG 85
          +  ++ ALR  ++ ++  G++REL+ R  YEKP+ +R R K+ A+ R R   R++     
Sbjct: 9  NEPIDVALRRFRRSIEKTGLIRELRSRTSYEKPTTERKRKKASAVARQRLRTRRLMPPRK 68


>gi|241668395|ref|ZP_04755973.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|254876928|ref|ZP_05249638.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|254842949|gb|EET21363.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
          Length = 66

 Score = 38.3 bits (88), Expect = 0.40,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           + +LR  K+  +  G+ +EL+ R  + KP+QKR   K  AI R++K  R+
Sbjct: 12 FDISLRNFKRACEKAGIKQELRDRKTFVKPTQKRKMAKKAAISRAKKEARR 62


>gi|167626581|ref|YP_001677081.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|241667138|ref|ZP_04754716.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|254875692|ref|ZP_05248402.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
 gi|167596582|gb|ABZ86580.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|254841713|gb|EET20127.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25015]
          Length = 65

 Score = 37.9 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 32/51 (62%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           + +LR  K+  +  G+ +EL+ R HY KP++KR   K +A++R+R   R+
Sbjct: 12 FDISLRNFKRACEKAGIKQELRDRQHYVKPTEKRKIAKRQAVKRARIAQRR 62


>gi|221134908|ref|ZP_03561211.1| 30S ribosomal protein S21 [Glaciecola sp. HTCC2999]
          Length = 71

 Score = 37.9 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   + ALR  K+  +  GVL E++ R  +EKP+ +R R K+ A +R  K +
Sbjct: 1  MPIVKVRENEPFDVALRRFKRSCEKAGVLSEVRKREFFEKPTWERKRKKAAAKKRHLKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|170734956|ref|YP_001774070.1| ribosomal protein S21 [Burkholderia cenocepacia MC0-3]
 gi|169820994|gb|ACA95575.1| ribosomal protein S21 [Burkholderia cenocepacia MC0-3]
          Length = 70

 Score = 37.9 bits (87), Expect = 0.41,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 35/60 (58%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREG 85
          +  ++ ALR  ++ ++  G++REL+ R  YEKP+ +R R K+ A+ R R   +++     
Sbjct: 9  NEPIDVALRRFRRDIEKTGLIRELRARTGYEKPTTERKRKKASAVARQRLRAKRLLPPRK 68


>gi|297617809|ref|YP_003702968.1| ribosomal protein S21 [Syntrophothermus lipocalidus DSM 12680]
 gi|297145646|gb|ADI02403.1| ribosomal protein S21 [Syntrophothermus lipocalidus DSM 12680]
          Length = 59

 Score = 37.9 bits (87), Expect = 0.43,   Method: Composition-based stats.
 Identities = 15/50 (30%), Positives = 30/50 (60%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          ++ +++ AL+  K+  Q  GV++E++   HY KPS KR +    A ++ +
Sbjct: 8  KNESLDSALKRFKRSCQRAGVMQEIRKHEHYVKPSVKRKKKSEAARKKRK 57


>gi|300726219|ref|ZP_07059672.1| ribosomal protein S21 [Prevotella bryantii B14]
 gi|299776416|gb|EFI72973.1| ribosomal protein S21 [Prevotella bryantii B14]
          Length = 63

 Score = 37.9 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  Y+KPS  +      A+
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRARQQYDKPSVLKRLKMEHAV 53


>gi|28378615|ref|NP_785507.1| 30S ribosomal protein S21 [Lactobacillus plantarum WCFS1]
 gi|254556830|ref|YP_003063247.1| 30S ribosomal protein S21 [Lactobacillus plantarum JDM1]
 gi|300768143|ref|ZP_07078048.1| 30S ribosomal protein S21 [Lactobacillus plantarum subsp.
          plantarum ATCC 14917]
 gi|308180771|ref|YP_003924899.1| ribosomal protein S21 [Lactobacillus plantarum subsp. plantarum
          ST-III]
 gi|38258514|sp|Q88VR5|RS21_LACPL RecName: Full=30S ribosomal protein S21
 gi|28271451|emb|CAD64356.1| ribosomal protein S21 [Lactobacillus plantarum WCFS1]
 gi|254045757|gb|ACT62550.1| 30S ribosomal protein S21 [Lactobacillus plantarum JDM1]
 gi|300494207|gb|EFK29370.1| 30S ribosomal protein S21 [Lactobacillus plantarum subsp.
          plantarum ATCC 14917]
 gi|308046262|gb|ADN98805.1| ribosomal protein S21 [Lactobacillus plantarum subsp. plantarum
          ST-III]
          Length = 62

 Score = 37.9 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 28/52 (53%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
           A  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS K+      A
Sbjct: 1  MAKTVVRKNESLDDALRRFKRTVSKSGTLQEYRKREFYEKPSVKKKLKSEAA 52


>gi|304439532|ref|ZP_07399438.1| 30S ribosomal protein S21 [Peptoniphilus duerdenii ATCC BAA-1640]
 gi|304371971|gb|EFM25571.1| 30S ribosomal protein S21 [Peptoniphilus duerdenii ATCC BAA-1640]
          Length = 60

 Score = 37.9 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 32/52 (61%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
           + +++ AL+  K++    GVL+E++ R HYEKPS +R +   EA R+  K 
Sbjct: 8  ENESLDNALKRFKRQCATNGVLKEVRKREHYEKPSVRRKKKSEEARRKKFKR 59


>gi|218441041|ref|YP_002379370.1| 30S ribosomal protein S21 [Cyanothece sp. PCC 7424]
 gi|226694994|sp|B7KLD0|RS21_CYAP7 RecName: Full=30S ribosomal protein S21
 gi|218173769|gb|ACK72502.1| ribosomal protein S21 [Cyanothece sp. PCC 7424]
          Length = 60

 Score = 37.9 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 10/39 (25%), Positives = 22/39 (56%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
          V+ ++  +E ALR  K+++   G+  ++K    +E P +
Sbjct: 5  VIGQNEAIESALRRFKRQVAKAGIYADIKKNQFFETPEE 43


>gi|239995169|ref|ZP_04715693.1| 30S ribosomal protein S21 [Alteromonas macleodii ATCC 27126]
 gi|332140164|ref|YP_004425902.1| 30S ribosomal protein S21 [Alteromonas macleodii str. 'Deep
          ecotype']
 gi|332142977|ref|YP_004428715.1| 30S ribosomal protein S21 [Alteromonas macleodii str. 'Deep
          ecotype']
 gi|332142978|ref|YP_004428716.1| 30S ribosomal protein S21 [Alteromonas macleodii str. 'Deep
          ecotype']
 gi|226694968|sp|B4RY34|RS21_ALTMD RecName: Full=30S ribosomal protein S21
 gi|327550186|gb|AEA96904.1| 30S ribosomal protein S21 [Alteromonas macleodii str. 'Deep
          ecotype']
 gi|327552999|gb|AEA99717.1| 30S ribosomal protein S21 [Alteromonas macleodii str. 'Deep
          ecotype']
 gi|327553000|gb|AEA99718.1| 30S ribosomal protein S21 [Alteromonas macleodii str. 'Deep
          ecotype']
 gi|332994455|gb|AEF04510.1| 30S ribosomal protein S21 [Alteromonas sp. SN2]
          Length = 71

 Score = 37.9 bits (87), Expect = 0.45,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   + ALR  K+  +  GVL E++ R  +EKP+ +R R K+ A +R  K +
Sbjct: 1  MPIVKVRENEPFDVALRRFKRSCEKAGVLSEVRRREFFEKPTWERKRKKAAAKKRHLKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|298490955|ref|YP_003721132.1| 30S ribosomal protein S21 ['Nostoc azollae' 0708]
 gi|298232873|gb|ADI64009.1| ribosomal protein S21 ['Nostoc azollae' 0708]
          Length = 58

 Score = 37.9 bits (87), Expect = 0.46,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 30/53 (56%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          VL  +  ++ ALR  K+++   G+L ++K   H+E P +KR R    A R+ R
Sbjct: 5  VLGENEGIDSALRRFKRQVSKAGILADVKYHRHFETPLEKRKRKAVAARRKRR 57


>gi|323490057|ref|ZP_08095278.1| 30S ribosomal protein S21 [Planococcus donghaensis MPA1U2]
 gi|323396353|gb|EGA89178.1| 30S ribosomal protein S21 [Planococcus donghaensis MPA1U2]
          Length = 57

 Score = 37.9 bits (87), Expect = 0.46,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 29/48 (60%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++ ++E ALR  K+ +   G ++E++ R +Y+KPS KR      A +R
Sbjct: 8  KNESIEDALRRFKRTVSKSGTMQEVRKREYYDKPSVKRKLKSEAARKR 55


>gi|17228237|ref|NP_484785.1| 30S ribosomal protein S21 [Nostoc sp. PCC 7120]
 gi|75910839|ref|YP_325135.1| 30S ribosomal protein S21 [Anabaena variabilis ATCC 29413]
 gi|61238462|sp|P0A4B7|RS21A_ANASP RecName: Full=30S ribosomal protein S21 A
 gi|61238467|sp|P0A4B8|RS21A_ANAVA RecName: Full=30S ribosomal protein S21 A
 gi|119367225|sp|Q3M446|RS213_ANAVT RecName: Full=30S ribosomal protein S21 3
 gi|532034|dbj|BAA04564.1| 30S ribosomal protein S21 [Anabaena variabilis]
 gi|17130087|dbj|BAB72699.1| 30S ribosomal protein S21 [Nostoc sp. PCC 7120]
 gi|75704564|gb|ABA24240.1| SSU ribosomal protein S21P [Anabaena variabilis ATCC 29413]
          Length = 62

 Score = 37.9 bits (87), Expect = 0.46,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 33/57 (57%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
          V+  + ++E ALR  K+++   G+ ++++   H+E P +K  R K    ++S++  R
Sbjct: 5  VVGENEHIESALRRFKREVSKAGIFQDMRKHRHFETPIEKSKRKKLALHKQSKRRFR 61


>gi|254368705|ref|ZP_04984718.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica FSC022]
 gi|157121626|gb|EDO65796.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica FSC022]
          Length = 65

 Score = 37.9 bits (87), Expect = 0.46,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 31/51 (60%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           + +LR  K+  +  G+ +EL+ R HY KP++KR   K + ++R+R   R+
Sbjct: 12 FDISLRNFKRACEKAGIKQELRDRQHYVKPTEKRKIAKRQVVKRARISQRR 62


>gi|150390792|ref|YP_001320841.1| ribosomal protein S21 [Alkaliphilus metalliredigens QYMF]
 gi|167011220|sp|A6TSL4|RS21_ALKMQ RecName: Full=30S ribosomal protein S21
 gi|149950654|gb|ABR49182.1| ribosomal protein S21 [Alkaliphilus metalliredigens QYMF]
          Length = 57

 Score = 37.9 bits (87), Expect = 0.47,   Method: Composition-based stats.
 Identities = 17/43 (39%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
             + ++DN  ++ ALR  KK+    GV+ E++ R HYEKPS 
Sbjct: 1  MSEIKIKDNESLDNALRRFKKQCAKSGVMAEVRKREHYEKPSV 43


>gi|134302527|ref|YP_001122497.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis WY96-3418]
 gi|134050304|gb|ABO47375.1| ribosomal protein S21 [Francisella tularensis subsp. tularensis
          WY96-3418]
          Length = 65

 Score = 37.9 bits (87), Expect = 0.47,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 31/51 (60%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           + +LR  K+  +  G+ +EL+ R HY KP++KR   K +A++R R   R+
Sbjct: 12 FDISLRNFKRACEKAGIKQELRDRQHYVKPTEKRKIAKRQAVKRVRISQRR 62


>gi|118497087|ref|YP_898137.1| 30S ribosomal protein S21 [Francisella tularensis subsp. novicida
          U112]
 gi|194323383|ref|ZP_03057160.1| ribosomal protein S21 [Francisella tularensis subsp. novicida
          FTE]
 gi|208778879|ref|ZP_03246225.1| ribosomal protein S21 [Francisella novicida FTG]
 gi|254372451|ref|ZP_04987940.1| 30S ribosomal protein S21 [Francisella tularensis subsp. novicida
          GA99-3549]
 gi|254373913|ref|ZP_04989395.1| 30S ribosomal protein S21 [Francisella novicida GA99-3548]
 gi|118422993|gb|ABK89383.1| 30S ribosomal protein S21 [Francisella novicida U112]
 gi|151570178|gb|EDN35832.1| 30S ribosomal protein S21 [Francisella novicida GA99-3549]
 gi|151571633|gb|EDN37287.1| 30S ribosomal protein S21 [Francisella novicida GA99-3548]
 gi|194322238|gb|EDX19719.1| ribosomal protein S21 [Francisella tularensis subsp. novicida
          FTE]
 gi|208744679|gb|EDZ90977.1| ribosomal protein S21 [Francisella novicida FTG]
 gi|328675624|gb|AEB28299.1| SSU ribosomal protein S21p [Francisella cf. novicida 3523]
 gi|328676548|gb|AEB27418.1| SSU ribosomal protein S21p [Francisella cf. novicida Fx1]
          Length = 65

 Score = 37.9 bits (87), Expect = 0.48,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 32/51 (62%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           + +LR  K+  +  G+ +EL+ R HY KP++KR   K +A++R+R   R+
Sbjct: 12 FDISLRNFKRACEKAGIKQELRDRQHYVKPTEKRKIAKRQAVKRARISQRR 62


>gi|56707539|ref|YP_169435.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|110670010|ref|YP_666567.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|187931343|ref|YP_001891327.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          mediasiatica FSC147]
 gi|224456608|ref|ZP_03665081.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|254370062|ref|ZP_04986068.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis FSC033]
 gi|254874357|ref|ZP_05247067.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|81677102|sp|Q5NHQ7|RS211_FRATT RecName: Full=30S ribosomal protein S21 1
 gi|119367206|sp|Q14J59|RS211_FRAT1 RecName: Full=30S ribosomal protein S21 1
 gi|56604031|emb|CAG45023.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|110320343|emb|CAL08406.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|151568306|gb|EDN33960.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis FSC033]
 gi|187712252|gb|ACD30549.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          mediasiatica FSC147]
 gi|254840356|gb|EET18792.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|282158693|gb|ADA78084.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis NE061598]
          Length = 65

 Score = 37.9 bits (87), Expect = 0.48,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 32/51 (62%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           + +LR  K+  +  G+ +EL+ R HY KP++KR   K +A++R+R   R+
Sbjct: 12 FDISLRNFKRACEKAGIKQELRDRQHYVKPTEKRKIAKRQAVKRARISQRR 62


>gi|302842616|ref|XP_002952851.1| hypothetical protein VOLCADRAFT_105672 [Volvox carteri f.
            nagariensis]
 gi|300261891|gb|EFJ46101.1| hypothetical protein VOLCADRAFT_105672 [Volvox carteri f.
            nagariensis]
          Length = 4799

 Score = 37.9 bits (87), Expect = 0.48,   Method: Composition-based stats.
 Identities = 18/73 (24%), Positives = 32/73 (43%), Gaps = 4/73 (5%)

Query: 23   LVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQ 82
            + R ++++  L VL  K++ E V    K+R   EK  ++R            +L  K+A 
Sbjct: 2239 MARSDDLDSELSVLSLKLERERVELARKLRE--EK--ERRRAKVLAKQAEVERLRSKLAA 2294

Query: 83   REGAPVSRLRQHR 95
             +G P  R    +
Sbjct: 2295 LKGQPAPRAAAPK 2307


>gi|260909720|ref|ZP_05916414.1| 30S ribosomal protein S21 [Prevotella sp. oral taxon 472 str.
          F0295]
 gi|260636145|gb|EEX54141.1| 30S ribosomal protein S21 [Prevotella sp. oral taxon 472 str.
          F0295]
          Length = 63

 Score = 37.9 bits (87), Expect = 0.48,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  Y+KPS  +      AI
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRARQQYDKPSVLKRLKMEHAI 53


>gi|298245007|ref|ZP_06968813.1| ribosomal protein S21 [Ktedonobacter racemifer DSM 44963]
 gi|297552488|gb|EFH86353.1| ribosomal protein S21 [Ktedonobacter racemifer DSM 44963]
          Length = 60

 Score = 37.9 bits (87), Expect = 0.49,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 32/52 (61%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
           + + E AL+   +K+Q +G+L E + R H+EKPS KR R ++   R+ ++ 
Sbjct: 8  ENESFETALKRFNRKIQQDGILAEARRREHFEKPSMKRKRKEATRRRKMQRR 59


>gi|260592788|ref|ZP_05858246.1| ribosomal protein S21 [Prevotella veroralis F0319]
 gi|260535319|gb|EEX17936.1| ribosomal protein S21 [Prevotella veroralis F0319]
          Length = 63

 Score = 37.9 bits (87), Expect = 0.49,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  ++KPS K+      A+
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRARQQFDKPSVKKRLKMEHAV 53


>gi|218437663|ref|YP_002375992.1| ribosomal protein S21 [Cyanothece sp. PCC 7424]
 gi|218170391|gb|ACK69124.1| ribosomal protein S21 [Cyanothece sp. PCC 7424]
          Length = 41

 Score = 37.9 bits (87), Expect = 0.50,   Method: Composition-based stats.
 Identities = 10/30 (33%), Positives = 18/30 (60%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKP 58
          +E ALR  KK++   G+ +++K    +E P
Sbjct: 12 IESALRRFKKQVAKAGIYQDIKKHQFFETP 41


>gi|167583109|ref|ZP_02375983.1| ribosomal protein S21 [Burkholderia thailandensis TXDOH]
          Length = 70

 Score = 37.9 bits (87), Expect = 0.51,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 35/60 (58%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREG 85
          +  ++ ALR  ++ ++  G++REL+ R  YEKP+ +R R K+ A+ R R   +++     
Sbjct: 9  NEPIDVALRRFRRGIEKTGLIRELRSRTGYEKPTTERKRKKASAVARQRLRAKRMLPPRK 68


>gi|301771137|ref|XP_002920979.1| PREDICTED: hydrocephalus-inducing protein homolog [Ailuropoda
            melanoleuca]
          Length = 5129

 Score = 37.9 bits (87), Expect = 0.52,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 14/75 (18%)

Query: 26   DNNVEQALRVLKKKMQGEGVLRELKM--RGHYEKPSQ---KRVRLKSEAIRRSRKLMRKI 80
            +  V+QALR  KK        REL+   R  +EK  Q   +R R + E  RR +K  +  
Sbjct: 2329 NREVQQALRERKK--------RELERLAREMHEKKLQQELERQREEDELKRRVKKPKQGP 2380

Query: 81   AQREGAPVSRLRQHR 95
             + E     + + +R
Sbjct: 2381 VKEE-PIPKKSQTNR 2394


>gi|281351462|gb|EFB27046.1| hypothetical protein PANDA_009814 [Ailuropoda melanoleuca]
          Length = 5119

 Score = 37.9 bits (87), Expect = 0.52,   Method: Composition-based stats.
 Identities = 22/75 (29%), Positives = 34/75 (45%), Gaps = 14/75 (18%)

Query: 26   DNNVEQALRVLKKKMQGEGVLRELKM--RGHYEKPSQ---KRVRLKSEAIRRSRKLMRKI 80
            +  V+QALR  KK        REL+   R  +EK  Q   +R R + E  RR +K  +  
Sbjct: 2320 NREVQQALRERKK--------RELERLAREMHEKKLQQELERQREEDELKRRVKKPKQGP 2371

Query: 81   AQREGAPVSRLRQHR 95
             + E     + + +R
Sbjct: 2372 VKEE-PIPKKSQTNR 2385


>gi|187734923|ref|YP_001877035.1| ribosomal protein S21 [Akkermansia muciniphila ATCC BAA-835]
 gi|226694967|sp|B2UNE2|RS21_AKKM8 RecName: Full=30S ribosomal protein S21
 gi|187424975|gb|ACD04254.1| ribosomal protein S21 [Akkermansia muciniphila ATCC BAA-835]
          Length = 83

 Score = 37.9 bits (87), Expect = 0.52,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             V VR    +++AL+ LK K+  EG+L E++ R  +E P  +R R    A +R++
Sbjct: 1  MREVTVRKGEPIDRALKRLKTKLDVEGILDEMRRRRAFETPMDERRRKARSASKRNK 57


>gi|291166415|gb|EFE28461.1| 30S ribosomal protein S21 [Filifactor alocis ATCC 35896]
          Length = 58

 Score = 37.9 bits (87), Expect = 0.52,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 28/44 (63%), Gaps = 1/44 (2%)

Query: 18 SAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
           A  + V++N  ++ ALR  K++    GV++E++ R HY+KPS 
Sbjct: 1  MATEIKVKENESLDSALRRFKRQCALSGVMQEVRKREHYDKPSV 44


>gi|209525034|ref|ZP_03273578.1| ribosomal protein S21 [Arthrospira maxima CS-328]
 gi|284053862|ref|ZP_06384072.1| 30S ribosomal protein S21 [Arthrospira platensis str. Paraca]
 gi|209494443|gb|EDZ94754.1| ribosomal protein S21 [Arthrospira maxima CS-328]
 gi|291570303|dbj|BAI92575.1| 30S ribosomal protein S21 [Arthrospira platensis NIES-39]
          Length = 65

 Score = 37.9 bits (87), Expect = 0.52,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 30/57 (52%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
           +  +E ALR  K+++   G+L +++ + H+E P +KR R      R+ R   +K  
Sbjct: 8  ENEQLESALRRFKREVSKAGILADVRKKRHFETPPEKRKRKAIANQRQRRAFRKKRM 64


>gi|109073053|ref|XP_001090339.1| PREDICTED: NEDD9-interacting protein with calponin homology and LIM
           domains isoform 3 [Macaca mulatta]
          Length = 1066

 Score = 37.6 bits (86), Expect = 0.55,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 17/69 (24%)

Query: 26  DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKR---VRLKSEAIRRSRKL---MRK 79
           D++VEQAL+   K     G + +         P+ +R    R K E ++R RK     R+
Sbjct: 885 DSDVEQALQTFAKT---SGTMNDY--------PTWRRTLLRRAKEEEMKRFRKAQTIQRR 933

Query: 80  IAQREGAPV 88
           + + EGA  
Sbjct: 934 LNEIEGALR 942


>gi|302039434|ref|YP_003799756.1| 30S ribosomal protein S21 [Candidatus Nitrospira defluvii]
 gi|300607498|emb|CBK43831.1| 30S ribosomal protein S21 [Candidatus Nitrospira defluvii]
          Length = 64

 Score = 37.6 bits (86), Expect = 0.56,   Method: Composition-based stats.
 Identities = 30/62 (48%), Positives = 43/62 (69%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + + V +NNVE+AL+V KKK+ GEG+ RELK R +YEKPS ++   + EA RR +K + K
Sbjct: 1  MEIKVFNNNVEKALKVAKKKLAGEGLFRELKRRRYYEKPSVRKKAKEREAQRRRQKWLAK 60

Query: 80 IA 81
            
Sbjct: 61 RR 62


>gi|288926257|ref|ZP_06420182.1| ribosomal protein S21 [Prevotella buccae D17]
 gi|315606524|ref|ZP_07881539.1| 30S ribosomal protein S21 [Prevotella buccae ATCC 33574]
 gi|288336948|gb|EFC75309.1| ribosomal protein S21 [Prevotella buccae D17]
 gi|315251930|gb|EFU31904.1| 30S ribosomal protein S21 [Prevotella buccae ATCC 33574]
          Length = 63

 Score = 37.6 bits (86), Expect = 0.56,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  Y+KPS  +      A+
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRARQQYDKPSVLKRLKMEHAV 53


>gi|184155311|ref|YP_001843651.1| 30S ribosomal protein S21 [Lactobacillus fermentum IFO 3956]
 gi|260662175|ref|ZP_05863071.1| 30S ribosomal protein S21 [Lactobacillus fermentum 28-3-CHN]
 gi|226695021|sp|B2GBY9|RS21_LACF3 RecName: Full=30S ribosomal protein S21
 gi|183226655|dbj|BAG27171.1| 30S ribosomal protein S21 [Lactobacillus fermentum IFO 3956]
 gi|260553558|gb|EEX26450.1| 30S ribosomal protein S21 [Lactobacillus fermentum 28-3-CHN]
          Length = 62

 Score = 37.6 bits (86), Expect = 0.56,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 28/52 (53%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
           +  ++ ++ +++ ALR  K+ +   G L+E + R  YEKPS KR      A
Sbjct: 1  MSKTIVRKNESLDDALRRFKRTVSRNGTLQEYRKREFYEKPSVKRKLKSEAA 52


>gi|115360546|ref|YP_777683.1| ribosomal protein S21 [Burkholderia ambifaria AMMD]
 gi|170702641|ref|ZP_02893510.1| ribosomal protein S21 [Burkholderia ambifaria IOP40-10]
 gi|171319235|ref|ZP_02908351.1| ribosomal protein S21 [Burkholderia ambifaria MEX-5]
 gi|172064869|ref|YP_001815581.1| ribosomal protein S21 [Burkholderia ambifaria MC40-6]
 gi|115285874|gb|ABI91349.1| SSU ribosomal protein S21P [Burkholderia ambifaria AMMD]
 gi|170132461|gb|EDT00920.1| ribosomal protein S21 [Burkholderia ambifaria IOP40-10]
 gi|171095537|gb|EDT40501.1| ribosomal protein S21 [Burkholderia ambifaria MEX-5]
 gi|171997111|gb|ACB68028.1| ribosomal protein S21 [Burkholderia ambifaria MC40-6]
          Length = 70

 Score = 37.6 bits (86), Expect = 0.56,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 35/60 (58%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREG 85
          +  ++ ALR  ++ ++  G++REL+ R  YEKP+ +R R K+ A+ R R   +++     
Sbjct: 9  NEPIDVALRRFRRDIEKTGLIRELRSRTGYEKPTTERKRKKASAVARQRLRAKRMLPPRK 68


>gi|332298087|ref|YP_004440009.1| 30S ribosomal protein S21 [Treponema brennaborense DSM 12168]
 gi|332181190|gb|AEE16878.1| 30S ribosomal protein S21 [Treponema brennaborense DSM 12168]
          Length = 72

 Score = 37.6 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 17/46 (36%), Positives = 29/46 (63%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           N+E+A++  K+ ++ EG++RE K R +YEKPS  + R      R+
Sbjct: 10 ENLEKAIKRFKRMVEKEGIIREYKKREYYEKPSTIKNRKNKTLQRK 55


>gi|297291966|ref|XP_002803995.1| PREDICTED: NEDD9-interacting protein with calponin homology and LIM
           domains [Macaca mulatta]
          Length = 1065

 Score = 37.6 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 32/69 (46%), Gaps = 17/69 (24%)

Query: 26  DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKR---VRLKSEAIRRSRKL---MRK 79
           D++VEQAL+   K     G + +         P+ +R    R K E ++R RK     R+
Sbjct: 884 DSDVEQALQTFAKT---SGTMNDY--------PTWRRTLLRRAKEEEMKRFRKAQTIQRR 932

Query: 80  IAQREGAPV 88
           + + EGA  
Sbjct: 933 LNEIEGALR 941


>gi|189485244|ref|YP_001956185.1| 30S ribosomal protein S21 [uncultured Termite group 1 bacterium
          phylotype Rs-D17]
 gi|226695064|sp|B1GZP2|RS21_UNCTG RecName: Full=30S ribosomal protein S21
 gi|170287203|dbj|BAG13724.1| 30S ribosomal protein S21 [uncultured Termite group 1 bacterium
          phylotype Rs-D17]
          Length = 68

 Score = 37.6 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 21/62 (33%), Positives = 36/62 (58%), Gaps = 1/62 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           V V VR+   +E+A+R  K++ +  GV++E+K R  Y+ PS  +    +E  R+ R+ M
Sbjct: 1  MVSVKVREGESIEEAIRRFKRECERNGVMQEIKKREFYKTPSILKKEKLAETKRKIRRKM 60

Query: 78 RK 79
           K
Sbjct: 61 FK 62


>gi|73541980|ref|YP_296500.1| 30S ribosomal protein S21 [Ralstonia eutropha JMP134]
 gi|94311391|ref|YP_584601.1| 30S ribosomal protein S21 [Cupriavidus metallidurans CH34]
 gi|119367210|sp|Q1LKJ4|RS211_RALME RecName: Full=30S ribosomal protein S21 1
 gi|119367297|sp|Q46YX7|RS21_RALEJ RecName: Full=30S ribosomal protein S21
 gi|72119393|gb|AAZ61656.1| SSU ribosomal protein S21P [Ralstonia eutropha JMP134]
 gi|93355243|gb|ABF09332.1| 30S ribosomal subunit protein S21 [Cupriavidus metallidurans
          CH34]
          Length = 70

 Score = 37.6 bits (86), Expect = 0.57,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 31/58 (53%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGA 86
          VE A+R  ++ +   G++ ELK R  YEKP+ +R R K  A  R RK +R     +  
Sbjct: 12 VEVAMRRFRRAILQTGLIVELKSRTAYEKPTTERKRKKKAAEARLRKRLRMQMLPKKL 69


>gi|281425135|ref|ZP_06256048.1| ribosomal protein S21 [Prevotella oris F0302]
 gi|281400727|gb|EFB31558.1| ribosomal protein S21 [Prevotella oris F0302]
          Length = 63

 Score = 37.6 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  G+++EL+ R  Y KPS  +      AI
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGIVKELRARQQYNKPSVLKRLKMEHAI 53


>gi|71020321|ref|XP_760391.1| hypothetical protein UM04244.1 [Ustilago maydis 521]
 gi|46100060|gb|EAK85293.1| hypothetical protein UM04244.1 [Ustilago maydis 521]
          Length = 203

 Score = 37.6 bits (86), Expect = 0.58,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 28  NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
           +  +A   L   ++   V +EL+++  YEKP+++R R KSE  RR 
Sbjct: 138 DPARAYAQLSVLLRRNNVRQELRLQQRYEKPNEERRRKKSERHRRR 183


>gi|326899895|gb|AEA09222.1| SSU ribosomal protein S21P [uncultured Acidobacteria bacterium]
          Length = 74

 Score = 37.6 bits (86), Expect = 0.60,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 31/61 (50%), Gaps = 1/61 (1%)

Query: 10 IFSEGREISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSE 68
          +   G       V +++   +E ALR  K+K+Q E +++E+K    Y KP +K    ++ 
Sbjct: 1  MVELGGVFRLAEVKLQEGETLENALRRFKRKVQQEDIIKEVKRHSFYLKPGEKLRAKQAL 60

Query: 69 A 69
          A
Sbjct: 61 A 61


>gi|288929394|ref|ZP_06423239.1| ribosomal protein S21 [Prevotella sp. oral taxon 317 str. F0108]
 gi|288329496|gb|EFC68082.1| ribosomal protein S21 [Prevotella sp. oral taxon 317 str. F0108]
          Length = 63

 Score = 37.6 bits (86), Expect = 0.60,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  Y+KPS  +      A+
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRARQQYDKPSVLKRLKMEHAV 53


>gi|160946012|ref|ZP_02093238.1| hypothetical protein FAEPRAM212_03545 [Faecalibacterium
          prausnitzii M21/2]
 gi|257439126|ref|ZP_05614881.1| ribosomal protein S21 [Faecalibacterium prausnitzii A2-165]
 gi|313114985|ref|ZP_07800478.1| ribosomal protein S21 [Faecalibacterium cf. prausnitzii KLE1255]
 gi|158443743|gb|EDP20748.1| hypothetical protein FAEPRAM212_03545 [Faecalibacterium
          prausnitzii M21/2]
 gi|257198377|gb|EEU96661.1| ribosomal protein S21 [Faecalibacterium prausnitzii A2-165]
 gi|295100370|emb|CBK97915.1| SSU ribosomal protein S21P [Faecalibacterium prausnitzii L2-6]
 gi|295103262|emb|CBL00806.1| SSU ribosomal protein S21P [Faecalibacterium prausnitzii SL3/3]
 gi|310622676|gb|EFQ06138.1| ribosomal protein S21 [Faecalibacterium cf. prausnitzii KLE1255]
          Length = 58

 Score = 37.6 bits (86), Expect = 0.60,   Method: Composition-based stats.
 Identities = 21/58 (36%), Positives = 30/58 (51%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             + V++   +E ALR  K+     GVL E++ R  YEKPS KR +    A +R  K
Sbjct: 1  MSEIRVKEGESLESALRRFKRSTARSGVLAEVRKREAYEKPSVKRKKKSEAARKRKFK 58


>gi|294668529|ref|ZP_06733626.1| ribosomal protein S21 [Neisseria elongata subsp. glycolytica ATCC
          29315]
 gi|291309492|gb|EFE50735.1| ribosomal protein S21 [Neisseria elongata subsp. glycolytica ATCC
          29315]
          Length = 70

 Score = 37.6 bits (86), Expect = 0.60,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A +R +K +
Sbjct: 1  MPTIRVKENEPFEVAMRRFKRAIEKTGLLTELRAREAYEKPTTERKRKKAAAAKRLQKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|295133018|ref|YP_003583694.1| 30S ribosomal protein S21 [Zunongwangia profunda SM-A87]
 gi|294981033|gb|ADF51498.1| 30S ribosomal protein S21 [Zunongwangia profunda SM-A87]
          Length = 64

 Score = 37.6 bits (86), Expect = 0.61,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRV 63
           + + V+D  N+++AL+  K+K    G +R+L+ R H+ KPS +R 
Sbjct: 1  MLIIPVKDGENIDRALKRFKRKFDKTGTMRQLRSRQHFTKPSVERR 46


>gi|288817488|ref|YP_003431835.1| ribosomal protein S21 [Hydrogenobacter thermophilus TK-6]
 gi|288786887|dbj|BAI68634.1| ribosomal protein S21 [Hydrogenobacter thermophilus TK-6]
 gi|308751095|gb|ADO44578.1| ribosomal protein S21 [Hydrogenobacter thermophilus TK-6]
          Length = 66

 Score = 37.6 bits (86), Expect = 0.62,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 28/42 (66%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLK 66
           + + E+ L+  K+ ++ EG+L E+K R  YEKPS+K+ R +
Sbjct: 8  ENESFEKVLKKFKRIVEKEGILTEVKRRQFYEKPSEKKKRKE 49


>gi|238020677|ref|ZP_04601103.1| hypothetical protein GCWU000324_00566 [Kingella oralis ATCC
          51147]
 gi|237867657|gb|EEP68663.1| hypothetical protein GCWU000324_00566 [Kingella oralis ATCC
          51147]
          Length = 70

 Score = 37.6 bits (86), Expect = 0.62,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A +R +K +
Sbjct: 1  MPSIKVKENEPFEVAMRRFKRAIEKTGLLTELRAREAYEKPTTERKRKKAAAAKRLQKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|194290321|ref|YP_002006228.1| 30S ribosomal subunit protein s21 [Cupriavidus taiwanensis LMG
          19424]
 gi|193224156|emb|CAQ70165.1| 30S ribosomal subunit protein S21 [Cupriavidus taiwanensis LMG
          19424]
          Length = 70

 Score = 37.6 bits (86), Expect = 0.63,   Method: Composition-based stats.
 Identities = 22/69 (31%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + +++N   E ALR  K+ ++  G+L EL+ R  YEKP+  R R K+ A +R  K +
Sbjct: 1  MTTIRLKENEPFEVALRRFKRTIEKNGLLPELRAREFYEKPTAARKRKKAAAEKRHYKRI 60

Query: 78 RKIAQREGA 86
          R     +  
Sbjct: 61 RSQMLPKKL 69


>gi|326794302|ref|YP_004312122.1| 30S ribosomal protein S21 [Marinomonas mediterranea MMB-1]
 gi|326545066|gb|ADZ90286.1| 30S ribosomal protein S21 [Marinomonas mediterranea MMB-1]
          Length = 71

 Score = 37.6 bits (86), Expect = 0.63,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPS 59
             V V+DN   + ALR  K+  +  GVL E++ R  YEKP+
Sbjct: 1  MPSVKVKDNEPFDIALRRFKRSCEKAGVLAEVRRRECYEKPT 42


>gi|281357527|ref|ZP_06244015.1| ribosomal protein S21 [Victivallis vadensis ATCC BAA-548]
 gi|281316130|gb|EFB00156.1| ribosomal protein S21 [Victivallis vadensis ATCC BAA-548]
          Length = 55

 Score = 37.6 bits (86), Expect = 0.64,   Method: Composition-based stats.
 Identities = 22/54 (40%), Positives = 32/54 (59%), Gaps = 1/54 (1%)

Query: 18 SAVYVLVRDNNV-EQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
              V V+   + ++ALR LKKK+  EG L+EL+ R HYEKPS+ + R   +  
Sbjct: 1  MDTEVRVKKGEIIDRALRRLKKKLDKEGTLKELRNRRHYEKPSEIKRREAKQRR 54


>gi|113868562|ref|YP_727051.1| 30S ribosomal protein S21 [Ralstonia eutropha H16]
 gi|194290193|ref|YP_002006100.1| 30S ribosomal protein s21 [Cupriavidus taiwanensis LMG 19424]
 gi|113527338|emb|CAJ93683.1| SSU ribosomal protein S21 [Ralstonia eutropha H16]
 gi|193224028|emb|CAQ70037.1| 30S ribosomal subunit protein S21 [Cupriavidus taiwanensis LMG
          19424]
          Length = 70

 Score = 37.6 bits (86), Expect = 0.64,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 31/57 (54%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREG 85
          VE A+R  ++ +   G++ ELK R  YEKP+ +R R K  A  R RK +R     + 
Sbjct: 12 VEVAMRRFRRAILQTGLIVELKSRTAYEKPTTERKRKKKAAEARLRKRLRMQMLPKK 68


>gi|323344610|ref|ZP_08084834.1| 30S ribosomal protein S21 [Prevotella oralis ATCC 33269]
 gi|323093880|gb|EFZ36457.1| 30S ribosomal protein S21 [Prevotella oralis ATCC 33269]
          Length = 63

 Score = 37.6 bits (86), Expect = 0.66,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  Y KPS  +      AI
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRARQQYNKPSVLKRLKMEHAI 53


>gi|226311641|ref|YP_002771535.1| 30S ribosomal protein S21 [Brevibacillus brevis NBRC 100599]
 gi|254813083|sp|C0ZB72|RS21_BREBN RecName: Full=30S ribosomal protein S21
 gi|226094589|dbj|BAH43031.1| 30S ribosomal protein S21 [Brevibacillus brevis NBRC 100599]
          Length = 57

 Score = 37.6 bits (86), Expect = 0.67,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 30/48 (62%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++ +++ ALR  K++    GV+ EL+ R H+EKPS KR +    A +R
Sbjct: 8  KNESLDSALRRFKRESAKSGVMAELRKRRHFEKPSIKRKKKSEAARKR 55


>gi|188997141|ref|YP_001931392.1| ribosomal protein S21 [Sulfurihydrogenibium sp. YO3AOP1]
 gi|226695058|sp|B2VA65|RS21_SULSY RecName: Full=30S ribosomal protein S21
 gi|188932208|gb|ACD66838.1| ribosomal protein S21 [Sulfurihydrogenibium sp. YO3AOP1]
          Length = 64

 Score = 37.6 bits (86), Expect = 0.67,   Method: Composition-based stats.
 Identities = 23/55 (41%), Positives = 34/55 (61%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
          + + E+AL+  KK ++ EG+L E K R  YEKPS KR R +  A +R  K ++K 
Sbjct: 7  EGDFEKALKKFKKIIEKEGILTEYKRREFYEKPSVKRKRKERAARKRLIKALKKK 61


>gi|226532472|ref|NP_001144309.1| hypothetical protein LOC100277200 [Zea mays]
 gi|195620276|gb|ACG31968.1| hypothetical protein [Zea mays]
 gi|195639950|gb|ACG39443.1| hypothetical protein [Zea mays]
          Length = 111

 Score = 37.6 bits (86), Expect = 0.68,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 13  EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHY-EKPSQKRVRLKSEAIR 71
           + ++   + V VRD N+E+AL +++++M+  G+ R ++ R HY  K S+KRV  +   ++
Sbjct: 30  QVQQARGIVVQVRDGNLERALSIMERRMRSSGMERLIRARTHYHVKDSEKRVLARKGLMQ 89

Query: 72  RSRKLMRKIAQRE 84
           R R        RE
Sbjct: 90  RVRSQELGKKLRE 102


>gi|87119775|ref|ZP_01075672.1| 30S ribosomal protein S21 [Marinomonas sp. MED121]
 gi|152995075|ref|YP_001339910.1| 30S ribosomal protein S21 [Marinomonas sp. MWYL1]
 gi|189044905|sp|A6VU46|RS21_MARMS RecName: Full=30S ribosomal protein S21
 gi|86165251|gb|EAQ66519.1| 30S ribosomal protein S21 [Marinomonas sp. MED121]
 gi|150835999|gb|ABR69975.1| ribosomal protein S21 [Marinomonas sp. MWYL1]
          Length = 71

 Score = 37.6 bits (86), Expect = 0.68,   Method: Composition-based stats.
 Identities = 17/42 (40%), Positives = 24/42 (57%), Gaps = 1/42 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPS 59
             V V+DN   + ALR  K+  +  GVL E++ R  YEKP+
Sbjct: 1  MPAVKVKDNEPFDIALRRFKRSCEKAGVLAEVRRRECYEKPT 42


>gi|15606212|ref|NP_213589.1| ribosomal protein S21 [Aquifex aeolicus VF5]
 gi|7388171|sp|O67028|RS21_AQUAE RecName: Full=30S ribosomal protein S21
 gi|2983406|gb|AAC06990.1| ribosomal protein S21 [Aquifex aeolicus VF5]
          Length = 67

 Score = 37.6 bits (86), Expect = 0.69,   Method: Composition-based stats.
 Identities = 19/65 (29%), Positives = 39/65 (60%), Gaps = 1/65 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           V V+V++   +E+ L+  K +++ E +L ELK R +YE PS+++ + +    ++  K +
Sbjct: 1  MVTVIVQEGEPIEKVLKRFKARVEQEQILTELKRREYYEPPSERKKKRERNRRKKILKAL 60

Query: 78 RKIAQ 82
          +K  Q
Sbjct: 61 KKQQQ 65


>gi|156846005|ref|XP_001645891.1| hypothetical protein Kpol_1045p18 [Vanderwaltozyma polyspora DSM
           70294]
 gi|156116561|gb|EDO18033.1| hypothetical protein Kpol_1045p18 [Vanderwaltozyma polyspora DSM
           70294]
          Length = 170

 Score = 37.2 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 14/56 (25%), Positives = 26/56 (46%)

Query: 17  ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
           ++   V V +N++  A R L  K+    +  + + +  Y KP +     KS+  RR
Sbjct: 94  LAGRTVDVYNNDIASAFRQLSSKLTANNIAVDRRTQRFYMKPGKVAELKKSQRHRR 149


>gi|145353449|ref|XP_001421025.1| Plastid ribosomal protein S21 small ribosomal subunit
          [Ostreococcus lucimarinus CCE9901]
 gi|144581261|gb|ABO99318.1| Plastid ribosomal protein S21 small ribosomal subunit
          [Ostreococcus lucimarinus CCE9901]
          Length = 108

 Score = 37.2 bits (85), Expect = 0.69,   Method: Composition-based stats.
 Identities = 11/43 (25%), Positives = 21/43 (48%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKS 67
           + N E A+R  +K +   G ++E + R ++E       R +S
Sbjct: 26 ENENAESAIRRFRKAVMSSGHIQETRRRRYFENKQDILKRKQS 68


>gi|82523789|emb|CAI78532.1| hypothetical protein [uncultured Chloroflexi bacterium]
          Length = 105

 Score = 37.2 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 29/53 (54%)

Query: 26  DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           + + +Q L+  +KK+   G+L  ++ +  +   S+ R   K ++IRR R+  R
Sbjct: 49  NESQDQLLKRFRKKVAKSGILSTVRRKRWFVSKSELRRIQKKKSIRRIRRKQR 101


>gi|109897366|ref|YP_660621.1| 30S ribosomal protein S21 [Pseudoalteromonas atlantica T6c]
 gi|332307718|ref|YP_004435569.1| ribosomal protein S21 [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|119367291|sp|Q15X21|RS21_PSEA6 RecName: Full=30S ribosomal protein S21
 gi|109699647|gb|ABG39567.1| SSU ribosomal protein S21P [Pseudoalteromonas atlantica T6c]
 gi|332175047|gb|AEE24301.1| ribosomal protein S21 [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 71

 Score = 37.2 bits (85), Expect = 0.70,   Method: Composition-based stats.
 Identities = 23/67 (34%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VR+N   + ALR  K+  +  GVL E++ R  +EKP+ +R R K+ A +R  K +
Sbjct: 1  MPIVKVRENEPFDVALRRFKRSCEKAGVLSEVRRREFFEKPTWERKRKKAAAKKRLLKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|325269557|ref|ZP_08136173.1| 30S ribosomal protein S21 [Prevotella multiformis DSM 16608]
 gi|324988176|gb|EGC20143.1| 30S ribosomal protein S21 [Prevotella multiformis DSM 16608]
          Length = 63

 Score = 37.2 bits (85), Expect = 0.71,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  ++KPS K+      A+
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRARQQFDKPSVKKRLKMEHAV 53


>gi|221106660|ref|XP_002159256.1| PREDICTED: similar to predicted protein [Hydra magnipapillata]
          Length = 85

 Score = 37.2 bits (85), Expect = 0.71,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 28/53 (52%)

Query: 17 ISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
            A  V+V       A + L K M  EG+ R+++++  YEKP+ KR RL  E 
Sbjct: 6  FRARTVMVGPQGPIVAYQNLMKIMSVEGLTRQVQLQRRYEKPTVKRHRLAYEK 58


>gi|167627837|ref|YP_001678337.1| 30S ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
 gi|167597838|gb|ABZ87836.1| ribosomal protein S21 [Francisella philomiragia subsp.
          philomiragia ATCC 25017]
          Length = 65

 Score = 37.2 bits (85), Expect = 0.71,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 30/51 (58%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           + +LR  K+  +  G+ +EL+ R  + KP+QKR   K  AI R++K  R+
Sbjct: 12 FDISLRNFKRACEKAGIKQELRDRKTFVKPTQKRKMAKKAAISRAKKEARR 62


>gi|282879916|ref|ZP_06288641.1| ribosomal protein S21 [Prevotella timonensis CRIS 5C-B1]
 gi|281306218|gb|EFA98253.1| ribosomal protein S21 [Prevotella timonensis CRIS 5C-B1]
          Length = 63

 Score = 37.2 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K    GV++EL+ R  Y+KPS  R      AI
Sbjct: 1  MIIVPVKDGENIERALKRFKRKFDKTGVIKELRARQQYDKPSVLRRLKMERAI 53


>gi|108761467|ref|YP_633354.1| 30S ribosomal protein S21 [Myxococcus xanthus DK 1622]
 gi|115375598|ref|ZP_01462855.1| ribosomal protein S21 [Stigmatella aurantiaca DW4/3-1]
 gi|310823181|ref|YP_003955539.1| 30S ribosomal protein S21 [Stigmatella aurantiaca DW4/3-1]
 gi|1350963|sp|P49225|RS21_MYXXA RecName: Full=30S ribosomal protein S21
 gi|119367276|sp|Q1D1W9|RS21_MYXXD RecName: Full=30S ribosomal protein S21
 gi|710340|gb|AAB60205.1| ribosomal protein S21 [Myxococcus xanthus]
 gi|108465347|gb|ABF90532.1| ribosomal protein S21 [Myxococcus xanthus DK 1622]
 gi|115367374|gb|EAU66352.1| ribosomal protein S21 [Stigmatella aurantiaca DW4/3-1]
 gi|309396253|gb|ADO73712.1| 30S ribosomal protein S21 [Stigmatella aurantiaca DW4/3-1]
 gi|1586809|prf||2204381A ribosomal protein S21
          Length = 64

 Score = 37.2 bits (85), Expect = 0.72,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 25/39 (64%), Gaps = 1/39 (2%)

Query: 22 VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPS 59
          + V++   +E AL+  KK  +  G+L E++ R HYEKPS
Sbjct: 4  IRVKEGESIESALKRFKKATEKAGILSEIRKREHYEKPS 42


>gi|325853537|ref|ZP_08171369.1| ribosomal protein S21 [Prevotella denticola CRIS 18C-A]
 gi|327313165|ref|YP_004328602.1| 30S ribosomal protein S21 [Prevotella denticola F0289]
 gi|325484341|gb|EGC87269.1| ribosomal protein S21 [Prevotella denticola CRIS 18C-A]
 gi|326944371|gb|AEA20256.1| ribosomal protein S21 [Prevotella denticola F0289]
          Length = 63

 Score = 37.2 bits (85), Expect = 0.75,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  ++KPS K+      A+
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRARQQFDKPSVKKRLKMEHAV 53


>gi|254517372|ref|ZP_05129429.1| ribosomal protein S21 [gamma proteobacterium NOR5-3]
 gi|219674210|gb|EED30579.1| ribosomal protein S21 [gamma proteobacterium NOR5-3]
          Length = 71

 Score = 37.2 bits (85), Expect = 0.75,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
            ++ V++N   + ALR  K+  +  GVL E++ R HYEKP+  R R  + A++R  K M
Sbjct: 1  MPHIKVKENEPFDVALRRFKRSCEKAGVLSEVRRREHYEKPTTVRKRAAAAAVKRHLKKM 60

Query: 78 RKIAQRE 84
           +  ++ 
Sbjct: 61 SRENRKR 67


>gi|325474806|gb|EGC77992.1| 30S ribosomal protein S21 [Treponema denticola F0402]
          Length = 73

 Score = 37.2 bits (85), Expect = 0.76,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           ++E+AL+  K++++ EG++RE K +  YEKPS    R      R+  K  R+
Sbjct: 14 EHLEKALKRFKRQVEKEGIIREWKKKEFYEKPSTVLNRKNKALRRKLMKKTRR 66


>gi|42527973|ref|NP_973071.1| 30S ribosomal protein S21 [Treponema denticola ATCC 35405]
 gi|61215983|sp|Q73JR1|RS21_TREDE RecName: Full=30S ribosomal protein S21
 gi|41819018|gb|AAS12990.1| ribosomal protein S21 [Treponema denticola ATCC 35405]
          Length = 69

 Score = 37.2 bits (85), Expect = 0.76,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 31/53 (58%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           ++E+AL+  K++++ EG++RE K +  YEKPS    R      R+  K  R+
Sbjct: 10 EHLEKALKRFKRQVEKEGIIREWKKKEFYEKPSTVLNRKNKALRRKLMKKTRR 62


>gi|290769957|gb|ADD61725.1| putative protein [uncultured organism]
          Length = 72

 Score = 37.2 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 18 SAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
              + V++   +E ALR  K+     GVL E++ R  YEKPS +R +    A +R  K
Sbjct: 14 KMSEIRVKEGESLESALRRFKRSTARSGVLAEVRKREAYEKPSVRRKKKSEAARKRKFK 72


>gi|255019641|ref|ZP_05291720.1| SSU ribosomal protein S21p [Acidithiobacillus caldus ATCC 51756]
 gi|254970864|gb|EET28347.1| SSU ribosomal protein S21p [Acidithiobacillus caldus ATCC 51756]
          Length = 71

 Score = 37.2 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E ALR  K+  +  GVL E++ R  YEKP+++R R  + A +R+ K M
Sbjct: 1  MPTIRVKENEPFEVALRRFKRSCEKAGVLTEVRRREFYEKPTEERKRKAAAARKRALKRM 60

Query: 78 RKIAQR 83
          R+   R
Sbjct: 61 RRQQLR 66


>gi|282601148|ref|ZP_05980908.2| ribosomal protein S21 [Subdoligranulum variabile DSM 15176]
 gi|282570013|gb|EFB75548.1| ribosomal protein S21 [Subdoligranulum variabile DSM 15176]
          Length = 74

 Score = 37.2 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 20/59 (33%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 18 SAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
              + V++   +E ALR  K+     GVL E++ R  YEKPS +R +    A +R  K
Sbjct: 16 KMSEIRVKEGESLESALRRFKRSTARSGVLAEVRKREAYEKPSVRRKKKSEAARKRKFK 74


>gi|326799799|ref|YP_004317618.1| 30S ribosomal protein S21 [Sphingobacterium sp. 21]
 gi|326550563|gb|ADZ78948.1| 30S ribosomal protein S21 [Sphingobacterium sp. 21]
          Length = 63

 Score = 37.2 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 22/53 (41%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D   +++AL+  KKK +  GVLREL+ R  YEK S  R     +AI
Sbjct: 1  MIIVNVKDGESLDKALKRFKKKFEKTGVLRELRARQAYEKKSVTRRTQIKKAI 53


>gi|218245813|ref|YP_002371184.1| 30S ribosomal protein S21 [Cyanothece sp. PCC 8801]
 gi|257058859|ref|YP_003136747.1| 30S ribosomal protein S21 [Cyanothece sp. PCC 8802]
 gi|218166291|gb|ACK65028.1| ribosomal protein S21 [Cyanothece sp. PCC 8801]
 gi|256589025|gb|ACU99911.1| ribosomal protein S21 [Cyanothece sp. PCC 8802]
          Length = 61

 Score = 37.2 bits (85), Expect = 0.77,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 27/54 (50%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           +  +E ALR  K+++   G+  ++K   H+E P +KR R      ++ R   R
Sbjct: 8  ENEGIESALRRFKRQVSKAGIFNDMKKHRHFETPIEKRKRKALAKHKQRRSNYR 61


>gi|330819198|ref|YP_004348060.1| 30S ribosomal protein S21P [Burkholderia gladioli BSR3]
 gi|327371193|gb|AEA62548.1| 30S ribosomal protein S21P [Burkholderia gladioli BSR3]
          Length = 70

 Score = 37.2 bits (85), Expect = 0.78,   Method: Composition-based stats.
 Identities = 24/64 (37%), Positives = 38/64 (59%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
              VL  D  VE ALR  ++++Q  G+++EL+ RG YEKP+ +R R  + A+ R R  +
Sbjct: 1  MTKVVLKADEPVEVALRRFRREIQKTGLIQELRARGAYEKPTTQRKRKLASAVSRQRARL 60

Query: 78 RKIA 81
          R+  
Sbjct: 61 RRAK 64


>gi|75910644|ref|YP_324940.1| 30S ribosomal protein S21 [Anabaena variabilis ATCC 29413]
 gi|119367213|sp|Q3M4P1|RS212_ANAVT RecName: Full=30S ribosomal protein S21 2
 gi|75704369|gb|ABA24045.1| SSU ribosomal protein S21P [Anabaena variabilis ATCC 29413]
          Length = 58

 Score = 37.2 bits (85), Expect = 0.79,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 30/53 (56%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          VL  +  ++ ALR  K+++   G+L ++K   H+E P ++R R    A R+ R
Sbjct: 5  VLGENEGIDSALRRFKRQVSKAGILADVKYHRHFETPLERRKRKAVAARRKRR 57


>gi|186684440|ref|YP_001867636.1| 30S ribosomal protein S21 [Nostoc punctiforme PCC 73102]
 gi|186466892|gb|ACC82693.1| ribosomal protein S21 [Nostoc punctiforme PCC 73102]
          Length = 59

 Score = 37.2 bits (85), Expect = 0.79,   Method: Composition-based stats.
 Identities = 15/49 (30%), Positives = 27/49 (55%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRS 73
           +  ++ ALR  K+++   G+L ++K   H+E P +KR R    A R+ 
Sbjct: 8  ENEAIDSALRRFKRQVSKAGILADVKYHRHFETPIEKRKRKAVAARRKR 56


>gi|299144164|ref|ZP_07037244.1| ribosomal protein S21 [Peptoniphilus sp. oral taxon 386 str.
          F0131]
 gi|298518649|gb|EFI42388.1| ribosomal protein S21 [Peptoniphilus sp. oral taxon 386 str.
          F0131]
          Length = 60

 Score = 37.2 bits (85), Expect = 0.80,   Method: Composition-based stats.
 Identities = 18/52 (34%), Positives = 30/52 (57%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
           + +++ AL+  K++    GVL+E + R HYEKPS +R +   EA R+    
Sbjct: 8  ENESLDNALKRFKRQCATSGVLKEARKREHYEKPSVRRKKKSEEARRKKHSR 59


>gi|116333391|ref|YP_794918.1| ribosomal protein S21 [Lactobacillus brevis ATCC 367]
 gi|122269922|sp|Q03SD5|RS21_LACBA RecName: Full=30S ribosomal protein S21
 gi|116098738|gb|ABJ63887.1| SSU ribosomal protein S21P [Lactobacillus brevis ATCC 367]
          Length = 62

 Score = 37.2 bits (85), Expect = 0.81,   Method: Composition-based stats.
 Identities = 16/48 (33%), Positives = 26/48 (54%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRL 65
           A  V+ ++ + + ALR  K+ +   G L+E + R  YEKPS K+   
Sbjct: 1  MAKTVVRKNESFDDALRRFKRTVSRSGTLQEYRKREFYEKPSVKKKLK 48


>gi|299141120|ref|ZP_07034257.1| ribosomal protein S21 [Prevotella oris C735]
 gi|298577080|gb|EFI48949.1| ribosomal protein S21 [Prevotella oris C735]
          Length = 63

 Score = 37.2 bits (85), Expect = 0.82,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  Y KPS  +      AI
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRARQQYNKPSVLKRLKMEHAI 53


>gi|195638932|gb|ACG38934.1| hypothetical protein [Zea mays]
          Length = 111

 Score = 37.2 bits (85), Expect = 0.82,   Method: Composition-based stats.
 Identities = 23/73 (31%), Positives = 42/73 (57%), Gaps = 1/73 (1%)

Query: 13  EGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHY-EKPSQKRVRLKSEAIR 71
           + ++   + V VRD N+E+AL +++++M+  G+ R ++ R HY  K S+KRV  +   ++
Sbjct: 30  QVQQPRGIVVQVRDGNLERALSIMERRMRSSGMERXIRARTHYHVKDSEKRVLARKGLMQ 89

Query: 72  RSRKLMRKIAQRE 84
           R R        RE
Sbjct: 90  RVRSQELGKKLRE 102


>gi|294056011|ref|YP_003549669.1| ribosomal protein S21 [Coraliomargarita akajimensis DSM 45221]
 gi|293615344|gb|ADE55499.1| ribosomal protein S21 [Coraliomargarita akajimensis DSM 45221]
          Length = 66

 Score = 37.2 bits (85), Expect = 0.83,   Method: Composition-based stats.
 Identities = 22/52 (42%), Positives = 34/52 (65%), Gaps = 1/52 (1%)

Query: 18 SAVYVLVRDNNV-EQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSE 68
           A+ V VR     E+ALR LKK++  EGV+R+++ + ++EKPSQ + R   E
Sbjct: 1  MAIEVKVRKGEPAERALRRLKKRLDREGVIRDVRAKRYFEKPSQAKRRKNKE 52


>gi|291515881|emb|CBK65091.1| SSU ribosomal protein S21P [Alistipes shahii WAL 8301]
          Length = 63

 Score = 37.2 bits (85), Expect = 0.83,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + + V++  N+E+AL+  K+K +  GVL+EL+ R ++ KPS  +      AI
Sbjct: 1  MIIMPVKEGENIERALKKFKRKYERTGVLKELRRRQYFTKPSIAKREAMQHAI 53


>gi|302345051|ref|YP_003813404.1| ribosomal protein S21 [Prevotella melaninogenica ATCC 25845]
 gi|302148972|gb|ADK95234.1| ribosomal protein S21 [Prevotella melaninogenica ATCC 25845]
          Length = 63

 Score = 37.2 bits (85), Expect = 0.83,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  ++KPS K+      A+
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRARQQFDKPSVKKRLKMERAV 53


>gi|88704604|ref|ZP_01102317.1| 30S ribosomal protein S21 [Congregibacter litoralis KT71]
 gi|88700925|gb|EAQ98031.1| 30S ribosomal protein S21 [Congregibacter litoralis KT71]
          Length = 71

 Score = 37.2 bits (85), Expect = 0.83,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
            ++ V++N   + ALR  K+  +  GVL E++ R HYEKP+  R R  + A++R  K +
Sbjct: 1  MPHIKVKENEPFDVALRRFKRSCEKAGVLSEVRRREHYEKPTTVRKRAAAAAVKRHLKKI 60

Query: 78 RKIAQRE 84
           +  ++ 
Sbjct: 61 SRENRKR 67


>gi|255692651|ref|ZP_05416326.1| ribosomal protein S21 [Bacteroides finegoldii DSM 17565]
 gi|260621627|gb|EEX44498.1| ribosomal protein S21 [Bacteroides finegoldii DSM 17565]
          Length = 63

 Score = 37.2 bits (85), Expect = 0.83,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  G+++EL+ R  ++KPS  +   K  A+
Sbjct: 1  MIVVPVKEGENIEKALKKFKRKFEKTGIVKELRSRQQFDKPSVTKRLKKERAV 53


>gi|224541754|ref|ZP_03682293.1| hypothetical protein CATMIT_00926 [Catenibacterium mitsuokai DSM
          15897]
 gi|224525358|gb|EEF94463.1| hypothetical protein CATMIT_00926 [Catenibacterium mitsuokai DSM
          15897]
          Length = 61

 Score = 37.2 bits (85), Expect = 0.85,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 29/61 (47%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           A  V+  + +++ ALR  K+++   G L E + R  Y KP  KR      A +  +K  
Sbjct: 1  MAKTVVRENESLDDALRRFKRQVSRTGTLAEARKREFYVKPGLKRKMKSEAARKNQKKRR 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|254491032|ref|ZP_05104213.1| ribosomal protein S21 [Methylophaga thiooxidans DMS010]
 gi|224463545|gb|EEF79813.1| ribosomal protein S21 [Methylophaga thiooxydans DMS010]
          Length = 71

 Score = 37.2 bits (85), Expect = 0.87,   Method: Composition-based stats.
 Identities = 19/63 (30%), Positives = 33/63 (52%), Gaps = 1/63 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+  +  G + E + R  YEKP+  R R  + A++R +K +
Sbjct: 1  MPAVRVKENEPFDVALRRFKRACEKAGTVAEARAREAYEKPTTVRKRAAAAAVKRHQKKL 60

Query: 78 RKI 80
           + 
Sbjct: 61 SRE 63


>gi|254414564|ref|ZP_05028330.1| ribosomal protein S21 [Microcoleus chthonoplastes PCC 7420]
 gi|196178794|gb|EDX73792.1| ribosomal protein S21 [Microcoleus chthonoplastes PCC 7420]
          Length = 63

 Score = 37.2 bits (85), Expect = 0.87,   Method: Composition-based stats.
 Identities = 11/42 (26%), Positives = 21/42 (50%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLK 66
           +  +E  LR  K+K+   G+  ++K    +E P +K  R +
Sbjct: 8  ENEGIESGLRRFKRKVSRAGIFSDMKKNRFFETPLEKHKRKE 49


>gi|158338652|ref|YP_001519829.1| 30S ribosomal protein S21 [Acaryochloris marina MBIC11017]
 gi|189044888|sp|B0CE36|RS21_ACAM1 RecName: Full=30S ribosomal protein S21
 gi|158308893|gb|ABW30510.1| 30S ribosomal protein S21 [Acaryochloris marina MBIC11017]
          Length = 59

 Score = 37.2 bits (85), Expect = 0.87,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 31/53 (58%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          VL  D  +E ALR  K+++   G+L ++K R H+E P +K+ R +    R+ R
Sbjct: 5  VLGEDEGIESALRRFKRQVSKAGILADVKRRRHFETPLEKKKRKRIATRRKRR 57


>gi|160883083|ref|ZP_02064086.1| hypothetical protein BACOVA_01051 [Bacteroides ovatus ATCC 8483]
 gi|167764389|ref|ZP_02436514.1| hypothetical protein BACSTE_02777 [Bacteroides stercoris ATCC
          43183]
 gi|237717382|ref|ZP_04547863.1| 30S ribosomal protein S21 [Bacteroides sp. D1]
 gi|237718761|ref|ZP_04549242.1| 30S ribosomal protein S21 [Bacteroides sp. 2_2_4]
 gi|253569573|ref|ZP_04846983.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|260175399|ref|ZP_05761811.1| 30S ribosomal protein S21 [Bacteroides sp. D2]
 gi|262406147|ref|ZP_06082697.1| ribosomal protein S21 [Bacteroides sp. 2_1_22]
 gi|293372136|ref|ZP_06618527.1| ribosomal protein S21 [Bacteroides ovatus SD CMC 3f]
 gi|294644042|ref|ZP_06721819.1| ribosomal protein S21 [Bacteroides ovatus SD CC 2a]
 gi|294810194|ref|ZP_06768861.1| ribosomal protein S21 [Bacteroides xylanisolvens SD CC 1b]
 gi|298386164|ref|ZP_06995721.1| ribosomal protein S21 [Bacteroides sp. 1_1_14]
 gi|298483047|ref|ZP_07001228.1| ribosomal protein S21 [Bacteroides sp. D22]
 gi|299144640|ref|ZP_07037708.1| ribosomal protein S21 [Bacteroides sp. 3_1_23]
 gi|315923629|ref|ZP_07919869.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|317476382|ref|ZP_07935631.1| ribosomal protein S21 [Bacteroides eggerthii 1_2_48FAA]
 gi|329956680|ref|ZP_08297253.1| ribosomal protein S21 [Bacteroides clarus YIT 12056]
 gi|156111555|gb|EDO13300.1| hypothetical protein BACOVA_01051 [Bacteroides ovatus ATCC 8483]
 gi|167697794|gb|EDS14373.1| hypothetical protein BACSTE_02777 [Bacteroides stercoris ATCC
          43183]
 gi|229443365|gb|EEO49156.1| 30S ribosomal protein S21 [Bacteroides sp. D1]
 gi|229451893|gb|EEO57684.1| 30S ribosomal protein S21 [Bacteroides sp. 2_2_4]
 gi|251841592|gb|EES69673.1| conserved hypothetical protein [Bacteroides sp. 1_1_6]
 gi|262357022|gb|EEZ06112.1| ribosomal protein S21 [Bacteroides sp. 2_1_22]
 gi|292632928|gb|EFF51515.1| ribosomal protein S21 [Bacteroides ovatus SD CMC 3f]
 gi|292640566|gb|EFF58807.1| ribosomal protein S21 [Bacteroides ovatus SD CC 2a]
 gi|294442606|gb|EFG11406.1| ribosomal protein S21 [Bacteroides xylanisolvens SD CC 1b]
 gi|295085444|emb|CBK66967.1| SSU ribosomal protein S21P [Bacteroides xylanisolvens XB1A]
 gi|298261392|gb|EFI04259.1| ribosomal protein S21 [Bacteroides sp. 1_1_14]
 gi|298270791|gb|EFI12371.1| ribosomal protein S21 [Bacteroides sp. D22]
 gi|298515131|gb|EFI39012.1| ribosomal protein S21 [Bacteroides sp. 3_1_23]
 gi|313697504|gb|EFS34339.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|316907408|gb|EFV29113.1| ribosomal protein S21 [Bacteroides eggerthii 1_2_48FAA]
 gi|322518745|gb|ADX07087.1| putative ribosomal protein S21 [Bacteroides thetaiotaomicron
          VPI-5482]
 gi|328524052|gb|EGF51128.1| ribosomal protein S21 [Bacteroides clarus YIT 12056]
          Length = 63

 Score = 37.2 bits (85), Expect = 0.87,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  G+++EL+ R  ++KPS  +   K  A+
Sbjct: 1  MIVVPVKEGENIEKALKKFKRKFEKTGIVKELRSRQQFDKPSVTKRLKKERAV 53


>gi|224537799|ref|ZP_03678338.1| hypothetical protein BACCELL_02682 [Bacteroides cellulosilyticus
          DSM 14838]
 gi|224520619|gb|EEF89724.1| hypothetical protein BACCELL_02682 [Bacteroides cellulosilyticus
          DSM 14838]
          Length = 63

 Score = 37.2 bits (85), Expect = 0.90,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  G+++EL+ R  ++KPS  +   K  A+
Sbjct: 1  MIVVPVKEGENIEKALKKFKRKFEKTGIVKELRSRQQFDKPSVVKRLKKERAV 53


>gi|225076627|ref|ZP_03719826.1| hypothetical protein NEIFLAOT_01677 [Neisseria flavescens
          NRL30031/H210]
 gi|241758584|ref|ZP_04756699.1| ribosomal protein S21 [Neisseria flavescens SK114]
 gi|261379902|ref|ZP_05984475.1| ribosomal protein S21 [Neisseria subflava NJ9703]
 gi|319637859|ref|ZP_07992625.1| 30S ribosomal protein S21 [Neisseria mucosa C102]
 gi|224952033|gb|EEG33242.1| hypothetical protein NEIFLAOT_01677 [Neisseria flavescens
          NRL30031/H210]
 gi|241321236|gb|EER57408.1| ribosomal protein S21 [Neisseria flavescens SK114]
 gi|284797605|gb|EFC52952.1| ribosomal protein S21 [Neisseria subflava NJ9703]
 gi|317401014|gb|EFV81669.1| 30S ribosomal protein S21 [Neisseria mucosa C102]
          Length = 70

 Score = 36.8 bits (84), Expect = 0.91,   Method: Composition-based stats.
 Identities = 22/61 (36%), Positives = 37/61 (60%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   E A+R  K+ ++  G+L EL+ R  YEKP+ +R R K+ A +R +K +
Sbjct: 1  MPAIRVKENEPFEVAMRRFKRAVEKTGLLTELRAREAYEKPTTERKRKKAAAAKRLQKRL 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|254410640|ref|ZP_05024419.1| ribosomal protein S21 [Microcoleus chthonoplastes PCC 7420]
 gi|196182846|gb|EDX77831.1| ribosomal protein S21 [Microcoleus chthonoplastes PCC 7420]
          Length = 67

 Score = 36.8 bits (84), Expect = 0.91,   Method: Composition-based stats.
 Identities = 18/55 (32%), Positives = 29/55 (52%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQR 83
          +E ALR  K+ +   G+  ++K   H+E P QKR R      ++ R+L R   +R
Sbjct: 12 IESALRRFKQAVSKAGIFPDMKKHRHFETPIQKRKRKAIARHKQLRRLSRYRKKR 66


>gi|113868686|ref|YP_727175.1| SSU ribosomal protein S21 [Ralstonia eutropha H16]
 gi|113527462|emb|CAJ93807.1| SSU ribosomal protein S21 [Ralstonia eutropha H16]
          Length = 70

 Score = 36.8 bits (84), Expect = 0.93,   Method: Composition-based stats.
 Identities = 21/69 (30%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + +++N   E A+R  K+ ++  G+L EL+ R  YEKP+  R R K+ A +R  K +
Sbjct: 1  MTTIRLKENEPFEVAMRRFKRTIEKNGLLPELRAREFYEKPTAARKRRKAAAEKRHYKRI 60

Query: 78 RKIAQREGA 86
          R     +  
Sbjct: 61 RSQMLPKKL 69


>gi|325299602|ref|YP_004259519.1| 30S ribosomal protein S21 [Bacteroides salanitronis DSM 18170]
 gi|324319155|gb|ADY37046.1| 30S ribosomal protein S21 [Bacteroides salanitronis DSM 18170]
          Length = 63

 Score = 36.8 bits (84), Expect = 0.95,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  GV++EL+ R  Y+KPS  +      AI
Sbjct: 1  MIVVPVKEGENIEKALKKFKRKFEKTGVVKELRRRQQYDKPSVLKRLKMEHAI 53


>gi|114704725|ref|ZP_01437633.1| 30S ribosomal protein S21 [Fulvimarina pelagi HTCC2506]
 gi|114539510|gb|EAU42630.1| 30S ribosomal protein S21 [Fulvimarina pelagi HTCC2506]
          Length = 46

 Score = 36.8 bits (84), Expect = 0.98,   Method: Composition-based stats.
 Identities = 26/44 (59%), Positives = 30/44 (68%)

Query: 49 LKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLR 92
          +K R  YEKPS++R R K EA+RRSRKL RK AQREG      R
Sbjct: 1  MKARRSYEKPSEERARRKQEAVRRSRKLARKQAQREGLLPKSGR 44


>gi|317504009|ref|ZP_07962016.1| 30S ribosomal protein S21 [Prevotella salivae DSM 15606]
 gi|315664869|gb|EFV04529.1| 30S ribosomal protein S21 [Prevotella salivae DSM 15606]
          Length = 63

 Score = 36.8 bits (84), Expect = 0.98,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  Y KPS  +      A+
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRARQQYNKPSVLKRLKMEHAV 53


>gi|220906553|ref|YP_002481864.1| 30S ribosomal protein S21 [Cyanothece sp. PCC 7425]
 gi|219863164|gb|ACL43503.1| ribosomal protein S21 [Cyanothece sp. PCC 7425]
          Length = 61

 Score = 36.8 bits (84), Expect = 0.98,   Method: Composition-based stats.
 Identities = 14/50 (28%), Positives = 27/50 (54%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
          +E ALR  K+++   G+  +++   H+E P +KR R      ++ R+  R
Sbjct: 12 IESALRRFKREVAKAGIFPDMRKHRHFETPIEKRKRKALAKQKQRRRFQR 61


>gi|300870158|ref|YP_003785029.1| 30S ribosomal protein S21 [Brachyspira pilosicoli 95/1000]
 gi|300687857|gb|ADK30528.1| 30S ribosomal protein S21 [Brachyspira pilosicoli 95/1000]
          Length = 69

 Score = 36.8 bits (84), Expect = 0.99,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 35/54 (64%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQ 82
          VE  ++  ++  + EG+L+ELK +  Y+KPS ++   + +A++R ++ ++K  +
Sbjct: 12 VESVIKRFRRACENEGILQELKEKQFYKKPSLEKKLQREKALKRMKRKIKKERR 65


>gi|167562018|ref|ZP_02354934.1| ribosomal protein S21 [Burkholderia oklahomensis EO147]
 gi|167569270|ref|ZP_02362144.1| ribosomal protein S21 [Burkholderia oklahomensis C6786]
          Length = 70

 Score = 36.8 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 34/56 (60%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
          +  ++  LR  +++++  G++REL+ R  YEKP+  R R K+ A+ R R  +++  
Sbjct: 9  NEPIDVTLRRFRREIERVGLIRELRDRRSYEKPTAMRKRKKASAVARQRARLKRSM 64


>gi|148266062|ref|YP_001232768.1| 30S ribosomal protein S21 [Geobacter uraniireducens Rf4]
 gi|197120059|ref|YP_002140486.1| 30S ribosomal protein S21 [Geobacter bemidjiensis Bem]
 gi|253702381|ref|YP_003023570.1| 30S ribosomal protein S21 [Geobacter sp. M21]
 gi|322421615|ref|YP_004200838.1| 30S ribosomal protein S21 [Geobacter sp. M18]
 gi|189044902|sp|A5G8S7|RS21_GEOUR RecName: Full=30S ribosomal protein S21
 gi|226695012|sp|B5EDR2|RS21_GEOBB RecName: Full=30S ribosomal protein S21
 gi|259494887|sp|C6E7F2|RS21_GEOSM RecName: Full=30S ribosomal protein S21
 gi|146399562|gb|ABQ28195.1| SSU ribosomal protein S21P [Geobacter uraniireducens Rf4]
 gi|197089419|gb|ACH40690.1| ribosomal protein S21 [Geobacter bemidjiensis Bem]
 gi|251777231|gb|ACT19812.1| ribosomal protein S21 [Geobacter sp. M21]
 gi|320128002|gb|ADW15562.1| ribosomal protein S21 [Geobacter sp. M18]
          Length = 65

 Score = 36.8 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 36/60 (60%), Gaps = 1/60 (1%)

Query: 22 VLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
          V V++    E AL+  KK+ +  G+L E++ R HYEKPS K+ +    A +R+ K  RK+
Sbjct: 4  VKVKEAEPFELALKKFKKQCEKAGILSEVRKREHYEKPSIKKKKKAIAARKRALKKQRKM 63


>gi|154498313|ref|ZP_02036691.1| hypothetical protein BACCAP_02302 [Bacteroides capillosus ATCC
          29799]
 gi|150272624|gb|EDM99802.1| hypothetical protein BACCAP_02302 [Bacteroides capillosus ATCC
          29799]
          Length = 60

 Score = 36.8 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 19/58 (32%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             V V++   +E AL+  K+     GVL E++ R  YE PS KR +    A +  +K
Sbjct: 1  MSEVRVKEGESLENALKRFKRNCAKSGVLAEVRKRECYESPSVKRRKKSEAARKNRKK 58


>gi|114778495|ref|ZP_01453339.1| ribosomal protein S21 [Mariprofundus ferrooxydans PV-1]
 gi|114551220|gb|EAU53779.1| ribosomal protein S21 [Mariprofundus ferrooxydans PV-1]
          Length = 74

 Score = 36.8 bits (84), Expect = 1.0,   Method: Composition-based stats.
 Identities = 19/56 (33%), Positives = 33/56 (58%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           E AL+  +K+++  GV+ + + R  YEKPS    R ++ A +R  K +R++  RE
Sbjct: 15 FEIALKRFRKQVEKGGVIADCRRREAYEKPSIASKRKEAAARKRLMKRLRRVRMRE 70


>gi|313159796|gb|EFR59152.1| ribosomal protein S21 [Alistipes sp. HGB5]
          Length = 63

 Score = 36.8 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 18/44 (40%), Positives = 28/44 (63%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           N+E+AL+  K+K +  GVL+EL+ R ++ KPS  +   K  AI
Sbjct: 10 ENIERALKKFKRKYERTGVLKELRRRQYFTKPSIAKRVAKQHAI 53


>gi|308050976|ref|YP_003914542.1| 30S ribosomal protein S21P [Ferrimonas balearica DSM 9799]
 gi|307633166|gb|ADN77468.1| SSU ribosomal protein S21P [Ferrimonas balearica DSM 9799]
          Length = 71

 Score = 36.8 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 24/67 (35%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  GVL E++ R HYEKP+  R R K+ A +R  K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGVLSEVRRREHYEKPTTARKRAKAAASKRQAKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARENARR 67


>gi|172038016|ref|YP_001804517.1| 30S ribosomal protein S21 [Cyanothece sp. ATCC 51142]
 gi|171699470|gb|ACB52451.1| 30S ribosomal protein S21 [Cyanothece sp. ATCC 51142]
          Length = 62

 Score = 36.8 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 29/55 (52%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           +  +E ALR  K+++   G+  ++K   H+E P +KR R      R+ ++  RK
Sbjct: 8  ENEGIESALRRFKRQVSKAGIFYDMKKNRHFETPIEKRKRKALAKQRQRKRSYRK 62


>gi|119486639|ref|ZP_01620689.1| Ribosomal protein S21 [Lyngbya sp. PCC 8106]
 gi|119456256|gb|EAW37388.1| Ribosomal protein S21 [Lyngbya sp. PCC 8106]
          Length = 65

 Score = 36.8 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 15/55 (27%), Positives = 31/55 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           +  +E ALR  K+++   G+L +++ + H+E P ++R R      R+ R + +K
Sbjct: 8  ENEQLESALRRFKREVSKAGILADVRKKRHFETPPERRKRKAIANQRQRRAMRKK 62


>gi|113477989|ref|YP_724050.1| 30S ribosomal protein S21 [Trichodesmium erythraeum IMS101]
 gi|119367340|sp|Q10VZ7|RS21_TRIEI RecName: Full=30S ribosomal protein S21
 gi|110169037|gb|ABG53577.1| SSU ribosomal protein S21P [Trichodesmium erythraeum IMS101]
          Length = 62

 Score = 36.8 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 28/54 (51%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           +  +E ALR  K+++   G+  ++K   H+E P +KR R      ++ ++  R
Sbjct: 8  ENEGIESALRRFKRQVSQAGIFPDMKKHRHFETPIEKRKRKAMALQKQRKRRSR 61


>gi|187250729|ref|YP_001875211.1| 30S ribosomal protein S21 [Elusimicrobium minutum Pei191]
 gi|226695008|sp|B2KBX0|RS21_ELUMP RecName: Full=30S ribosomal protein S21
 gi|186970889|gb|ACC97874.1| ribosomal protein S21 [Elusimicrobium minutum Pei191]
          Length = 64

 Score = 36.8 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 32/52 (61%), Gaps = 1/52 (1%)

Query: 19 AVYVLVRD-NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
           V+V VRD  ++E+AL+  K++ +  G+L+E+K R  Y  PS KR     EA
Sbjct: 1  MVFVKVRDAEHLEEALKRFKRECEKNGILKEIKRRETYMPPSVKRKIKSQEA 52


>gi|218515274|ref|ZP_03512114.1| 30S ribosomal protein S21 [Rhizobium etli 8C-3]
          Length = 49

 Score = 36.8 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 25/44 (56%), Positives = 29/44 (65%)

Query: 49 LKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLR 92
          +K R  YEKPS+KR R K EAIRR RKL RK  QREG   +  +
Sbjct: 1  MKARSAYEKPSEKRAREKGEAIRRQRKLARKKLQREGLLPAPKK 44


>gi|126658058|ref|ZP_01729210.1| 30S ribosomal protein S21 [Cyanothece sp. CCY0110]
 gi|126620696|gb|EAZ91413.1| 30S ribosomal protein S21 [Cyanothece sp. CCY0110]
          Length = 62

 Score = 36.8 bits (84), Expect = 1.1,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 29/55 (52%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           +  +E ALR  K+++   G+  ++K   H+E P +KR R      R+ ++  RK
Sbjct: 8  ENEGIESALRRFKRQVSKAGIFYDMKKNRHFETPIEKRKRKAIAKQRQRKRSYRK 62


>gi|221198546|ref|ZP_03571591.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2M]
 gi|221207775|ref|ZP_03580782.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2]
 gi|221215722|ref|ZP_03588683.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD1]
 gi|221164424|gb|EED96909.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD1]
 gi|221172272|gb|EEE04712.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2]
 gi|221180997|gb|EEE13399.1| 30S ribosomal protein S21 [Burkholderia multivorans CGD2M]
          Length = 70

 Score = 36.8 bits (84), Expect = 1.2,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 27/42 (64%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKS 67
          +  ++ ALR  ++ ++  G++REL+ R  YEKP+  R R K+
Sbjct: 9  NEPIDVALRRFRRDIEKTGLIRELRSRTSYEKPTAMRKRKKA 50


>gi|17228338|ref|NP_484886.1| 30S ribosomal protein S21 [Nostoc sp. PCC 7120]
 gi|20978595|sp|Q8YYK5|RS21B_ANASP RecName: Full=30S ribosomal protein S21 B
 gi|17130188|dbj|BAB72800.1| 30S ribosomal protein S21 [Nostoc sp. PCC 7120]
          Length = 58

 Score = 36.8 bits (84), Expect = 1.2,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 29/53 (54%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          VL     ++ ALR  K+++   G+L ++K   H+E P ++R R    A R+ R
Sbjct: 5  VLGEHEGIDSALRRFKRQVSKAGILADVKYHRHFETPLERRKRKAVAARRKRR 57


>gi|110678379|ref|YP_681386.1| hypothetical protein RD1_1036 [Roseobacter denitrificans OCh 114]
 gi|109454495|gb|ABG30700.1| hypothetical protein RD1_1036 [Roseobacter denitrificans OCh 114]
          Length = 39

 Score = 36.8 bits (84), Expect = 1.2,   Method: Composition-based stats.
 Identities = 24/37 (64%), Positives = 32/37 (86%)

Query: 49 LKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREG 85
          +K++ H+EKPS+K+ R K+EAIRR+RKL RK AQREG
Sbjct: 1  MKLKQHFEKPSEKKAREKAEAIRRARKLARKKAQREG 37


>gi|222053798|ref|YP_002536160.1| ribosomal protein S21 [Geobacter sp. FRC-32]
 gi|254807393|sp|B9M0M2|RS21_GEOSF RecName: Full=30S ribosomal protein S21
 gi|221563087|gb|ACM19059.1| ribosomal protein S21 [Geobacter sp. FRC-32]
          Length = 65

 Score = 36.4 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 21/52 (40%), Positives = 32/52 (61%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
           E AL+  KK+ +  G+L E++ R HYEKPS K+ +    A +R+ K  RK+
Sbjct: 12 FELALKKFKKQCEKAGILSEVRKREHYEKPSIKKKKKAIAARKRALKKQRKM 63


>gi|298250079|ref|ZP_06973883.1| ribosomal protein S21 [Ktedonobacter racemifer DSM 44963]
 gi|297548083|gb|EFH81950.1| ribosomal protein S21 [Ktedonobacter racemifer DSM 44963]
          Length = 60

 Score = 36.4 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 15/42 (35%), Positives = 23/42 (54%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKS 67
          D++ E AL+   +K+Q  G L E + R  YE P ++R R   
Sbjct: 9  DDSFEFALKRFSRKVQQAGTLAEARRRRFYESPQERRKRKAE 50


>gi|327398489|ref|YP_004339358.1| 30S ribosomal protein S21 [Hippea maritima DSM 10411]
 gi|327181118|gb|AEA33299.1| 30S ribosomal protein S21 [Hippea maritima DSM 10411]
          Length = 66

 Score = 36.4 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 17/39 (43%), Positives = 26/39 (66%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
          ++  D N E+AL+  KK+ +  G+L E+K R  YEKPS+
Sbjct: 5  IVREDENFEEALKRFKKQCERAGILSEIKKRERYEKPSE 43


>gi|218962083|ref|YP_001741858.1| 30S ribosomal subunit protein S21 [Candidatus Cloacamonas
          acidaminovorans]
 gi|167730740|emb|CAO81652.1| 30S ribosomal subunit protein S21 [Candidatus Cloacamonas
          acidaminovorans]
          Length = 72

 Score = 36.4 bits (83), Expect = 1.2,   Method: Composition-based stats.
 Identities = 18/61 (29%), Positives = 33/61 (54%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
          V   + + +  L+  KKK +   +L E+K    YEKPS ++ R  + A R+  K+ R++ 
Sbjct: 9  VAKENESFDLLLKRFKKKCEKAAILSEIKKNQAYEKPSVRKKREANVARRKMLKMQRRMQ 68

Query: 82 Q 82
          +
Sbjct: 69 R 69


>gi|150015724|ref|YP_001307978.1| 30S ribosomal protein S21 [Clostridium beijerinckii NCIMB 8052]
 gi|149902189|gb|ABR33022.1| ribosomal protein S21 [Clostridium beijerinckii NCIMB 8052]
          Length = 58

 Score = 36.4 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 29/51 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           +  +E ALR  K+K    GVL E++ R HYEKPS K+ +    A +R  K
Sbjct: 8  ENETLESALRRFKRKCARAGVLSEVRKREHYEKPSVKKKKKSEAARKRKFK 58


>gi|325290535|ref|YP_004266716.1| SSU ribosomal protein S21P [Syntrophobotulus glycolicus DSM 8271]
 gi|324965936|gb|ADY56715.1| SSU ribosomal protein S21P [Syntrophobotulus glycolicus DSM 8271]
          Length = 58

 Score = 36.4 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 18/48 (37%), Positives = 28/48 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRR 72
          ++ +++ ALR  K+  Q  GVL E +   HYEKPS K+ +    A +R
Sbjct: 8  KNESLDAALRRFKRNCQRSGVLSEARKHEHYEKPSVKKKKKSEAARKR 55


>gi|284035038|ref|YP_003384968.1| ribosomal protein S21 [Spirosoma linguale DSM 74]
 gi|283814331|gb|ADB36169.1| ribosomal protein S21 [Spirosoma linguale DSM 74]
          Length = 65

 Score = 36.4 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 21/57 (36%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           + + V+DN  +++AL+  KKK +  GVLR+L+ R  ++KPS KR     +A  + R
Sbjct: 1  MLIINVKDNESIDKALKRFKKKFEKTGVLRQLRSRTAFQKPSVKRRTEIIKAAYKER 57


>gi|120553594|ref|YP_957945.1| 30S ribosomal protein S21 [Marinobacter aquaeolei VT8]
 gi|149376141|ref|ZP_01893906.1| 30S ribosomal protein S21 [Marinobacter algicola DG893]
 gi|166224040|sp|A1TYD9|RS21_MARAV RecName: Full=30S ribosomal protein S21
 gi|120323443|gb|ABM17758.1| SSU ribosomal protein S21P [Marinobacter aquaeolei VT8]
 gi|149359546|gb|EDM48005.1| 30S ribosomal protein S21 [Marinobacter algicola DG893]
          Length = 71

 Score = 36.4 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 22/66 (33%), Positives = 38/66 (57%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+  +  GVL E++ R HYEKP+  R R  + A++R  K +
Sbjct: 1  MPAVKVKENEPFDVALRRFKRSCEKAGVLSEVRRREHYEKPTAVRKRKAAAAVKRHLKKL 60

Query: 78 RKIAQR 83
          ++  ++
Sbjct: 61 QREQRK 66


>gi|148380905|ref|YP_001255446.1| ribosomal protein S21 [Clostridium botulinum A str. ATCC 3502]
 gi|153931711|ref|YP_001385213.1| 30S ribosomal protein S21 [Clostridium botulinum A str. ATCC
          19397]
 gi|153936658|ref|YP_001388682.1| 30S ribosomal protein S21 [Clostridium botulinum A str. Hall]
 gi|153941305|ref|YP_001392230.1| 30S ribosomal protein S21 [Clostridium botulinum F str.
          Langeland]
 gi|168179384|ref|ZP_02614048.1| ribosomal protein S21 [Clostridium botulinum NCTC 2916]
 gi|168181639|ref|ZP_02616303.1| 30S ribosomal protein S21 [Clostridium botulinum Bf]
 gi|170757467|ref|YP_001782586.1| 30S ribosomal protein S21 [Clostridium botulinum B1 str. Okra]
 gi|170760351|ref|YP_001788266.1| 30S ribosomal protein S21 [Clostridium botulinum A3 str. Loch
          Maree]
 gi|187778466|ref|ZP_02994939.1| hypothetical protein CLOSPO_02060 [Clostridium sporogenes ATCC
          15579]
 gi|226950379|ref|YP_002805470.1| ribosomal protein S21 [Clostridium botulinum A2 str. Kyoto]
 gi|237796406|ref|YP_002863958.1| 30S ribosomal protein S21 [Clostridium botulinum Ba4 str. 657]
 gi|166224023|sp|A7FXK9|RS21_CLOB1 RecName: Full=30S ribosomal protein S21
 gi|166224024|sp|A5I634|RS21_CLOBH RecName: Full=30S ribosomal protein S21
 gi|166224025|sp|A7GHH0|RS21_CLOBL RecName: Full=30S ribosomal protein S21
 gi|226694992|sp|B1ILL7|RS21_CLOBK RecName: Full=30S ribosomal protein S21
 gi|226694993|sp|B1KZN1|RS21_CLOBM RecName: Full=30S ribosomal protein S21
 gi|254813609|sp|C1FVT4|RS21_CLOBJ RecName: Full=30S ribosomal protein S21
 gi|259494879|sp|C3L3G1|RS21_CLOB6 RecName: Full=30S ribosomal protein S21
 gi|148290389|emb|CAL84516.1| 30S ribosomal protein S21 [Clostridium botulinum A str. ATCC
          3502]
 gi|152927755|gb|ABS33255.1| 30S ribosomal protein S21 [Clostridium botulinum A str. ATCC
          19397]
 gi|152932572|gb|ABS38071.1| 30S ribosomal protein S21 [Clostridium botulinum A str. Hall]
 gi|152937201|gb|ABS42699.1| 30S ribosomal protein S21 [Clostridium botulinum F str.
          Langeland]
 gi|169122679|gb|ACA46515.1| 30S ribosomal protein S21 [Clostridium botulinum B1 str. Okra]
 gi|169407340|gb|ACA55751.1| 30S ribosomal protein S21 [Clostridium botulinum A3 str. Loch
          Maree]
 gi|182669552|gb|EDT81528.1| ribosomal protein S21 [Clostridium botulinum NCTC 2916]
 gi|182675229|gb|EDT87190.1| 30S ribosomal protein S21 [Clostridium botulinum Bf]
 gi|187772091|gb|EDU35893.1| hypothetical protein CLOSPO_02060 [Clostridium sporogenes ATCC
          15579]
 gi|226841360|gb|ACO84026.1| ribosomal protein S21 [Clostridium botulinum A2 str. Kyoto]
 gi|229262911|gb|ACQ53944.1| 30S ribosomal protein S21 [Clostridium botulinum Ba4 str. 657]
 gi|295320228|gb|ADG00606.1| 30S ribosomal protein S21 [Clostridium botulinum F str. 230613]
 gi|322807270|emb|CBZ04844.1| SSU ribosomal protein S21p [Clostridium botulinum H04402 065]
          Length = 58

 Score = 36.4 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 30/51 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           + ++E ALR  KKK    GVL E++ R HYEKPS K+ +    A +R  K
Sbjct: 8  ENESLENALRRFKKKCARAGVLSEVRKREHYEKPSVKKKKKSEAARKRKFK 58


>gi|313204182|ref|YP_004042839.1| SSU ribosomal protein s21p [Paludibacter propionicigenes WB4]
 gi|312443498|gb|ADQ79854.1| SSU ribosomal protein S21P [Paludibacter propionicigenes WB4]
          Length = 63

 Score = 36.4 bits (83), Expect = 1.3,   Method: Composition-based stats.
 Identities = 20/63 (31%), Positives = 36/63 (57%), Gaps = 1/63 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           + V V++  N+E+AL+  K+K +  GV++EL+ R  ++KPS      K  AI   +K +
Sbjct: 1  MIVVPVKEGENIERALKKFKRKFEKTGVVKELRRRQCFDKPSIVGREEKMHAIYVQKKNL 60

Query: 78 RKI 80
           + 
Sbjct: 61 SEE 63


>gi|330794475|ref|XP_003285304.1| hypothetical protein DICPUDRAFT_149145 [Dictyostelium purpureum]
 gi|325084756|gb|EGC38177.1| hypothetical protein DICPUDRAFT_149145 [Dictyostelium purpureum]
          Length = 2618

 Score = 36.4 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 13/38 (34%), Positives = 19/38 (50%)

Query: 50  KMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAP 87
           K    YE  S K+V++K+E  +R  K   K  Q+ G  
Sbjct: 803 KEEKGYESRSDKKVKVKTEDEKRDEKREEKKKQQSGEL 840


>gi|303237512|ref|ZP_07324077.1| ribosomal protein S21 [Prevotella disiens FB035-09AN]
 gi|302482332|gb|EFL45362.1| ribosomal protein S21 [Prevotella disiens FB035-09AN]
          Length = 63

 Score = 36.4 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  ++KPS K+      AI
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRSRQQFDKPSVKKRLKMERAI 53


>gi|255558536|ref|XP_002520293.1| DNA binding protein, putative [Ricinus communis]
 gi|223540512|gb|EEF42079.1| DNA binding protein, putative [Ricinus communis]
          Length = 510

 Score = 36.4 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 14/46 (30%), Positives = 26/46 (56%), Gaps = 7/46 (15%)

Query: 46  LRELKM-RGHYEKPSQKRVRLKSEAIRRS-----RKLMRKIAQREG 85
           ++E++  +  YEK  +KR+  K+EA +R+     +KL  K  +  G
Sbjct: 452 IKEIRRAKRAYEKR-EKRLEKKAEADKRACENLEKKLDEKCEKESG 496


>gi|269468132|gb|EEZ79839.1| ribosomal protein S21 [uncultured SUP05 cluster bacterium]
          Length = 71

 Score = 36.4 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 29/55 (52%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           +   + ALR  ++     GV+ +++ +  YEK +    R K+ A++R+ +L  K
Sbjct: 8  ENEPFDIALRRFRRSCDRAGVITDVRKKEFYEKKTWVNKRKKAAAVKRTHQLRSK 62


>gi|226494415|ref|NP_001148414.1| ribosome-like protein [Zea mays]
 gi|195619106|gb|ACG31383.1| ribosome-like protein [Zea mays]
          Length = 164

 Score = 36.4 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 16/55 (29%), Positives = 26/55 (47%)

Query: 25  RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
            D + E+ LR  + ++   GV+ E++ R  +E    KR R    A  R R+   K
Sbjct: 74  EDADGEELLRRFRWQVSRAGVMEEIRRRRRHEDARDKRKRKARSASLRYRRRRFK 128


>gi|225164956|ref|ZP_03727168.1| ribosomal protein S21 [Opitutaceae bacterium TAV2]
 gi|224800430|gb|EEG18814.1| ribosomal protein S21 [Opitutaceae bacterium TAV2]
          Length = 65

 Score = 36.4 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 31/43 (72%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKS 67
          ++  V++ALR LKKK++ E V+++++ + ++EKP ++R R   
Sbjct: 9  KNEPVDRALRRLKKKLERENVIKDVRAKRYFEKPCERRRRKDK 51


>gi|86140291|ref|ZP_01058850.1| ribosomal protein S21 [Leeuwenhoekiella blandensis MED217]
 gi|85832233|gb|EAQ50682.1| ribosomal protein S21 [Leeuwenhoekiella blandensis MED217]
          Length = 64

 Score = 36.4 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 31/52 (59%), Gaps = 1/52 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
           + + V+D  N+++AL+  K+K    G +R+L+ R  + KPS +R R   +A
Sbjct: 1  MLIIPVKDGENIDRALKRFKRKFDRTGTMRKLRDRQAFTKPSVERRREIQKA 52


>gi|149278900|ref|ZP_01885035.1| hypothetical protein PBAL39_06976 [Pedobacter sp. BAL39]
 gi|149230519|gb|EDM35903.1| hypothetical protein PBAL39_06976 [Pedobacter sp. BAL39]
          Length = 64

 Score = 36.4 bits (83), Expect = 1.4,   Method: Composition-based stats.
 Identities = 21/53 (39%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + + ++D   +++AL+  KKK +  GVLREL+ R  YEK S  R  L   AI
Sbjct: 1  MIIINIKDGESLDKALKRFKKKFEKTGVLRELRSRQAYEKKSVARRTLVKHAI 53


>gi|261416269|ref|YP_003249952.1| ribosomal protein S21 [Fibrobacter succinogenes subsp.
          succinogenes S85]
 gi|261372725|gb|ACX75470.1| ribosomal protein S21 [Fibrobacter succinogenes subsp.
          succinogenes S85]
 gi|302325374|gb|ADL24575.1| ribosomal protein S21 [Fibrobacter succinogenes subsp.
          succinogenes S85]
          Length = 69

 Score = 36.4 bits (83), Expect = 1.5,   Method: Composition-based stats.
 Identities = 18/67 (26%), Positives = 39/67 (58%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           + V+V+ N   E+AL+   K  +  G++ ++K R  +EKPS+++ R+++ A R+  K +
Sbjct: 1  MIGVIVKSNEPFERALKRFTKSCEKNGIISDVKKRQRFEKPSEEKKRIETAARRKRLKEI 60

Query: 78 RKIAQRE 84
              ++ 
Sbjct: 61 ADQNRKR 67


>gi|296125259|ref|YP_003632511.1| ribosomal protein S21 [Brachyspira murdochii DSM 12563]
 gi|296017075|gb|ADG70312.1| ribosomal protein S21 [Brachyspira murdochii DSM 12563]
          Length = 69

 Score = 36.4 bits (83), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 35/54 (64%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQ 82
          VE  ++  ++  + EG+L++LK +  Y+KPS ++   + +A++R ++ ++K  +
Sbjct: 12 VESVIKRFRRACENEGILQDLKEKQFYKKPSLEKKLQREKALKRMKRKIKKERR 65


>gi|225619112|ref|YP_002720338.1| 30S ribosomal protein S21 [Brachyspira hyodysenteriae WA1]
 gi|225213931|gb|ACN82665.1| 30S ribosomal protein S21 putative [Brachyspira hyodysenteriae
          WA1]
          Length = 72

 Score = 36.4 bits (83), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 35/54 (64%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQ 82
          VE  ++  ++  + EG+L++LK +  Y+KPS ++   + +A++R ++ ++K  +
Sbjct: 15 VESVIKRFRRACENEGILQDLKEKQFYKKPSLEKKLQREKALKRMKRKIKKERR 68


>gi|229543811|ref|ZP_04432870.1| ribosomal protein S21 [Bacillus coagulans 36D1]
 gi|229324950|gb|EEN90626.1| ribosomal protein S21 [Bacillus coagulans 36D1]
          Length = 61

 Score = 36.4 bits (83), Expect = 1.5,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 27/45 (60%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKR 62
           +  V+ ++ +++ ALR  K+ +   G L+E + R  YEKPS +R
Sbjct: 1  MSKTVVRKNESLDDALRRFKRTVSKTGTLQEYRKREFYEKPSVRR 45


>gi|158320274|ref|YP_001512781.1| ribosomal protein S21 [Alkaliphilus oremlandii OhILAs]
 gi|167011221|sp|A8MG57|RS21_ALKOO RecName: Full=30S ribosomal protein S21
 gi|158140473|gb|ABW18785.1| ribosomal protein S21 [Alkaliphilus oremlandii OhILAs]
          Length = 59

 Score = 36.4 bits (83), Expect = 1.5,   Method: Composition-based stats.
 Identities = 14/36 (38%), Positives = 23/36 (63%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
           + +++ ALR  K++    G+L E++ R HYEKPS 
Sbjct: 8  ENESLDNALRRFKRQCAKSGILSEVRKREHYEKPSV 43


>gi|78221612|ref|YP_383359.1| 30S ribosomal protein S21 [Geobacter metallireducens GS-15]
 gi|119367259|sp|Q39YP0|RS21_GEOMG RecName: Full=30S ribosomal protein S21
 gi|78192867|gb|ABB30634.1| SSU ribosomal protein S21P [Geobacter metallireducens GS-15]
          Length = 65

 Score = 36.4 bits (83), Expect = 1.5,   Method: Composition-based stats.
 Identities = 21/54 (38%), Positives = 32/54 (59%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQ 82
           E AL+  KK+ +  G+L E++ R HYEKPS K+ +    A +R+ K  RK+  
Sbjct: 12 FELALKKFKKQCEKAGILSEVRKREHYEKPSIKKKKKAIAARKRAMKKQRKMMD 65


>gi|189465401|ref|ZP_03014186.1| hypothetical protein BACINT_01750 [Bacteroides intestinalis DSM
          17393]
 gi|189437675|gb|EDV06660.1| hypothetical protein BACINT_01750 [Bacteroides intestinalis DSM
          17393]
          Length = 63

 Score = 36.4 bits (83), Expect = 1.5,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  G+++EL+ R  ++KPS      K  A+
Sbjct: 1  MIVVPVKEGENIEKALKKFKRKFEKTGIVKELRSRQQFDKPSVVNRLKKERAV 53


>gi|187934948|ref|YP_001885100.1| 30S ribosomal protein S21 [Clostridium botulinum B str. Eklund
          17B]
 gi|188590220|ref|YP_001920261.1| 30S ribosomal protein S21 [Clostridium botulinum E3 str. Alaska
          E43]
 gi|251778958|ref|ZP_04821878.1| 30S ribosomal protein S21 [Clostridium botulinum E1 str. 'BoNT E
          Beluga']
 gi|226694990|sp|B2V2J3|RS21_CLOBA RecName: Full=30S ribosomal protein S21
 gi|226694991|sp|B2TM09|RS21_CLOBB RecName: Full=30S ribosomal protein S21
 gi|187723101|gb|ACD24322.1| 30S ribosomal protein S21 [Clostridium botulinum B str. Eklund
          17B]
 gi|188500501|gb|ACD53637.1| 30S ribosomal protein S21 [Clostridium botulinum E3 str. Alaska
          E43]
 gi|243083273|gb|EES49163.1| 30S ribosomal protein S21 [Clostridium botulinum E1 str. 'BoNT E
          Beluga']
          Length = 58

 Score = 36.0 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 22/51 (43%), Positives = 29/51 (56%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           +  +E ALR  KKK    GVL E++ R HYEKPS K+ +    A +R  K
Sbjct: 8  ENETLESALRRFKKKCARAGVLSEVRKREHYEKPSVKKKKKSEAARKRKFK 58


>gi|254283742|ref|ZP_04958710.1| ribosomal protein S21 [gamma proteobacterium NOR51-B]
 gi|219679945|gb|EED36294.1| ribosomal protein S21 [gamma proteobacterium NOR51-B]
          Length = 71

 Score = 36.0 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+  +  G+L E++ R HYEKP+  R R  + A++R  K M
Sbjct: 1  MPSVKVKENEPFDVALRRFKRSCEKAGLLAEVRKREHYEKPTTVRKRAAAAAVKRHLKKM 60

Query: 78 RKIAQRE 84
           +  ++ 
Sbjct: 61 SRENRKR 67


>gi|288803801|ref|ZP_06409228.1| ribosomal protein S21 [Prevotella melaninogenica D18]
 gi|288333708|gb|EFC72156.1| ribosomal protein S21 [Prevotella melaninogenica D18]
          Length = 63

 Score = 36.0 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  ++KPS K+      A+
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRARQQFDKPSVKKRLKMERAV 53


>gi|282896323|ref|ZP_06304345.1| Ribosomal protein S21 [Raphidiopsis brookii D9]
 gi|282900579|ref|ZP_06308521.1| Ribosomal protein S21 [Cylindrospermopsis raciborskii CS-505]
 gi|281194379|gb|EFA69334.1| Ribosomal protein S21 [Cylindrospermopsis raciborskii CS-505]
 gi|281198819|gb|EFA73698.1| Ribosomal protein S21 [Raphidiopsis brookii D9]
          Length = 59

 Score = 36.0 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 30/53 (56%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          VL  +  ++ ALR  K+++   G+L ++K   H+E P +KR R    A R+ R
Sbjct: 5  VLGENEGIDSALRRFKRQVSKAGILADVKYHRHFETPLEKRKRKAVSARRKRR 57


>gi|323342109|ref|ZP_08082342.1| 30S ribosomal protein S21 [Erysipelothrix rhusiopathiae ATCC
          19414]
 gi|322464534|gb|EFY09727.1| 30S ribosomal protein S21 [Erysipelothrix rhusiopathiae ATCC
          19414]
          Length = 61

 Score = 36.0 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/61 (27%), Positives = 28/61 (45%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           +  V+  +  ++ ALR  K+++   G L E + R  Y KP  +R      A +  RK  
Sbjct: 1  MSRIVVKENEGLDDALRRFKRQVSRNGTLAEARKREFYVKPGVRRKLKSEAAQKARRKKR 60

Query: 78 R 78
          R
Sbjct: 61 R 61


>gi|326524059|dbj|BAJ97040.1| predicted protein [Hordeum vulgare subsp. vulgare]
          Length = 874

 Score = 36.0 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 14/55 (25%), Positives = 31/55 (56%), Gaps = 1/55 (1%)

Query: 30  EQALRVLKKKMQGEGVLRELKMRGHYEKPS-QKRVRLKSEAIRRSRKLMRKIAQR 83
           E  LR  +++++ E VL + + +   E+ + + R R  +EA  ++ +  R+ +QR
Sbjct: 490 EMRLREEQRRLEKERVLEQQREKQAVERATKEARERAVAEARAKAERDARQRSQR 544


>gi|124515196|gb|EAY56707.1| ribosomal protein S21 [Leptospirillum rubarum]
 gi|206603674|gb|EDZ40154.1| Ribosomal protein S21 [Leptospirillum sp. Group II '5-way CG']
          Length = 65

 Score = 36.0 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 16/36 (44%), Positives = 23/36 (63%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
           + + E AL+  KK+ +  G+L E+K R HYEKPS 
Sbjct: 8  ENESFESALKRFKKQCEKAGILSEIKKREHYEKPSV 43


>gi|150008884|ref|YP_001303627.1| 30S ribosomal protein S21 [Parabacteroides distasonis ATCC 8503]
 gi|255014712|ref|ZP_05286838.1| 30S ribosomal protein S21 [Bacteroides sp. 2_1_7]
 gi|256841122|ref|ZP_05546629.1| ribosomal protein S21 [Parabacteroides sp. D13]
 gi|262383757|ref|ZP_06076893.1| 30S ribosomal protein S21 [Bacteroides sp. 2_1_33B]
 gi|298375887|ref|ZP_06985843.1| ribosomal protein S21 [Bacteroides sp. 3_1_19]
 gi|301311929|ref|ZP_07217851.1| ribosomal protein S21 [Bacteroides sp. 20_3]
 gi|166224046|sp|A6LE91|RS21_PARD8 RecName: Full=30S ribosomal protein S21
 gi|149937308|gb|ABR44005.1| 30S ribosomal protein S21 [Parabacteroides distasonis ATCC 8503]
 gi|256736965|gb|EEU50292.1| ribosomal protein S21 [Parabacteroides sp. D13]
 gi|262294655|gb|EEY82587.1| 30S ribosomal protein S21 [Bacteroides sp. 2_1_33B]
 gi|298266924|gb|EFI08581.1| ribosomal protein S21 [Bacteroides sp. 3_1_19]
 gi|300830031|gb|EFK60679.1| ribosomal protein S21 [Bacteroides sp. 20_3]
          Length = 63

 Score = 36.0 bits (82), Expect = 1.6,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 28/44 (63%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           N+E+AL+  K+K +  GV++EL+ R  +EKPS  + +    AI
Sbjct: 10 ENIEKALKKFKRKFEKTGVVKELRGRQAFEKPSVTKRKQTMRAI 53


>gi|320527298|ref|ZP_08028483.1| ribosomal protein S21 [Solobacterium moorei F0204]
 gi|320132322|gb|EFW24867.1| ribosomal protein S21 [Solobacterium moorei F0204]
          Length = 60

 Score = 36.0 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 29/58 (50%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           +  VL  + N++ ALR  K+++   G L E + R +Y KP  KR      A +  R+
Sbjct: 1  MSRVVLKENENLDDALRRFKRQVSRNGTLAEARKREYYVKPGVKRKLKIEAARKARRR 58


>gi|317037709|ref|XP_001398962.2| small nucleolar ribonucleoprotein complex subunit (SOF1)
           [Aspergillus niger CBS 513.88]
          Length = 465

 Score = 36.0 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 46  LRELKMRGHYEKPSQKRVRLKSE---AIRRSRKLMRKIAQREGAPVSRLRQHR 95
           +R ++ + H  KP +K   +K E   AI+R  + +RK  ++E  P  +  + +
Sbjct: 406 IRRIRRQRHVPKPIKKAREIKREELMAIKRREENVRKHTKKENLPKRQSEREK 458


>gi|254446001|ref|ZP_05059477.1| ribosomal protein S21 [Verrucomicrobiae bacterium DG1235]
 gi|198260309|gb|EDY84617.1| ribosomal protein S21 [Verrucomicrobiae bacterium DG1235]
          Length = 65

 Score = 36.0 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 24/53 (45%), Positives = 36/53 (67%), Gaps = 1/53 (1%)

Query: 18 SAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
           A+ V +R N  VE+ALR LKKK+  EGV+++++   ++EKPSQ + R K  A
Sbjct: 1  MAIEVKIRKNEPVERALRRLKKKLDREGVIKDVRANRYFEKPSQTKRRQKKVA 53


>gi|170088164|ref|XP_001875305.1| predicted protein [Laccaria bicolor S238N-H82]
 gi|164650505|gb|EDR14746.1| predicted protein [Laccaria bicolor S238N-H82]
          Length = 700

 Score = 36.0 bits (82), Expect = 1.7,   Method: Composition-based stats.
 Identities = 9/30 (30%), Positives = 13/30 (43%)

Query: 51  MRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80
            R  +E   ++R R K +  RR  K   K 
Sbjct: 627 RRRRHETKQERRQRHKEKKQRRKAKAREKR 656


>gi|312892235|ref|ZP_07751732.1| SSU ribosomal protein S21P [Mucilaginibacter paludis DSM 18603]
 gi|311295365|gb|EFQ72537.1| SSU ribosomal protein S21P [Mucilaginibacter paludis DSM 18603]
          Length = 63

 Score = 36.0 bits (82), Expect = 1.8,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + + ++D   +++AL+  KKK +  GVLREL+ R  YEK S  R      AI
Sbjct: 1  MIIINIKDGESLDKALKRFKKKFEKTGVLRELRSRQAYEKKSVTRRTEIKHAI 53


>gi|307069580|ref|YP_003878057.1| putative 30S ribosomal subunit protein S21 [Candidatus Zinderia
          insecticola CARI]
 gi|306482840|gb|ADM89711.1| putative 30S ribosomal subunnit protein S21 [Candidatus Zinderia
          insecticola CARI]
          Length = 70

 Score = 36.0 bits (82), Expect = 1.8,   Method: Composition-based stats.
 Identities = 11/36 (30%), Positives = 21/36 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
          +  N+E  ++  K  +   G+L  +K++  YEKP+Q
Sbjct: 8  KKENIETVIKNFKNIIDKIGILNTIKLKEFYEKPNQ 43


>gi|255530751|ref|YP_003091123.1| 30S ribosomal protein S21 [Pedobacter heparinus DSM 2366]
 gi|255343735|gb|ACU03061.1| ribosomal protein S21 [Pedobacter heparinus DSM 2366]
          Length = 64

 Score = 36.0 bits (82), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 30/53 (56%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + + ++D   +++AL+  KKK +  GVLREL+ R  YEK S  R      AI
Sbjct: 1  MIIINIKDGESLDKALKRFKKKFEKTGVLRELRSRQAYEKKSVARRTQVKHAI 53


>gi|196228314|ref|ZP_03127181.1| ribosomal protein S21 [Chthoniobacter flavus Ellin428]
 gi|196227717|gb|EDY22220.1| ribosomal protein S21 [Chthoniobacter flavus Ellin428]
          Length = 66

 Score = 36.0 bits (82), Expect = 1.9,   Method: Composition-based stats.
 Identities = 15/44 (34%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQK 61
             V+VR    +++AL+ LK K+  EG++ E++    +E P+QK
Sbjct: 1  MPEVIVRKGEPIDRALKRLKSKLDAEGIMDEVRRLRAFETPTQK 44


>gi|53715487|ref|YP_101479.1| 30S ribosomal protein S21 [Bacteroides fragilis YCH46]
 gi|60683460|ref|YP_213604.1| 30S ribosomal protein S21 [Bacteroides fragilis NCTC 9343]
 gi|255011625|ref|ZP_05283751.1| 30S ribosomal protein S21 [Bacteroides fragilis 3_1_12]
 gi|313149460|ref|ZP_07811653.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
 gi|61215860|sp|Q64NI7|RS21_BACFR RecName: Full=30S ribosomal protein S21
 gi|81313492|sp|Q5L887|RS21_BACFN RecName: Full=30S ribosomal protein S21
 gi|52218352|dbj|BAD50945.1| 30S ribosomal protein S21 [Bacteroides fragilis YCH46]
 gi|60494894|emb|CAH09701.1| putative ribosomal protein S21 [Bacteroides fragilis NCTC 9343]
 gi|301164944|emb|CBW24505.1| 30S ribosomal protein S21 [Bacteroides fragilis 638R]
 gi|313138227|gb|EFR55587.1| conserved hypothetical protein [Bacteroides fragilis 3_1_12]
          Length = 63

 Score = 36.0 bits (82), Expect = 1.9,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  G+++EL+ R  ++KPS  +   K  A+
Sbjct: 1  MIVVPVKEGENIEKALKKFKRKFEKTGIVKELRSRQQFDKPSVTKRLKKERAV 53


>gi|134080753|emb|CAL00867.1| unnamed protein product [Aspergillus niger]
          Length = 606

 Score = 36.0 bits (82), Expect = 1.9,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 34/61 (55%), Gaps = 9/61 (14%)

Query: 23  LVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQ 82
           +V+D ++E+ L+ L++KM+  G     + R   EK   KR++      +R RK   KIAQ
Sbjct: 373 IVQD-DLEKGLKQLQRKMEKLG-----RER---EKGVTKRLQQSERTFQRVRKREAKIAQ 423

Query: 83  R 83
           +
Sbjct: 424 K 424


>gi|258647391|ref|ZP_05734860.1| ribosomal protein S21 [Prevotella tannerae ATCC 51259]
 gi|260852758|gb|EEX72627.1| ribosomal protein S21 [Prevotella tannerae ATCC 51259]
          Length = 63

 Score = 36.0 bits (82), Expect = 1.9,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  GV+++L+ R  ++KPS  +   K  AI
Sbjct: 1  MIIVPVKEGENIERALKKFKRKFERTGVVKQLRARQQFDKPSVLKRLAKEHAI 53


>gi|293374776|ref|ZP_06621083.1| ribosomal protein S21 [Turicibacter sanguinis PC909]
 gi|325845142|ref|ZP_08168451.1| ribosomal protein S21 [Turicibacter sp. HGF1]
 gi|292646598|gb|EFF64601.1| ribosomal protein S21 [Turicibacter sanguinis PC909]
 gi|325488807|gb|EGC91207.1| ribosomal protein S21 [Turicibacter sp. HGF1]
          Length = 63

 Score = 36.0 bits (82), Expect = 2.0,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 32/58 (55%)

Query: 21 YVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           V+ ++ +++ ALR  K+++   G L E + R +Y KPS KR +    A + + K  +
Sbjct: 5  TVVRKNESLDDALRRFKREVSKVGTLTEARKREYYVKPSIKRKQKSEAARKSAIKRNK 62


>gi|304384440|ref|ZP_07366844.1| 30S ribosomal protein S21 [Prevotella marshii DSM 16973]
 gi|304334460|gb|EFM00749.1| 30S ribosomal protein S21 [Prevotella marshii DSM 16973]
          Length = 63

 Score = 36.0 bits (82), Expect = 2.0,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV+REL+ R  ++KPS  +      AI
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVRELRARQQFDKPSVLKRLKMEHAI 53


>gi|182413910|ref|YP_001818976.1| ribosomal protein S21 [Opitutus terrae PB90-1]
 gi|177841124|gb|ACB75376.1| ribosomal protein S21 [Opitutus terrae PB90-1]
          Length = 65

 Score = 36.0 bits (82), Expect = 2.0,   Method: Composition-based stats.
 Identities = 13/43 (30%), Positives = 30/43 (69%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKS 67
          ++  V++A+R +KKK+  E +++ ++ + +YEKP ++R R + 
Sbjct: 9  KNEPVDRAIRRMKKKLDRENIIKGVRAKRYYEKPCERRRRKEK 51


>gi|167753129|ref|ZP_02425256.1| hypothetical protein ALIPUT_01400 [Alistipes putredinis DSM
          17216]
 gi|167659443|gb|EDS03573.1| hypothetical protein ALIPUT_01400 [Alistipes putredinis DSM
          17216]
          Length = 63

 Score = 35.6 bits (81), Expect = 2.0,   Method: Composition-based stats.
 Identities = 17/44 (38%), Positives = 27/44 (61%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           N+E+AL+  K+K +  GVL+EL+ R ++ KPS  +      AI
Sbjct: 10 ENIEKALKKFKRKYERTGVLKELRRRQYFTKPSVAKRIAMQHAI 53


>gi|220906768|ref|YP_002482079.1| 30S ribosomal protein S21 [Cyanothece sp. PCC 7425]
 gi|219863379|gb|ACL43718.1| ribosomal protein S21 [Cyanothece sp. PCC 7425]
          Length = 59

 Score = 35.6 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 32/53 (60%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          VL ++  +E ALR  K+++   G+L ++K   H+E P +K+ R +  A R+ R
Sbjct: 5  VLGQNEGIESALRRFKRQVSKAGILADVKRYRHFETPLEKKKRKEIAARRKRR 57


>gi|224023589|ref|ZP_03641955.1| hypothetical protein BACCOPRO_00293 [Bacteroides coprophilus DSM
          18228]
 gi|224016811|gb|EEF74823.1| hypothetical protein BACCOPRO_00293 [Bacteroides coprophilus DSM
          18228]
          Length = 63

 Score = 35.6 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  GV++EL+ R  ++KPS  +      AI
Sbjct: 1  MIVVPVKEGENIEKALKKFKRKFEKTGVVKELRRRQQFDKPSVLKRLKMEHAI 53


>gi|198277426|ref|ZP_03209957.1| hypothetical protein BACPLE_03640 [Bacteroides plebeius DSM
          17135]
 gi|198269924|gb|EDY94194.1| hypothetical protein BACPLE_03640 [Bacteroides plebeius DSM
          17135]
          Length = 63

 Score = 35.6 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  GV++EL+ R  Y+KPS  +      AI
Sbjct: 1  MIVVPVKEGENIEKALKKFKRKFEKTGVVKELRSRQQYDKPSVLKRLKMERAI 53


>gi|330804926|ref|XP_003290440.1| hypothetical protein DICPUDRAFT_154957 [Dictyostelium purpureum]
 gi|325079451|gb|EGC33051.1| hypothetical protein DICPUDRAFT_154957 [Dictyostelium purpureum]
          Length = 429

 Score = 35.6 bits (81), Expect = 2.1,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 36  LKKKMQGEGVL--RELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQ 93
           L++K+Q + +L  RE++ R + EK  +K    K E  +      RK   RE   +  L++
Sbjct: 360 LERKLQKKILLEQREMERRVYIEKDLEKVREKKREMEKDKLNEKRKEENREKRIIRELKR 419


>gi|115350851|ref|YP_772690.1| 30S ribosomal protein S21 [Burkholderia ambifaria AMMD]
 gi|115280839|gb|ABI86356.1| SSU ribosomal protein S21P [Burkholderia ambifaria AMMD]
          Length = 70

 Score = 35.6 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 20/69 (28%), Positives = 36/69 (52%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
              VL  +  V+ ALR  ++ ++  G++REL+ R  YEK + +R R K+ A+ R R   
Sbjct: 1  MTTIVLKPNEPVDVALRRFRRDIEKTGLIRELRSRTGYEKRTTQREREKASAVARQRLRA 60

Query: 78 RKIAQREGA 86
          +++      
Sbjct: 61 KRMLPPRKL 69


>gi|92113102|ref|YP_573030.1| 30S ribosomal protein S21 [Chromohalobacter salexigens DSM 3043]
 gi|119367246|sp|Q1QYX7|RS21_CHRSD RecName: Full=30S ribosomal protein S21
 gi|91796192|gb|ABE58331.1| SSU ribosomal protein S21P [Chromohalobacter salexigens DSM 3043]
          Length = 71

 Score = 35.6 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 1/66 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V VRDN   + ALR  K+  +  GVL E++ R  YEKP+  R R  + A++R  K +
Sbjct: 1  MPSVKVRDNEPFDVALRRFKRSCEKAGVLSEVRRRETYEKPTAVRKRKAAAAVKRHAKKL 60

Query: 78 RKIAQR 83
          ++  +R
Sbjct: 61 QRERKR 66


>gi|289619456|emb|CBI53739.1| unnamed protein product [Sordaria macrospora]
          Length = 232

 Score = 35.6 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 11/44 (25%), Positives = 24/44 (54%)

Query: 28  NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIR 71
           +   AL+ L + +    V ++++++  +E+P+ KR R   E  R
Sbjct: 167 DFATALKQLNRAVAMNQVRKDVRLQRFHERPALKRKRKLRERWR 210


>gi|294866446|ref|XP_002764720.1| myosin heavy chain, skeletal muscle, putative [Perkinsus marinus ATCC
            50983]
 gi|239864410|gb|EEQ97437.1| myosin heavy chain, skeletal muscle, putative [Perkinsus marinus ATCC
            50983]
          Length = 1852

 Score = 35.6 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 28   NVEQALRVLKKKMQGEGVLRE---LKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
             VE A+R L ++++  G+ +E    K     +K S+ R R  ++  R+   L   +A+RE
Sbjct: 1693 EVEIAMRKLIERIEKSGMDKEAALAKELELAKKRSEARRRENAKFERKLDDLREVVAERE 1752


>gi|294674800|ref|YP_003575416.1| 30S ribosomal protein S21 [Prevotella ruminicola 23]
 gi|294473902|gb|ADE83291.1| ribosomal protein S21 [Prevotella ruminicola 23]
          Length = 63

 Score = 35.6 bits (81), Expect = 2.2,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  GV++EL+ R  ++KPS  +      A+
Sbjct: 1  MIIVPVKEGENIEKALKKFKRKFEKTGVVKELRRRQQFDKPSVLKRLKMEHAV 53


>gi|212550768|ref|YP_002309085.1| 30S ribosomal protein S21 [Candidatus Azobacteroides
          pseudotrichonymphae genomovar. CFP2]
 gi|226694971|sp|B6YR52|RS21_AZOPC RecName: Full=30S ribosomal protein S21
 gi|212549006|dbj|BAG83674.1| 30S ribosomal protein S21 [Candidatus Azobacteroides
          pseudotrichonymphae genomovar. CFP2]
          Length = 63

 Score = 35.6 bits (81), Expect = 2.3,   Method: Composition-based stats.
 Identities = 21/61 (34%), Positives = 33/61 (54%), Gaps = 1/61 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           + V +++  N+E+AL+  K+K +  GV +ELK R  + KPS  R   K  AI   + L 
Sbjct: 1  MIIVSLKEGENLEKALKKFKRKFERTGVSKELKRRQAFVKPSVLRRNQKIHAIYAQKFLQ 60

Query: 78 R 78
           
Sbjct: 61 S 61


>gi|67924770|ref|ZP_00518172.1| Ribosomal protein S21 [Crocosphaera watsonii WH 8501]
 gi|67853395|gb|EAM48752.1| Ribosomal protein S21 [Crocosphaera watsonii WH 8501]
          Length = 61

 Score = 35.6 bits (81), Expect = 2.3,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 28/54 (51%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           +  +E ALR  K+++   G+  ++K   H+E P +KR R      R+ ++  R
Sbjct: 8  ENEGIESALRRFKRQVSKAGIFYDMKKNRHFETPIEKRKRKALAKQRQRKRYSR 61


>gi|260790077|ref|XP_002590070.1| hypothetical protein BRAFLDRAFT_123437 [Branchiostoma floridae]
 gi|229275258|gb|EEN46081.1| hypothetical protein BRAFLDRAFT_123437 [Branchiostoma floridae]
          Length = 1878

 Score = 35.6 bits (81), Expect = 2.4,   Method: Composition-based stats.
 Identities = 20/83 (24%), Positives = 38/83 (45%), Gaps = 12/83 (14%)

Query: 2    LVFNAFRGIFSEGREISAVYVLVRDNNVEQALRVLK--KKMQGEGVLRELKMRGHYEKPS 59
            +V +  +      +    V +L+ D+ +E+ LR  +  K++Q E +  + K R       
Sbjct: 1565 MVISGGKFSPDTLKPKEVVSLLLDDDELEKKLRQRQEEKRLQEEAI--KAKDR------- 1615

Query: 60   QKRVRLKSEAIRRSRKLMRKIAQ 82
             KR R K  A +R R+  +K  +
Sbjct: 1616 -KRKREKYAADKRRREAAKKKKE 1637


>gi|300869361|ref|ZP_07113951.1| 30S ribosomal protein S21 [Oscillatoria sp. PCC 6506]
 gi|300332660|emb|CBN59149.1| 30S ribosomal protein S21 [Oscillatoria sp. PCC 6506]
          Length = 59

 Score = 35.6 bits (81), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/43 (34%), Positives = 26/43 (60%), Gaps = 1/43 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
             VL+ +N  +E ALR  K+++   G+L ++K R H+E P +
Sbjct: 1  MTQVLLGENERIESALRRFKRQVSSAGILADVKKRRHFETPLE 43


>gi|319956002|ref|YP_004167265.1| SSU ribosomal protein s21p [Nitratifractor salsuginis DSM 16511]
 gi|319418406|gb|ADV45516.1| SSU ribosomal protein S21P [Nitratifractor salsuginis DSM 16511]
          Length = 70

 Score = 35.6 bits (81), Expect = 2.4,   Method: Composition-based stats.
 Identities = 15/56 (26%), Positives = 30/56 (53%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           E+A R  K++     ++ E + R HYEKP+++R + K    ++  K +  + + E
Sbjct: 12 FEEAYRKFKRQCDRNLIVTEARARQHYEKPTERRKKEKIATRKKILKKLYMLRRYE 67


>gi|37522098|ref|NP_925475.1| 30S ribosomal protein S21 [Gloeobacter violaceus PCC 7421]
 gi|81709481|sp|Q7NHK6|RS211_GLOVI RecName: Full=30S ribosomal protein S21 1
 gi|35213097|dbj|BAC90470.1| 30S ribosomal protein S21 [Gloeobacter violaceus PCC 7421]
          Length = 59

 Score = 35.6 bits (81), Expect = 2.4,   Method: Composition-based stats.
 Identities = 13/36 (36%), Positives = 21/36 (58%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
          +D ++E ALR  K+ +   G+L E K   H+E P +
Sbjct: 8  QDESIESALRRFKRTVAKAGILAEAKRHRHFETPIE 43


>gi|71277960|ref|YP_270986.1| 30S ribosomal protein S21 [Colwellia psychrerythraea 34H]
 gi|119367250|sp|Q47W36|RS21_COLP3 RecName: Full=30S ribosomal protein S21
 gi|71143700|gb|AAZ24173.1| ribosomal protein S21 [Colwellia psychrerythraea 34H]
          Length = 71

 Score = 35.6 bits (81), Expect = 2.5,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 38/67 (56%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + VR+N   + ALR  K+  +  G+L E++ R  YEKP+ +R R K+ A++R+ K +
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGILSEVRRRESYEKPTWERKRKKAAAVKRAAKKV 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 SRENARR 67


>gi|194766417|ref|XP_001965321.1| GF20711 [Drosophila ananassae]
 gi|190617931|gb|EDV33455.1| GF20711 [Drosophila ananassae]
          Length = 5735

 Score = 35.6 bits (81), Expect = 2.5,   Method: Composition-based stats.
 Identities = 12/55 (21%), Positives = 26/55 (47%), Gaps = 2/55 (3%)

Query: 41   QGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQHR 95
              E   +E + +   EK  ++R +   E  +R ++L+R   QRE     + ++ +
Sbjct: 2114 DKELREKEQREKEQREK--EQREKELREKEQREKELVRAKEQREKELHEKEQREK 2166


>gi|189460666|ref|ZP_03009451.1| hypothetical protein BACCOP_01308 [Bacteroides coprocola DSM
          17136]
 gi|189432625|gb|EDV01610.1| hypothetical protein BACCOP_01308 [Bacteroides coprocola DSM
          17136]
          Length = 63

 Score = 35.6 bits (81), Expect = 2.5,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  GV++EL+ R  Y+KPS  +      A+
Sbjct: 1  MIVVPVKEGENIEKALKKFKRKFEKTGVVKELRSRQQYDKPSVLKRLKMERAV 53


>gi|284929117|ref|YP_003421639.1| 30S ribosomal protein S21P [cyanobacterium UCYN-A]
 gi|284809576|gb|ADB95281.1| SSU ribosomal protein S21P [cyanobacterium UCYN-A]
          Length = 61

 Score = 35.6 bits (81), Expect = 2.6,   Method: Composition-based stats.
 Identities = 15/54 (27%), Positives = 28/54 (51%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
           +  +E ALR  K+++   G+  ++K   H+E P +KR R      R+ ++  R
Sbjct: 8  ENEGIESALRRFKRQVSKAGIFYDMKKNRHFETPIEKRKRKALAKQRQRKRSYR 61


>gi|294881527|ref|XP_002769392.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
 gi|239872801|gb|EER02110.1| conserved hypothetical protein [Perkinsus marinus ATCC 50983]
          Length = 1743

 Score = 35.6 bits (81), Expect = 2.6,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 31/60 (51%), Gaps = 3/60 (5%)

Query: 28   NVEQALRVLKKKMQGEGVLRE---LKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
             VE A+R L ++++  G+ +E    K     +K S+ R R  ++  R+   L   +A+RE
Sbjct: 1578 EVEIAMRKLIERIEKSGMDKEAALAKELELAKKRSEARRRENAKFERKLDDLREVVAERE 1637


>gi|288801072|ref|ZP_06406528.1| ribosomal protein S21 [Prevotella sp. oral taxon 299 str. F0039]
 gi|288332006|gb|EFC70488.1| ribosomal protein S21 [Prevotella sp. oral taxon 299 str. F0039]
          Length = 63

 Score = 35.6 bits (81), Expect = 2.6,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+MR  Y KPS  +      A+
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRMRQQYNKPSVLKRLRMEHAV 53


>gi|86604914|ref|YP_473677.1| 30S ribosomal protein S21 [Synechococcus sp. JA-3-3Ab]
 gi|119367330|sp|Q2JXR2|RS21_SYNJA RecName: Full=30S ribosomal protein S21
 gi|86553456|gb|ABC98414.1| ribosomal protein S21 [Synechococcus sp. JA-3-3Ab]
          Length = 61

 Score = 35.3 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           +  +E ALR  K+++   G+LR+L+   H+E   +KR R      R  RK M
Sbjct: 8  ENEGIESALRRFKRQVSKAGILRDLRNHRHFETNLEKRKRKAVAMRRNRRKSM 60


>gi|332708829|ref|ZP_08428800.1| SSU ribosomal protein S21P [Lyngbya majuscula 3L]
 gi|332352371|gb|EGJ31940.1| SSU ribosomal protein S21P [Lyngbya majuscula 3L]
          Length = 66

 Score = 35.3 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 17/49 (34%), Positives = 28/49 (57%), Gaps = 1/49 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLK 66
             V+V +N  +E ALR  K+K+   G+  ++K   H+E  +QKR R +
Sbjct: 1  MTQVVVGENEQLESALRRFKRKVSQAGIFADMKKNRHFETFAQKRKRKE 49


>gi|228473632|ref|ZP_04058384.1| ribosomal protein S21 [Capnocytophaga gingivalis ATCC 33624]
 gi|228275004|gb|EEK13814.1| ribosomal protein S21 [Capnocytophaga gingivalis ATCC 33624]
          Length = 64

 Score = 35.3 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 16/46 (34%), Positives = 29/46 (63%), Gaps = 1/46 (2%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRV 63
           + + V++  N+++AL+  K+K    G++REL+ R H+ KPS  R 
Sbjct: 1  MLIIPVKEGENIDRALKRYKRKFDRVGIVRELRARQHFTKPSVLRR 46


>gi|86608705|ref|YP_477467.1| 30S ribosomal protein S21 [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|119367331|sp|Q2JM43|RS21_SYNJB RecName: Full=30S ribosomal protein S21
 gi|86557247|gb|ABD02204.1| ribosomal protein S21 [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 61

 Score = 35.3 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 28/53 (52%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           +  +E ALR  K+++   G+LR+L+   H+E   +KR R      R  RK M
Sbjct: 8  ENEGIESALRRFKRQVSKAGILRDLRNHRHFETNLEKRKRKAVAVRRNRRKSM 60


>gi|310640734|ref|YP_003945492.1| protein [Paenibacillus polymyxa SC2]
 gi|309245684|gb|ADO55251.1| Putative uncharacterized protein [Paenibacillus polymyxa SC2]
          Length = 414

 Score = 35.3 bits (80), Expect = 2.7,   Method: Composition-based stats.
 Identities = 14/41 (34%), Positives = 24/41 (58%), Gaps = 2/41 (4%)

Query: 28 NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSE 68
          NV  ALR   +K+  E V + +K +G +  P+ K+++ K E
Sbjct: 2  NVNGALRKFFRKVNRENVEKLMKEKGVF--PTDKKIKSKRE 40


>gi|134084553|emb|CAK43306.1| unnamed protein product [Aspergillus niger]
          Length = 447

 Score = 35.3 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 28/53 (52%), Gaps = 3/53 (5%)

Query: 46  LRELKMRGHYEKPSQKRVRLKSE---AIRRSRKLMRKIAQREGAPVSRLRQHR 95
           +R ++ + H  KP +K   +K E   AI+R  + +RK  ++E  P  +  + +
Sbjct: 388 IRRIRRQRHVPKPIKKAREIKREELMAIKRREENVRKHTKKENLPKRQSEREK 440


>gi|152989888|ref|YP_001355610.1| 30S ribosomal protein S21 [Nitratiruptor sp. SB155-2]
 gi|166224043|sp|A6Q194|RS21_NITSB RecName: Full=30S ribosomal protein S21
 gi|151421749|dbj|BAF69253.1| 30S ribosomal protein S21 [Nitratiruptor sp. SB155-2]
          Length = 70

 Score = 35.3 bits (80), Expect = 2.8,   Method: Composition-based stats.
 Identities = 17/59 (28%), Positives = 34/59 (57%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
          D + E+A R+ KK++    ++ E + R  YEKP+++R + K  A ++  K +  + + E
Sbjct: 9  DQSFEEAYRLFKKQVDRNLIVTEARARRFYEKPTERRKKEKIAARKKMLKRLYMLRRYE 67


>gi|224372304|ref|YP_002606676.1| 30S ribosomal protein S21 [Nautilia profundicola AmH]
 gi|254813725|sp|B9L7R8|RS21_NAUPA RecName: Full=30S ribosomal protein S21
 gi|223588563|gb|ACM92299.1| ribosomal protein S21 [Nautilia profundicola AmH]
          Length = 70

 Score = 35.3 bits (80), Expect = 2.9,   Method: Composition-based stats.
 Identities = 15/63 (23%), Positives = 33/63 (52%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
          V+ +  + E A R  K+++    ++ EL+ R  YE PS++R + K    ++  + +  + 
Sbjct: 5  VVHQGEDFESAYRKFKRQVDRNLIVVELRKRRFYEPPSERRKKEKIATRKKILRKLWMLR 64

Query: 82 QRE 84
          + E
Sbjct: 65 RYE 67


>gi|299140208|ref|ZP_07033375.1| ribosomal protein S21 [Acidobacterium sp. MP5ACTX8]
 gi|298597846|gb|EFI54017.1| ribosomal protein S21 [Acidobacterium sp. MP5ACTX8]
          Length = 65

 Score = 35.3 bits (80), Expect = 3.0,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
             V V++   +E ALR  K+K+Q E +++E+K    Y KP +K+   ++ A
Sbjct: 1  MAEVRVQEGEPLENALRRFKRKVQTEDIIKEVKRHSFYLKPGEKKRVKEALA 52


>gi|282878704|ref|ZP_06287472.1| ribosomal protein S21 [Prevotella buccalis ATCC 35310]
 gi|281299095|gb|EFA91496.1| ribosomal protein S21 [Prevotella buccalis ATCC 35310]
          Length = 63

 Score = 35.3 bits (80), Expect = 3.0,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 29/53 (54%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K    GV +EL+ R  Y KPS  +      AI
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFDKTGVSKELRARQQYNKPSVLKRLKMERAI 53


>gi|283769583|ref|ZP_06342479.1| ribosomal protein S21 [Bulleidia extructa W1219]
 gi|283103851|gb|EFC05237.1| ribosomal protein S21 [Bulleidia extructa W1219]
          Length = 60

 Score = 35.3 bits (80), Expect = 3.1,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 29/60 (48%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           A  VL  + N++ ALR  K+++   G L E + R +Y KP  KR      A +  ++  
Sbjct: 1  MARVVLKENENLDDALRRFKRQVSRNGTLAEARKREYYVKPGIKRKLKIEAAKKARKRNK 60


>gi|119504974|ref|ZP_01627051.1| 30S ribosomal protein S21 [marine gamma proteobacterium HTCC2080]
 gi|119459260|gb|EAW40358.1| 30S ribosomal protein S21 [marine gamma proteobacterium HTCC2080]
          Length = 71

 Score = 35.3 bits (80), Expect = 3.3,   Method: Composition-based stats.
 Identities = 22/67 (32%), Positives = 37/67 (55%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             V V++N   + ALR  K+  +  G+L E++ R HYEKP+  R R  + A++R  K M
Sbjct: 1  MPAVKVKENEPFDVALRRFKRSCEKAGLLAEVRKREHYEKPTTIRKRAAAAAVKRHAKKM 60

Query: 78 RKIAQRE 84
           +  ++ 
Sbjct: 61 SRENRKR 67


>gi|307152306|ref|YP_003887690.1| 30S ribosomal protein S21 [Cyanothece sp. PCC 7822]
 gi|306982534|gb|ADN14415.1| ribosomal protein S21 [Cyanothece sp. PCC 7822]
          Length = 69

 Score = 35.3 bits (80), Expect = 3.3,   Method: Composition-based stats.
 Identities = 16/59 (27%), Positives = 30/59 (50%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQR 83
          ++  +E ALR  KK++   G+  +LK   H+E P +KR R      +  R+   +  ++
Sbjct: 8  QNEGIESALRRFKKEVSQAGIFPDLKKHRHFETPIEKRKRKAIARQKERRRFSSRYRKK 66


>gi|104783855|ref|YP_610353.1| hypothetical protein PSEEN4925 [Pseudomonas entomophila L48]
 gi|95112842|emb|CAK17570.1| putative Fe-S oxidase, SAM-binding [Pseudomonas entomophila L48]
          Length = 765

 Score = 35.3 bits (80), Expect = 3.4,   Method: Composition-based stats.
 Identities = 11/39 (28%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 57  KPSQKRVRLKSEAIRRSRKLMRKIAQ-REGAPVSRLRQH 94
           KP  KR + K+EA  R+++  ++  +  +G    + RQ 
Sbjct: 723 KPWDKREKAKAEAFARNQQAAKERKEAAKGGKGKKPRQP 761


>gi|56707868|ref|YP_169764.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|89256659|ref|YP_514021.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica LVS]
 gi|110670339|ref|YP_666896.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|115315072|ref|YP_763795.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica OSU18]
 gi|134301710|ref|YP_001121678.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis WY96-3418]
 gi|156502806|ref|YP_001428871.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica FTNF002-00]
 gi|167010530|ref|ZP_02275461.1| ribosomal protein S21 [Francisella tularensis subsp. holarctica
          FSC200]
 gi|208779108|ref|ZP_03246454.1| ribosomal protein S21 [Francisella novicida FTG]
 gi|224456947|ref|ZP_03665420.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis MA00-2987]
 gi|254367971|ref|ZP_04983991.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica 257]
 gi|254369525|ref|ZP_04985536.1| predicted protein [Francisella tularensis subsp. holarctica
          FSC022]
 gi|254370362|ref|ZP_04986367.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis FSC033]
 gi|254372687|ref|ZP_04988176.1| 30S ribosomal protein S21 [Francisella tularensis subsp. novicida
          GA99-3549]
 gi|254874683|ref|ZP_05247393.1| predicted protein [Francisella tularensis subsp. tularensis
          MA00-2987]
 gi|290953402|ref|ZP_06558023.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|295313363|ref|ZP_06803972.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica URFT1]
 gi|81677073|sp|Q5NGS8|RS212_FRATT RecName: Full=30S ribosomal protein S21 2
 gi|119367218|sp|Q14I80|RS212_FRAT1 RecName: Full=30S ribosomal protein S21 2
 gi|119367229|sp|Q2A2N1|RS213_FRATH RecName: Full=30S ribosomal protein S21 3
 gi|119367230|sp|Q0BL76|RS213_FRATO RecName: Full=30S ribosomal protein S21 3
 gi|56604360|emb|CAG45386.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis SCHU S4]
 gi|89144490|emb|CAJ79799.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica LVS]
 gi|110320672|emb|CAL08769.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis FSC198]
 gi|115129971|gb|ABI83158.1| ribosomal protein S21 [Francisella tularensis subsp. holarctica
          OSU18]
 gi|134049487|gb|ABO46558.1| ribosomal protein S21 [Francisella tularensis subsp. tularensis
          WY96-3418]
 gi|134253781|gb|EBA52875.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          holarctica 257]
 gi|151568605|gb|EDN34259.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis FSC033]
 gi|151570414|gb|EDN36068.1| 30S ribosomal protein S21 [Francisella novicida GA99-3549]
 gi|156253409|gb|ABU61915.1| ribosomal protein S21 [Francisella tularensis subsp. holarctica
          FTNF002-00]
 gi|157122479|gb|EDO66614.1| predicted protein [Francisella tularensis subsp. holarctica
          FSC022]
 gi|208744908|gb|EDZ91206.1| ribosomal protein S21 [Francisella novicida FTG]
 gi|254840682|gb|EET19118.1| predicted protein [Francisella tularensis subsp. tularensis
          MA00-2987]
 gi|282159049|gb|ADA78440.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          tularensis NE061598]
 gi|328676806|gb|AEB27676.1| SSU ribosomal protein S21p [Francisella cf. novicida Fx1]
          Length = 66

 Score = 35.3 bits (80), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 31/51 (60%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           + +LR  K+  +  G+ +EL+ R HY KP+QKR   K  AI +++K  R+
Sbjct: 12 FDISLRNFKRACEKAGIKQELRDRQHYVKPTQKRKIAKKAAISKAKKEARR 62


>gi|313676500|ref|YP_004054496.1| SSU ribosomal protein s21p [Marivirga tractuosa DSM 4126]
 gi|312943198|gb|ADR22388.1| SSU ribosomal protein S21P [Marivirga tractuosa DSM 4126]
          Length = 63

 Score = 34.9 bits (79), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 33/57 (57%), Gaps = 1/57 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           + V V++N  +++AL+  KKK +  G L+E++ R H+ KPS  R +    A  R +
Sbjct: 1  MIVVNVKENESIDKALKRFKKKFEKTGALKEVRSRQHFVKPSVARRKEVIRAAYRQK 57


>gi|261880905|ref|ZP_06007332.1| 30S ribosomal protein S21 [Prevotella bergensis DSM 17361]
 gi|270332413|gb|EFA43199.1| 30S ribosomal protein S21 [Prevotella bergensis DSM 17361]
          Length = 63

 Score = 34.9 bits (79), Expect = 3.4,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GVL+EL+ R  ++KPS  +      A 
Sbjct: 1  MIIVPVKDGENIERALKRFKRKFERTGVLKELRTRQQFDKPSVLKRLKMQRAT 53


>gi|255037675|ref|YP_003088296.1| 30S ribosomal protein S21 [Dyadobacter fermentans DSM 18053]
 gi|254950431|gb|ACT95131.1| ribosomal protein S21 [Dyadobacter fermentans DSM 18053]
          Length = 64

 Score = 34.9 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           + + ++DN  +++AL+  KKK +  G +REL+ R  +EKPS KR      A+ + +
Sbjct: 1  MLIINIKDNESIDRALKRYKKKFERTGTMRELRARTAFEKPSVKRRFEVLRAVYKEK 57


>gi|300864620|ref|ZP_07109478.1| 30S ribosomal protein S21 [Oscillatoria sp. PCC 6506]
 gi|300337369|emb|CBN54626.1| 30S ribosomal protein S21 [Oscillatoria sp. PCC 6506]
          Length = 62

 Score = 34.9 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 14/53 (26%), Positives = 27/53 (50%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
          V+  +  +E ALR  K+++   G+  +++   H+E P +KR R       + R
Sbjct: 5  VIGENEGIESALRRFKRQVSKAGIFPDMRKHRHFETPLEKRKRKAIARRPKRR 57


>gi|197106745|ref|YP_002132122.1| 30S ribosomal protein S21 [Phenylobacterium zucineum HLK1]
 gi|196480165|gb|ACG79693.1| 30S ribosomal protein S21 [Phenylobacterium zucineum HLK1]
          Length = 56

 Score = 34.9 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 33/56 (58%), Positives = 40/56 (71%)

Query: 40 MQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQHR 95
          MQ EG  RE+K   HYEKPS+KR R K+EA+RR+RKL RK AQREG  V+  +  R
Sbjct: 1  MQREGSFREMKRHVHYEKPSEKRARQKAEAVRRARKLARKRAQREGLIVAPKKPGR 56


>gi|78712876|gb|ABB50053.1| SSU ribosomal protein S21P [Prochlorococcus marinus str. MIT
          9312]
          Length = 68

 Score = 34.9 bits (79), Expect = 3.7,   Method: Composition-based stats.
 Identities = 17/56 (30%), Positives = 29/56 (51%), Gaps = 1/56 (1%)

Query: 21 YVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
           V V +N  +E ALR  K+++   G+  +LK   H+E P +K  R   +  +  R+
Sbjct: 13 QVTVGENEGIESALRRFKRQVSKSGIFADLKRLRHHETPIEKYKRKLQQRRKARRR 68


>gi|31789380|gb|AAP58497.1| putative 30S ribosomal protein [uncultured Acidobacteria
          bacterium]
          Length = 65

 Score = 34.9 bits (79), Expect = 3.8,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
             V V++   +E ALR  K+K+Q E +++++K    Y KP  +R   ++ A
Sbjct: 1  MAEVKVQEGESIESALRRFKRKVQQEDIIKDIKKHSFYLKPGDRRRAKQALA 52


>gi|149195382|ref|ZP_01872467.1| 30S ribosomal protein S21 [Caminibacter mediatlanticus TB-2]
 gi|149134473|gb|EDM22964.1| 30S ribosomal protein S21 [Caminibacter mediatlanticus TB-2]
          Length = 70

 Score = 34.9 bits (79), Expect = 3.9,   Method: Composition-based stats.
 Identities = 12/58 (20%), Positives = 29/58 (50%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           + E A R  K+++    ++ E++ R  Y  PS++R + K    ++  + +  + + E
Sbjct: 10 EDFESAYRKFKRQVDRNLIVVEVRKRRFYIPPSERRKQEKIATRKKILRKLWMLRRYE 67


>gi|160888417|ref|ZP_02069420.1| hypothetical protein BACUNI_00834 [Bacteroides uniformis ATCC
          8492]
 gi|270294769|ref|ZP_06200970.1| 30S ribosomal protein S21 [Bacteroides sp. D20]
 gi|317477768|ref|ZP_07936961.1| ribosomal protein S21 [Bacteroides sp. 4_1_36]
 gi|319900907|ref|YP_004160635.1| SSU ribosomal protein S21P [Bacteroides helcogenes P 36-108]
 gi|329962249|ref|ZP_08300255.1| ribosomal protein S21 [Bacteroides fluxus YIT 12057]
 gi|156862094|gb|EDO55525.1| hypothetical protein BACUNI_00834 [Bacteroides uniformis ATCC
          8492]
 gi|270274016|gb|EFA19877.1| 30S ribosomal protein S21 [Bacteroides sp. D20]
 gi|316906113|gb|EFV27874.1| ribosomal protein S21 [Bacteroides sp. 4_1_36]
 gi|319415938|gb|ADV43049.1| SSU ribosomal protein S21P [Bacteroides helcogenes P 36-108]
 gi|328530357|gb|EGF57234.1| ribosomal protein S21 [Bacteroides fluxus YIT 12057]
          Length = 63

 Score = 34.9 bits (79), Expect = 4.1,   Method: Composition-based stats.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  G ++EL+ R  ++KPS  +   K  A+
Sbjct: 1  MIVVPVKEGENIEKALKKFKRKFEKTGTVKELRRRQQFDKPSVTKRLKKERAV 53


>gi|149372374|ref|ZP_01891562.1| 30S ribosomal protein S21 [unidentified eubacterium SCB49]
 gi|149354764|gb|EDM43327.1| 30S ribosomal protein S21 [unidentified eubacterium SCB49]
          Length = 64

 Score = 34.9 bits (79), Expect = 4.2,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
           + + V+D  N+++AL+  K+K    G +R+L+ R  + KPS  R +   +A
Sbjct: 1  MLIIPVKDGENIDRALKRFKRKFDRTGTMRQLRSRQAFSKPSVVRRKQIQKA 52


>gi|282896318|ref|ZP_06304340.1| Ribosomal protein S21 [Raphidiopsis brookii D9]
 gi|282900574|ref|ZP_06308516.1| Ribosomal protein S21 [Cylindrospermopsis raciborskii CS-505]
 gi|281194374|gb|EFA69329.1| Ribosomal protein S21 [Cylindrospermopsis raciborskii CS-505]
 gi|281198814|gb|EFA73693.1| Ribosomal protein S21 [Raphidiopsis brookii D9]
          Length = 64

 Score = 34.9 bits (79), Expect = 4.2,   Method: Composition-based stats.
 Identities = 14/60 (23%), Positives = 31/60 (51%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
          VL  +  +E ALR  K+++   G+ ++++   H+E P +K  R      ++ R+   ++ 
Sbjct: 5  VLGENEGIESALRRFKREVSKAGIFQDMRKNRHFETPLEKEKRKAIARHKQRRQQRTRLK 64


>gi|332533290|ref|ZP_08409156.1| diguanylate cyclase/phosphodiesterase [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332037172|gb|EGI73628.1| diguanylate cyclase/phosphodiesterase [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 673

 Score = 34.9 bits (79), Expect = 4.2,   Method: Composition-based stats.
 Identities = 14/54 (25%), Positives = 21/54 (38%)

Query: 4   FNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEK 57
           FNA      +        V +R N +E A   L++    +G+      R  YEK
Sbjct: 209 FNAMLYNIEQRENSLENQVRLRTNELENANIQLQQYAYQDGLTDLPNRRYFYEK 262


>gi|187931530|ref|YP_001891514.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          mediasiatica FSC147]
 gi|187712439|gb|ACD30736.1| 30S ribosomal protein S21 [Francisella tularensis subsp.
          mediasiatica FSC147]
          Length = 66

 Score = 34.9 bits (79), Expect = 4.3,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 31/51 (60%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           + +LR  K+  +  G+ +EL+ R HY KP+QKR   K  AI +++K  R+
Sbjct: 12 FDISLRNFKRACEKAGIKQELRDRQHYVKPTQKRKIAKKAAISKAKKEARR 62


>gi|54113731|gb|AAV29499.1| NT02FT0934 [synthetic construct]
          Length = 66

 Score = 34.9 bits (79), Expect = 4.3,   Method: Composition-based stats.
 Identities = 19/51 (37%), Positives = 31/51 (60%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           + +LR  K+  +  G+ +EL+ R HY KP+QKR   K  AI +++K  R+
Sbjct: 12 FDISLRNFKRACEKAGIKQELRDRQHYVKPTQKRKIAKKAAISKAKKEARR 62


>gi|268317916|ref|YP_003291635.1| 30S ribosomal protein S21 [Rhodothermus marinus DSM 4252]
 gi|262335450|gb|ACY49247.1| ribosomal protein S21 [Rhodothermus marinus DSM 4252]
          Length = 67

 Score = 34.9 bits (79), Expect = 4.3,   Method: Composition-based stats.
 Identities = 18/59 (30%), Positives = 34/59 (57%), Gaps = 1/59 (1%)

Query: 18 SAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
            V + VR+N  +++ LR  K+ +    +LRE +    Y KPS++R   + +A+R +R+
Sbjct: 4  PGVGIKVRENEPIDRVLRRFKRAVNRSKILREYRQHMFYIKPSEQRRIERQKALRNARR 62


>gi|159462500|ref|XP_001689480.1| plastid ribosomal protein S21 [Chlamydomonas reinhardtii]
 gi|158283468|gb|EDP09218.1| plastid ribosomal protein S21 [Chlamydomonas reinhardtii]
          Length = 184

 Score = 34.9 bits (79), Expect = 4.3,   Method: Composition-based stats.
 Identities = 13/58 (22%), Positives = 25/58 (43%), Gaps = 1/58 (1%)

Query: 14 GREISAVYVLVRDNNVEQ-ALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           ++   V V V ++  E  A+R   K +    V+ +L+ R   E   ++  R   E +
Sbjct: 33 RKDSYMVEVEVAEDEPEDVAVRRYMKLVMQSRVVEKLRARRTKETKIEEYKRRFRERV 90


>gi|153805940|ref|ZP_01958608.1| hypothetical protein BACCAC_00180 [Bacteroides caccae ATCC 43185]
 gi|149130617|gb|EDM21823.1| hypothetical protein BACCAC_00180 [Bacteroides caccae ATCC 43185]
          Length = 63

 Score = 34.9 bits (79), Expect = 4.3,   Method: Composition-based stats.
 Identities = 16/53 (30%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E++L+  K+K +  G+++EL+ R  ++KPS  +   K  A+
Sbjct: 1  MIVVPVKEGENIEKSLKKFKRKFEKTGIVKELRRRQQFDKPSVTKRLKKERAV 53


>gi|320108851|ref|YP_004184441.1| 30S ribosomal protein S21 [Terriglobus saanensis SP1PR4]
 gi|319927372|gb|ADV84447.1| ribosomal protein S21 [Terriglobus saanensis SP1PR4]
          Length = 65

 Score = 34.9 bits (79), Expect = 4.4,   Method: Composition-based stats.
 Identities = 17/52 (32%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
             V V++   +E ALR  K+K+Q E +++E+K    Y KP +K+   ++ A
Sbjct: 1  MAEVRVQEGEPLENALRRFKRKVQQEDIIKEVKRHSFYLKPGEKKRVKEALA 52


>gi|154491731|ref|ZP_02031357.1| hypothetical protein PARMER_01347 [Parabacteroides merdae ATCC
          43184]
 gi|218264365|ref|ZP_03478222.1| hypothetical protein PRABACTJOHN_03918 [Parabacteroides johnsonii
          DSM 18315]
 gi|154087972|gb|EDN87017.1| hypothetical protein PARMER_01347 [Parabacteroides merdae ATCC
          43184]
 gi|218222063|gb|EEC94713.1| hypothetical protein PRABACTJOHN_03918 [Parabacteroides johnsonii
          DSM 18315]
          Length = 63

 Score = 34.9 bits (79), Expect = 4.4,   Method: Composition-based stats.
 Identities = 16/44 (36%), Positives = 28/44 (63%)

Query: 27 NNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           N+E+AL+  K+K +  GV++EL+ R  +EKPS  + +    A+
Sbjct: 10 ENIEKALKKFKRKFEKTGVVKELRNRQAFEKPSVAKRKQTMRAV 53


>gi|213402615|ref|XP_002172080.1| RNA-binding protein [Schizosaccharomyces japonicus yFS275]
 gi|212000127|gb|EEB05787.1| RNA-binding protein [Schizosaccharomyces japonicus yFS275]
          Length = 709

 Score = 34.9 bits (79), Expect = 4.5,   Method: Composition-based stats.
 Identities = 20/60 (33%), Positives = 30/60 (50%), Gaps = 2/60 (3%)

Query: 36  LKKKMQGEGVLRE-LKMRGH-YEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQ 93
            K+    E +L E LK R H +EKP++ RV LK +  R + K   +   R  A V   ++
Sbjct: 650 FKRTTVTETILSETLKRREHEHEKPTEGRVELKQKRRRVAEKDKSQELDRLVASVKNKKK 709


>gi|167035917|ref|YP_001671148.1| hypothetical protein PputGB1_4928 [Pseudomonas putida GB-1]
 gi|166862405|gb|ABZ00813.1| Radical SAM domain protein [Pseudomonas putida GB-1]
          Length = 736

 Score = 34.5 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 15/40 (37%), Positives = 20/40 (50%), Gaps = 2/40 (5%)

Query: 57  KPSQKRVRLKSEAIRRSRKLM--RKIAQREGAPVSRLRQH 94
           KP  KR + K+EA  R+ K    RK A + G    + RQ 
Sbjct: 693 KPWDKREKAKAEAFARNEKAAKERKEAAKGGKGNKKPRQP 732


>gi|163745324|ref|ZP_02152684.1| hypothetical protein OIHEL45_07035 [Oceanibulbus indolifex
          HEL-45]
 gi|161382142|gb|EDQ06551.1| hypothetical protein OIHEL45_07035 [Oceanibulbus indolifex
          HEL-45]
          Length = 37

 Score = 34.5 bits (78), Expect = 4.5,   Method: Composition-based stats.
 Identities = 22/37 (59%), Positives = 30/37 (81%)

Query: 49 LKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREG 85
          +K++ H+EKPS+K  R K+EAIRR+RKL RK  +REG
Sbjct: 1  MKLKQHFEKPSEKNARQKAEAIRRARKLARKKLEREG 37


>gi|298492824|ref|YP_003723001.1| 30S ribosomal protein S21 ['Nostoc azollae' 0708]
 gi|298234742|gb|ADI65878.1| ribosomal protein S21 ['Nostoc azollae' 0708]
          Length = 64

 Score = 34.5 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 14/60 (23%), Positives = 30/60 (50%)

Query: 22 VLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIA 81
          VL  +  +E ALR  K+++   G+ ++++   H+E P +K  R      ++ R+   +  
Sbjct: 5  VLGENEGIESALRRFKREVSKAGIFQDMRKNRHFETPLEKEKRKAIARHKQRRQQRSRFK 64


>gi|167754628|ref|ZP_02426755.1| hypothetical protein CLORAM_00130 [Clostridium ramosum DSM 1402]
 gi|169348395|ref|ZP_02866333.1| hypothetical protein CLOSPI_00110 [Clostridium spiroforme DSM
          1552]
 gi|237733738|ref|ZP_04564219.1| 30S ribosomal protein S21 [Mollicutes bacterium D7]
 gi|167705460|gb|EDS20039.1| hypothetical protein CLORAM_00130 [Clostridium ramosum DSM 1402]
 gi|169293864|gb|EDS75997.1| hypothetical protein CLOSPI_00110 [Clostridium spiroforme DSM
          1552]
 gi|229383076|gb|EEO33167.1| 30S ribosomal protein S21 [Coprobacillus sp. D7]
          Length = 60

 Score = 34.5 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 16/57 (28%), Positives = 28/57 (49%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           A  V+  + +++ ALR  K+++   G L E + R  Y KP  KR      A + ++
Sbjct: 1  MAKTVVRENESLDDALRRFKRQVSRTGTLAEARKREFYVKPGLKRKLKSEAARKNNK 57


>gi|282858398|ref|ZP_06267578.1| ribosomal protein S21 [Prevotella bivia JCVIHMP010]
 gi|282588846|gb|EFB93971.1| ribosomal protein S21 [Prevotella bivia JCVIHMP010]
          Length = 63

 Score = 34.5 bits (78), Expect = 4.6,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  ++KPS K+      A+
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRSRQQFDKPSVKKRLKMERAV 53


>gi|70991058|ref|XP_750378.1| small nucleolar ribonucleoprotein complex subunit (SOF1), putative
           [Aspergillus fumigatus Af293]
 gi|66848010|gb|EAL88340.1| small nucleolar ribonucleoprotein complex subunit (SOF1), putative
           [Aspergillus fumigatus Af293]
 gi|159130852|gb|EDP55965.1| small nucleolar ribonucleoprotein complex subunit (SOF1), putative
           [Aspergillus fumigatus A1163]
          Length = 476

 Score = 34.5 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 28  NVEQALRVLKKKMQGEGVLRELKM--RGHYEKPSQKR----VRLKSEAIRRSRKLMRKIA 81
             +QAL      +     + E++   R  +   + K+     R +  AI+R  + +RK A
Sbjct: 402 EYDQAL------ITRYSHMPEIRRIKRQRHVPRTVKKAAEIKREELAAIKRREENVRKHA 455

Query: 82  QREGAPVSRLRQHR 95
           ++   P  R  + +
Sbjct: 456 KKGALPPRRSEREK 469


>gi|188995444|ref|YP_001929696.1| 30S ribosomal protein S21 [Porphyromonas gingivalis ATCC 33277]
 gi|226695035|sp|B2RL54|RS21_PORG3 RecName: Full=30S ribosomal protein S21
 gi|188595124|dbj|BAG34099.1| putative 30S ribosomal protein S21 [Porphyromonas gingivalis ATCC
          33277]
          Length = 63

 Score = 34.5 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  G +REL+ R  +EKPS  + +   +AI
Sbjct: 1  MIVVPVKEGENIERALKRFKRKFEKTGAVRELRARQAFEKPSVAKRKKMQKAI 53


>gi|34540213|ref|NP_904692.1| 30S ribosomal protein S21 [Porphyromonas gingivalis W83]
 gi|81707502|sp|Q7MX34|RS21_PORGI RecName: Full=30S ribosomal protein S21
 gi|34396525|gb|AAQ65591.1| ribosomal protein S21 [Porphyromonas gingivalis W83]
          Length = 63

 Score = 34.5 bits (78), Expect = 4.8,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  G +REL+ R  +EKPS  + +   +AI
Sbjct: 1  MIVVPVKEGENIERALKRFKRKFEKTGAVRELRARQAFEKPSVAKRKKMQKAI 53


>gi|322436991|ref|YP_004219203.1| ribosomal protein S21 [Acidobacterium sp. MP5ACTX9]
 gi|321164718|gb|ADW70423.1| ribosomal protein S21 [Acidobacterium sp. MP5ACTX9]
          Length = 65

 Score = 34.5 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 16/52 (30%), Positives = 30/52 (57%), Gaps = 1/52 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
             + V++   +E ALR  K+K+Q E +++E+K    Y KP +K+   ++ A
Sbjct: 1  MAEIRVQEGEPLENALRRFKRKVQTEDIIKEVKRHSFYLKPGEKKRVKEALA 52


>gi|256819667|ref|YP_003140946.1| 30S ribosomal protein S21 [Capnocytophaga ochracea DSM 7271]
 gi|256581250|gb|ACU92385.1| ribosomal protein S21 [Capnocytophaga ochracea DSM 7271]
          Length = 64

 Score = 34.5 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 26/41 (63%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
          +++AL+  K+K    GV+REL+ R H+ KPS +R     +A
Sbjct: 12 IDKALKRYKRKFDRTGVVRELRERQHFTKPSVRRRAEIQKA 52


>gi|220909893|ref|YP_002485204.1| 30S ribosomal protein S21 [Cyanothece sp. PCC 7425]
 gi|219866504|gb|ACL46843.1| ribosomal protein S21 [Cyanothece sp. PCC 7425]
          Length = 62

 Score = 34.5 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 13/50 (26%), Positives = 28/50 (56%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMR 78
          +E ALR  K+++   G+  ++K + H+E P ++R R +    ++ +   R
Sbjct: 12 IESALRRFKRQVARAGIFMDMKKKRHFETPIERRKRKELAKHKQQKHKFR 61


>gi|189501599|ref|YP_001957316.1| 30S ribosomal protein S21 [Candidatus Amoebophilus asiaticus 5a2]
 gi|226694969|sp|B3EUG8|RS21_AMOA5 RecName: Full=30S ribosomal protein S21
 gi|189497040|gb|ACE05587.1| ribosomal protein S21 [Candidatus Amoebophilus asiaticus 5a2]
          Length = 64

 Score = 34.5 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 24/57 (42%), Positives = 35/57 (61%), Gaps = 1/57 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           + V V+DN  +E+AL+  KKK+    VL+E+K R +Y KPS KR   K +AI +  
Sbjct: 1  MIVVQVKDNEPIERALKRFKKKIDRVKVLKEVKSRRYYTKPSIKRREEKLKAIYKQH 57


>gi|146299693|ref|YP_001194284.1| 30S ribosomal protein S21 [Flavobacterium johnsoniae UW101]
 gi|189044901|sp|A5FIL0|RS21_FLAJO RecName: Full=30S ribosomal protein S21
 gi|146154111|gb|ABQ04965.1| 30S ribosomal protein S21 [Flavobacterium johnsoniae UW101]
          Length = 64

 Score = 34.5 bits (78), Expect = 5.0,   Method: Composition-based stats.
 Identities = 13/46 (28%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRV 63
           + + ++D  N+++AL+  K+K    G +R+L+ R  + KPS  + 
Sbjct: 1  MLIIPIKDGENIDRALKRYKRKFDKTGTVRQLRARTAFIKPSVVKR 46


>gi|298373090|ref|ZP_06983080.1| ribosomal protein S21 [Bacteroidetes oral taxon 274 str. F0058]
 gi|298275994|gb|EFI17545.1| ribosomal protein S21 [Bacteroidetes oral taxon 274 str. F0058]
          Length = 63

 Score = 34.5 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++   +E+AL+  K+K +  GV+REL+ R  + KPS  +   K  A+
Sbjct: 1  MIVVPVKEGEAIEKALKKFKRKYEKTGVVRELRRRQAFHKPSVVKREAKMHAV 53


>gi|257091833|ref|YP_003165474.1| transposase IS66 [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
 gi|257044357|gb|ACV33545.1| transposase IS66 [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
          Length = 564

 Score = 34.5 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 18/58 (31%), Positives = 29/58 (50%), Gaps = 2/58 (3%)

Query: 36  LKKKMQG-EGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLR 92
           L+ +++  EG LR+L+ R    K S++R R + +A    +K  R   QR G      R
Sbjct: 76  LRSELEKAEGKLRDLQKRLFGRK-SERRSRTEKDAASNDQKSARPRGQRPGVAGHGRR 132


>gi|17554250|ref|NP_497413.1| hypothetical protein M01G5.1 [Caenorhabditis elegans]
 gi|3329635|gb|AAC26941.1| Hypothetical protein M01G5.1 [Caenorhabditis elegans]
          Length = 889

 Score = 34.5 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 15/57 (26%), Positives = 30/57 (52%), Gaps = 5/57 (8%)

Query: 33  LRVLKKK-----MQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           LR L+KK     ++ E + RE+K R   EK   ++++   E ++   K  +K  +++
Sbjct: 89  LRELRKKQRERRLEAEKIAREIKKRETDEKREAEKLKKMDEKLKIQEKKQQKDDEKQ 145


>gi|213963006|ref|ZP_03391265.1| ribosomal protein S21 [Capnocytophaga sputigena Capno]
 gi|315225124|ref|ZP_07866941.1| 30S ribosomal protein S21 [Capnocytophaga ochracea F0287]
 gi|213954347|gb|EEB65670.1| ribosomal protein S21 [Capnocytophaga sputigena Capno]
 gi|314944807|gb|EFS96839.1| 30S ribosomal protein S21 [Capnocytophaga ochracea F0287]
          Length = 64

 Score = 34.5 bits (78), Expect = 5.1,   Method: Composition-based stats.
 Identities = 16/41 (39%), Positives = 26/41 (63%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
          +++AL+  K+K    GV+REL+ R H+ KPS +R     +A
Sbjct: 12 IDKALKRYKRKFDRTGVVRELRERQHFTKPSVRRRAEIQKA 52


>gi|78184538|ref|YP_376973.1| 30S ribosomal protein S21 [Synechococcus sp. CC9902]
 gi|78212597|ref|YP_381376.1| 30S ribosomal protein S21 [Synechococcus sp. CC9605]
 gi|116070798|ref|ZP_01468067.1| ribosomal protein S21 [Synechococcus sp. BL107]
 gi|119367334|sp|Q3AY98|RS21_SYNS9 RecName: Full=30S ribosomal protein S21
 gi|119367335|sp|Q3AKR1|RS21_SYNSC RecName: Full=30S ribosomal protein S21
 gi|78168832|gb|ABB25929.1| SSU ribosomal protein S21P [Synechococcus sp. CC9902]
 gi|78197056|gb|ABB34821.1| ribosomal protein S21 [Synechococcus sp. CC9605]
 gi|116066203|gb|EAU71960.1| ribosomal protein S21 [Synechococcus sp. BL107]
          Length = 58

 Score = 34.5 bits (78), Expect = 5.2,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 28/58 (48%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             V V +N  +E ALR  K+ +   G+  +L+   H+E P +K  R   +  R  R+
Sbjct: 1  MSQVTVGENEGIESALRRFKRSVAKAGIFSDLRRIRHHETPVEKYKRKLKQRSRNRRR 58


>gi|307565744|ref|ZP_07628213.1| 30S ribosomal protein S21 [Prevotella amnii CRIS 21A-A]
 gi|307345570|gb|EFN90938.1| 30S ribosomal protein S21 [Prevotella amnii CRIS 21A-A]
          Length = 63

 Score = 34.5 bits (78), Expect = 5.2,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V+D  N+E+AL+  K+K +  GV++EL+ R  ++KPS K+      AI
Sbjct: 1  MIIVPVKDGENIERALKKFKRKFEKTGVVKELRSRQQFDKPSVKKRLKMERAI 53


>gi|194214342|ref|XP_001915305.1| PREDICTED: F-box and leucine-rich repeat protein 10 [Equus
           caballus]
          Length = 1266

 Score = 34.5 bits (78), Expect = 5.3,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 15/84 (17%)

Query: 25  RDNNVEQALRVLK----KKMQGEGVLRE------LKMRGHYEKPSQ---KRVRLKSEAIR 71
           R +  E+A R       KK+  +G+LR       L+ +  YEKP +   ++     +  +
Sbjct: 727 RRSECEEAPRRRSDEHPKKVPPDGILRRKSDDVHLRRKRKYEKPQELSGRKRLKPGKEDK 786

Query: 72  RSRKLMR--KIAQREGAPVSRLRQ 93
             RK  R  K A+   A  ++  +
Sbjct: 787 LFRKKRRSWKNAEDRMALANKPLR 810


>gi|319937477|ref|ZP_08011882.1| 30S ribosomal protein S21 [Coprobacillus sp. 29_1]
 gi|319807317|gb|EFW03926.1| 30S ribosomal protein S21 [Coprobacillus sp. 29_1]
          Length = 60

 Score = 34.5 bits (78), Expect = 5.4,   Method: Composition-based stats.
 Identities = 17/60 (28%), Positives = 28/60 (46%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
           A  V+  + +++ ALR  K+++   G L+E + R  Y KP  KR      A +   K  
Sbjct: 1  MAKTVVRDNESLDDALRRFKRQVSRTGTLQEARKREFYVKPGLKRKMKSEAARKNKGKQR 60


>gi|118497321|ref|YP_898371.1| 30S ribosomal protein S21 [Francisella tularensis subsp. novicida
          U112]
 gi|195536007|ref|ZP_03079014.1| ribosomal protein S21 [Francisella tularensis subsp. novicida
          FTE]
 gi|118423227|gb|ABK89617.1| 30S ribosomal protein S21 [Francisella novicida U112]
 gi|194372484|gb|EDX27195.1| ribosomal protein S21 [Francisella tularensis subsp. novicida
          FTE]
          Length = 66

 Score = 34.5 bits (78), Expect = 5.4,   Method: Composition-based stats.
 Identities = 18/51 (35%), Positives = 31/51 (60%)

Query: 29 VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
           + +LR  K+  +  G+ +EL+ + HY KP+QKR   K  AI +++K  R+
Sbjct: 12 FDISLRNFKRACEKAGIKQELRDKQHYVKPTQKRKIAKKAAISKAKKEARR 62


>gi|330997395|ref|ZP_08321246.1| ribosomal protein S21 [Paraprevotella xylaniphila YIT 11841]
 gi|329570769|gb|EGG52485.1| ribosomal protein S21 [Paraprevotella xylaniphila YIT 11841]
          Length = 63

 Score = 34.5 bits (78), Expect = 5.5,   Method: Composition-based stats.
 Identities = 19/53 (35%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  GV++EL+ R  ++KPS  +   K  AI
Sbjct: 1  MIVVPVKEGENIERALKKFKRKFEKTGVVKELRRRQQFDKPSVVKRLAKERAI 53


>gi|294102419|ref|YP_003554277.1| ribosomal protein S21 [Aminobacterium colombiense DSM 12261]
 gi|293617399|gb|ADE57553.1| ribosomal protein S21 [Aminobacterium colombiense DSM 12261]
          Length = 62

 Score = 34.5 bits (78), Expect = 5.5,   Method: Composition-based stats.
 Identities = 17/51 (33%), Positives = 29/51 (56%)

Query: 18 SAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSE 68
              +   + ++E ALR  K+++   G LRE + R HYEKPS+ +   ++E
Sbjct: 1  MTTIIRKDNESLEDALRRFKREVSKVGTLREARKREHYEKPSEVKKAKRAE 51


>gi|156368165|ref|XP_001627566.1| predicted protein [Nematostella vectensis]
 gi|156214480|gb|EDO35466.1| predicted protein [Nematostella vectensis]
          Length = 460

 Score = 34.5 bits (78), Expect = 5.8,   Method: Composition-based stats.
 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%)

Query: 57  KPSQK-RVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQH 94
           K +++ + R KSEAIRR RK  +   +RE A   R+++ 
Sbjct: 144 KETERLKRRAKSEAIRRMRKQSKMQQEREKAYEKRVQRE 182


>gi|293400694|ref|ZP_06644839.1| ribosomal protein S21 [Erysipelotrichaceae bacterium 5_2_54FAA]
 gi|291305720|gb|EFE46964.1| ribosomal protein S21 [Erysipelotrichaceae bacterium 5_2_54FAA]
          Length = 59

 Score = 34.5 bits (78), Expect = 5.8,   Method: Composition-based stats.
 Identities = 18/57 (31%), Positives = 28/57 (49%), Gaps = 1/57 (1%)

Query: 19 AVYVLVRDNNV-EQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
             V+V++N V + ALR  K+++   G L E + R  Y KP  +R      A +  R
Sbjct: 1  MPKVVVKENEVLDDALRRFKRQVSRNGTLAEARKREFYVKPGVRRKLKSEAARKARR 57


>gi|218777969|ref|YP_002429287.1| ribosomal protein S21 [Desulfatibacillum alkenivorans AK-01]
 gi|218759353|gb|ACL01819.1| ribosomal protein S21 [Desulfatibacillum alkenivorans AK-01]
          Length = 66

 Score = 34.5 bits (78), Expect = 5.8,   Method: Composition-based stats.
 Identities = 28/65 (43%), Positives = 46/65 (70%)

Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + V V+DN +E+A++VLKK ++ EGVL +LK +  YEKPS K+ R +++A +R R++  +
Sbjct: 1  MQVTVQDNQLERAVKVLKKMLRKEGVLTQLKEKRFYEKPSVKKRRKRAKAAKRRRRIELR 60

Query: 80 IAQRE 84
            QR 
Sbjct: 61 ANQRR 65


>gi|73994539|ref|XP_860244.1| PREDICTED: similar to F-box and leucine-rich repeat protein 10
           isoform b isoform 6 [Canis familiaris]
          Length = 1270

 Score = 34.1 bits (77), Expect = 5.9,   Method: Composition-based stats.
 Identities = 20/84 (23%), Positives = 36/84 (42%), Gaps = 15/84 (17%)

Query: 25  RDNNVEQALRVLK----KKMQGEGVLRE------LKMRGHYEKPSQ---KRVRLKSEAIR 71
           R +  E+A R       KK+  +G+LR       L+ +  YEKP +   ++     +  +
Sbjct: 740 RRSECEEAPRRRSDEHPKKVPPDGILRRKSDDVHLRRKRKYEKPQELSGRKRLKPGKEDK 799

Query: 72  RSRKLMR--KIAQREGAPVSRLRQ 93
             RK  R  K A+   A  ++  +
Sbjct: 800 LFRKKRRSWKNAEDRMALANKPLR 823


>gi|255946730|ref|XP_002564132.1| Pc22g00870 [Penicillium chrysogenum Wisconsin 54-1255]
 gi|211591149|emb|CAP97375.1| Pc22g00870 [Penicillium chrysogenum Wisconsin 54-1255]
          Length = 1140

 Score = 34.1 bits (77), Expect = 6.1,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 28/64 (43%), Gaps = 10/64 (15%)

Query: 31   QALRVLKKKMQGEGVLRELKMRGHY---------EK-PSQKRVRLKSEAIRRSRKLMRKI 80
            QAL   +KK    G +R  + +  +         EK   +K VR + E  RR +K   + 
Sbjct: 979  QALTASEKKALRAGNMRLFRAKRRFSDIEDGEEEEKADQEKVVRERIETQRRQKKQEHER 1038

Query: 81   AQRE 84
             +RE
Sbjct: 1039 KRRE 1042


>gi|297748472|gb|ADI51018.1| SSU ribosomal protein S21P [Chlamydia trachomatis D-EC]
 gi|297749352|gb|ADI52030.1| SSU ribosomal protein S21P [Chlamydia trachomatis D-LC]
          Length = 78

 Score = 34.1 bits (77), Expect = 6.2,   Method: Composition-based stats.
 Identities = 18/46 (39%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 16 EISAVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQ 60
           +    V VR    +++ALR+LKKK+  EG+L+  K    Y+KPS 
Sbjct: 18 RLFMPSVKVRVGEPIDRALRILKKKIDKEGILKTSKSHRFYDKPSV 63


>gi|333029647|ref|ZP_08457708.1| 30S ribosomal protein S21 [Bacteroides coprosuis DSM 18011]
 gi|332740244|gb|EGJ70726.1| 30S ribosomal protein S21 [Bacteroides coprosuis DSM 18011]
          Length = 63

 Score = 34.1 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 33/53 (62%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  G+++EL+ R  Y+KPS +    +  AI
Sbjct: 1  MIVVPVKEGENIERALKKFKRKFERTGIVKELRRRQQYDKPSVRNRFKRERAI 53


>gi|57234890|ref|YP_181097.1| 30S ribosomal protein S21 [Dehalococcoides ethenogenes 195]
 gi|73748200|ref|YP_307439.1| 30S ribosomal protein S21 [Dehalococcoides sp. CBDB1]
 gi|147668975|ref|YP_001213793.1| 30S ribosomal protein S21 [Dehalococcoides sp. BAV1]
 gi|270307721|ref|YP_003329779.1| ribosomal protein S21 [Dehalococcoides sp. VS]
 gi|289432250|ref|YP_003462123.1| ribosomal protein S21 [Dehalococcoides sp. GT]
 gi|119367253|sp|Q3Z9K2|RS21_DEHE1 RecName: Full=30S ribosomal protein S21
 gi|119367254|sp|Q3ZZ95|RS21_DEHSC RecName: Full=30S ribosomal protein S21
 gi|189044898|sp|A5FSB3|RS21_DEHSB RecName: Full=30S ribosomal protein S21
 gi|57225338|gb|AAW40395.1| ribosomal protein S21 [Dehalococcoides ethenogenes 195]
 gi|73659916|emb|CAI82523.1| ribosomal protein S21 [Dehalococcoides sp. CBDB1]
 gi|146269923|gb|ABQ16915.1| SSU ribosomal protein S21P [Dehalococcoides sp. BAV1]
 gi|270153613|gb|ACZ61451.1| ribosomal protein S21 [Dehalococcoides sp. VS]
 gi|288945970|gb|ADC73667.1| ribosomal protein S21 [Dehalococcoides sp. GT]
          Length = 64

 Score = 34.1 bits (77), Expect = 6.4,   Method: Composition-based stats.
 Identities = 16/54 (29%), Positives = 29/54 (53%)

Query: 26 DNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRK 79
          + + E  L+   +K+Q +G+L E + R  +E+P  +R R  +   R + K  RK
Sbjct: 9  NESFESMLKRFNRKVQQDGILSEARRRTRFERPPTRRKRKDAAKRRLAIKAARK 62


>gi|289811794|ref|ZP_06542423.1| 30S ribosomal protein S21 [Salmonella enterica subsp. enterica
          serovar Typhi str. AG3]
          Length = 52

 Score = 34.1 bits (77), Expect = 6.5,   Method: Composition-based stats.
 Identities = 14/39 (35%), Positives = 21/39 (53%), Gaps = 1/39 (2%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYE 56
             + VR+N   + ALR  K+  +  GVL E++ R  YE
Sbjct: 1  MPVIKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYE 39


>gi|150003404|ref|YP_001298148.1| 30S ribosomal protein S21 [Bacteroides vulgatus ATCC 8482]
 gi|212695322|ref|ZP_03303450.1| hypothetical protein BACDOR_04867 [Bacteroides dorei DSM 17855]
 gi|237711656|ref|ZP_04542137.1| 30S ribosomal protein S21 [Bacteroides sp. 9_1_42FAA]
 gi|237725902|ref|ZP_04556383.1| 30S ribosomal protein S21 [Bacteroides sp. D4]
 gi|254881305|ref|ZP_05254015.1| 30S ribosomal protein S21 [Bacteroides sp. 4_3_47FAA]
 gi|265753076|ref|ZP_06088645.1| 30S ribosomal protein S21 [Bacteroides sp. 3_1_33FAA]
 gi|294777806|ref|ZP_06743250.1| ribosomal protein S21 [Bacteroides vulgatus PC510]
 gi|319640307|ref|ZP_07995032.1| 30S ribosomal protein S21 [Bacteroides sp. 3_1_40A]
 gi|166224011|sp|A6KYL2|RS21_BACV8 RecName: Full=30S ribosomal protein S21
 gi|149931828|gb|ABR38526.1| 30S ribosomal protein S21 [Bacteroides vulgatus ATCC 8482]
 gi|212662232|gb|EEB22806.1| hypothetical protein BACDOR_04867 [Bacteroides dorei DSM 17855]
 gi|229435710|gb|EEO45787.1| 30S ribosomal protein S21 [Bacteroides dorei 5_1_36/D4]
 gi|229454351|gb|EEO60072.1| 30S ribosomal protein S21 [Bacteroides sp. 9_1_42FAA]
 gi|254834098|gb|EET14407.1| 30S ribosomal protein S21 [Bacteroides sp. 4_3_47FAA]
 gi|263236262|gb|EEZ21757.1| 30S ribosomal protein S21 [Bacteroides sp. 3_1_33FAA]
 gi|294448260|gb|EFG16816.1| ribosomal protein S21 [Bacteroides vulgatus PC510]
 gi|317388082|gb|EFV68936.1| 30S ribosomal protein S21 [Bacteroides sp. 3_1_40A]
          Length = 63

 Score = 34.1 bits (77), Expect = 6.7,   Method: Composition-based stats.
 Identities = 18/53 (33%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++  N+E+AL+  K+K +  GV++EL+ R  ++KPS      +  AI
Sbjct: 1  MIVVPVKEGENIEKALKKFKRKFEKTGVVKELRARQQFDKPSVLNRLKRERAI 53


>gi|119496529|ref|XP_001265038.1| small nucleolar ribonucleoprotein complex subunit (SOF1), putative
           [Neosartorya fischeri NRRL 181]
 gi|119413200|gb|EAW23141.1| small nucleolar ribonucleoprotein complex subunit (SOF1), putative
           [Neosartorya fischeri NRRL 181]
          Length = 457

 Score = 34.1 bits (77), Expect = 6.7,   Method: Composition-based stats.
 Identities = 15/74 (20%), Positives = 31/74 (41%), Gaps = 12/74 (16%)

Query: 28  NVEQALRVLKKKMQGEGVLRELKM--RGHYEKPSQKR----VRLKSEAIRRSRKLMRKIA 81
             +QAL      +     + E++   R  +   + K+     R +  AI+R  + +RK A
Sbjct: 383 EYDQAL------ITRYSHMPEIRRIKRQRHVPRTVKKAAEIKREELAAIKRREENVRKHA 436

Query: 82  QREGAPVSRLRQHR 95
           ++   P  R  + +
Sbjct: 437 KKGALPPRRSEREK 450


>gi|309355528|emb|CAS00932.1| hypothetical protein CBG_26851 [Caenorhabditis briggsae AF16]
          Length = 1306

 Score = 34.1 bits (77), Expect = 6.9,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 17/38 (44%)

Query: 57 KPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQH 94
          KPSQKR     +A    +KL RK  + E     R R  
Sbjct: 45 KPSQKRRLAMKKAETAEKKLQRKDEESEEITAKRRRLD 82


>gi|227536509|ref|ZP_03966558.1| possible ribosomal protein S21 [Sphingobacterium spiritivorum
          ATCC 33300]
 gi|300773597|ref|ZP_07083466.1| 30S ribosomal protein S21 [Sphingobacterium spiritivorum ATCC
          33861]
 gi|227243586|gb|EEI93601.1| possible ribosomal protein S21 [Sphingobacterium spiritivorum
          ATCC 33300]
 gi|300759768|gb|EFK56595.1| 30S ribosomal protein S21 [Sphingobacterium spiritivorum ATCC
          33861]
          Length = 63

 Score = 33.7 bits (76), Expect = 7.8,   Method: Composition-based stats.
 Identities = 20/53 (37%), Positives = 31/53 (58%), Gaps = 1/53 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
           + V V++   +++AL+  KKK +  GVLREL+ R  +EK S  R     +AI
Sbjct: 1  MIIVNVKEGESLDRALKRFKKKFEKTGVLRELRSRQAFEKKSVTRRIQVKKAI 53


>gi|296421932|ref|XP_002840517.1| hypothetical protein [Tuber melanosporum Mel28]
 gi|295636735|emb|CAZ84708.1| unnamed protein product [Tuber melanosporum]
          Length = 216

 Score = 33.7 bits (76), Expect = 7.9,   Method: Composition-based stats.
 Identities = 16/71 (22%), Positives = 28/71 (39%), Gaps = 1/71 (1%)

Query: 11  FSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70
                  +   V V   ++  AL  L+  +    +  + + +  + +PS KR RLKS   
Sbjct: 135 LPRTGSTAGRTVEVTT-DLSSALSRLRTIIAQNKLRADQREQRFHVRPSLKRKRLKSLRH 193

Query: 71  RRSRKLMRKIA 81
           R+  K   K  
Sbjct: 194 RKRFKDAFKRL 204


>gi|292490203|ref|YP_003525642.1| ribosomal protein S21 [Nitrosococcus halophilus Nc4]
 gi|291578798|gb|ADE13255.1| ribosomal protein S21 [Nitrosococcus halophilus Nc4]
          Length = 71

 Score = 33.7 bits (76), Expect = 8.0,   Method: Composition-based stats.
 Identities = 21/67 (31%), Positives = 36/67 (53%), Gaps = 1/67 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLM 77
             + V++N   + A+R  K+  +  GVL E++ R  YEKP+  R R  + A++RS K +
Sbjct: 1  MPSIRVKENEPFDVAIRRFKRTCEKAGVLSEVRRREFYEKPTAVRKRKAAAAVKRSMKKL 60

Query: 78 RKIAQRE 84
           +   R 
Sbjct: 61 ARERARR 67


>gi|317122983|ref|YP_004102986.1| 30S ribosomal protein S21P [Thermaerobacter marianensis DSM
          12885]
 gi|315592963|gb|ADU52259.1| SSU ribosomal protein S21P [Thermaerobacter marianensis DSM
          12885]
          Length = 59

 Score = 33.7 bits (76), Expect = 8.1,   Method: Composition-based stats.
 Identities = 15/45 (33%), Positives = 28/45 (62%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
           + +++ ALR  ++ M+  G+L E++ R HY+KPS +R +    A
Sbjct: 8  ENESLDDALRRFRQAMRKAGILSEVRRREHYDKPSVRRKKKSDAA 52


>gi|171769783|sp|A2R7P5|NST1_ASPNC RecName: Full=Stress response protein nst1
 gi|134083288|emb|CAK46843.1| unnamed protein product [Aspergillus niger]
          Length = 1201

 Score = 33.7 bits (76), Expect = 8.1,   Method: Composition-based stats.
 Identities = 12/59 (20%), Positives = 26/59 (44%), Gaps = 3/59 (5%)

Query: 35  VLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQ 93
            L+K+ + +  LRE + R       +++ R + E  ++ R+  R+   RE        +
Sbjct: 616 RLRKEAEKQKRLREERERQAEI---ERKQREQKELEKKRREEARQNELREKKTKDERER 671


>gi|126663342|ref|ZP_01734340.1| 30S ribosomal protein S21 [Flavobacteria bacterium BAL38]
 gi|126625000|gb|EAZ95690.1| 30S ribosomal protein S21 [Flavobacteria bacterium BAL38]
          Length = 64

 Score = 33.7 bits (76), Expect = 8.1,   Method: Composition-based stats.
 Identities = 14/52 (26%), Positives = 28/52 (53%), Gaps = 1/52 (1%)

Query: 19 AVYVLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEA 69
           + + ++D  N+++AL+  K+K    G +R+L+ R  + KPS        +A
Sbjct: 1  MLIIPIKDGENIDRALKRYKRKFDKTGTVRQLRARQAFIKPSVSNRAKIQKA 52


>gi|309359073|emb|CAR99887.1| hypothetical protein CBG_27608 [Caenorhabditis briggsae AF16]
          Length = 1081

 Score = 33.7 bits (76), Expect = 8.2,   Method: Composition-based stats.
 Identities = 14/38 (36%), Positives = 17/38 (44%)

Query: 57 KPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQH 94
          KPSQKR     +A    +KL RK  + E     R R  
Sbjct: 45 KPSQKRRLAMKKAETAEKKLQRKDEESEEITAKRRRLD 82


>gi|311693208|gb|ADP96081.1| ribosomal protein S21 [marine bacterium HP15]
          Length = 66

 Score = 33.7 bits (76), Expect = 8.4,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 34/59 (57%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQR 83
           +   + ALR  K+  +  GVL E++ R HYEKP+  R R  + A++R  K +++  ++
Sbjct: 3  ENEPFDVALRRFKRSCEKAGVLSEVRRREHYEKPTAVRKRKAAAAVKRHLKKLQREQRK 61


>gi|328724375|ref|XP_001945918.2| PREDICTED: hypothetical protein LOC100161574 [Acyrthosiphon pisum]
          Length = 407

 Score = 33.7 bits (76), Expect = 8.7,   Method: Composition-based stats.
 Identities = 21/77 (27%), Positives = 35/77 (45%), Gaps = 15/77 (19%)

Query: 23  LVRDNNVEQALRVLKKKMQGEG-----VLRELKMRGHYE----------KPSQKRVRLKS 67
            V++NN++  +  LKKK++ +G     + R LK + H E           PSQ     K+
Sbjct: 305 QVQNNNLKNKIYRLKKKIEKDGEYIQSLNRLLKEKEHKEILNANIIGALTPSQLISAKKA 364

Query: 68  EAIRRSRKLMRKIAQRE 84
           +    ++K   K  Q E
Sbjct: 365 KTRLDTKKNKFKERQIE 381


>gi|332664480|ref|YP_004447268.1| 30S ribosomal protein S21 [Haliscomenobacter hydrossis DSM 1100]
 gi|332333294|gb|AEE50395.1| 30S ribosomal protein S21 [Haliscomenobacter hydrossis DSM 1100]
          Length = 67

 Score = 33.7 bits (76), Expect = 9.0,   Method: Composition-based stats.
 Identities = 19/57 (33%), Positives = 34/57 (59%), Gaps = 1/57 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSR 74
           + + ++D   +++AL+  K+K Q  GV++EL+ R  + KPS KR     +AI R +
Sbjct: 1  MLIIEIKDGESIDKALKRYKRKFQNAGVIKELRRRKEFVKPSVKRRGEVLKAIYREK 57


>gi|300112777|ref|YP_003759352.1| 30S ribosomal protein S21 [Nitrosococcus watsonii C-113]
 gi|299538714|gb|ADJ27031.1| ribosomal protein S21 [Nitrosococcus watsonii C-113]
          Length = 71

 Score = 33.7 bits (76), Expect = 9.1,   Method: Composition-based stats.
 Identities = 18/60 (30%), Positives = 32/60 (53%)

Query: 25 RDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQRE 84
           +   + A+R  K+  +  G+L E++ R  YEKP+  R R  + A++RS K + +   R 
Sbjct: 8  ENEPFDVAIRRFKRTCEKAGILSEVRRREFYEKPTAVRKRKAAAAVKRSMKKLARERARR 67


>gi|189491609|dbj|BAG48199.1| chromatin assembly factor-1 [Oryza sativa Japonica Group]
          Length = 940

 Score = 33.7 bits (76), Expect = 9.2,   Method: Composition-based stats.
 Identities = 16/64 (25%), Positives = 31/64 (48%), Gaps = 3/64 (4%)

Query: 30  EQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVS 89
           E+ALR  K++ + E  +++ + +   E   +++ R K EA  R     +K  Q E     
Sbjct: 364 EEALREQKRREKEEAEMKKQQRKQEEEAQKEQKRREKEEAETR---KQQKKQQEEAEKEQ 420

Query: 90  RLRQ 93
           + R+
Sbjct: 421 KRRE 424


>gi|33240041|ref|NP_874983.1| 30S ribosomal protein S21 [Prochlorococcus marinus subsp. marinus
          str. CCMP1375]
 gi|81712820|sp|Q7VCZ9|RS21_PROMA RecName: Full=30S ribosomal protein S21
 gi|33237567|gb|AAP99635.1| Ribosomal protein S21 [Prochlorococcus marinus subsp. marinus
          str. CCMP1375]
          Length = 59

 Score = 33.7 bits (76), Expect = 9.2,   Method: Composition-based stats.
 Identities = 19/59 (32%), Positives = 30/59 (50%), Gaps = 1/59 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKL 76
             V+V +N  VE ALR  K+++   G+  +LK   H+E P +K  R +    R  R+ 
Sbjct: 1  MTQVIVGENEGVESALRRFKREVSKAGIFNDLKRIRHHETPVEKYKRKQRLKNRTKRRR 59


>gi|126696406|ref|YP_001091292.1| 30S ribosomal protein S21 [Prochlorococcus marinus str. MIT 9301]
 gi|166224050|sp|A3PD66|RS21_PROM0 RecName: Full=30S ribosomal protein S21
 gi|126543449|gb|ABO17691.1| 30S Ribosomal protein S21 [Prochlorococcus marinus str. MIT 9301]
          Length = 58

 Score = 33.7 bits (76), Expect = 9.7,   Method: Composition-based stats.
 Identities = 17/58 (29%), Positives = 29/58 (50%), Gaps = 1/58 (1%)

Query: 19 AVYVLVRDNN-VEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75
             V V +N  +E ALR  K+++   G+  +LK   H+E P +K  R   +  +  R+
Sbjct: 1  MTQVTVGENEGIESALRRFKRQVSKSGIFADLKRLRHHETPVEKYKRKLQQRRKARRR 58


  Database: nr
    Posted date:  May 22, 2011 12:22 AM
  Number of letters in database: 999,999,966
  Number of sequences in database:  2,987,313
  
  Database: /data/usr2/db/fasta/nr.01
    Posted date:  May 22, 2011 12:30 AM
  Number of letters in database: 999,999,796
  Number of sequences in database:  2,903,041
  
  Database: /data/usr2/db/fasta/nr.02
    Posted date:  May 22, 2011 12:36 AM
  Number of letters in database: 999,999,281
  Number of sequences in database:  2,904,016
  
  Database: /data/usr2/db/fasta/nr.03
    Posted date:  May 22, 2011 12:41 AM
  Number of letters in database: 999,999,960
  Number of sequences in database:  2,935,328
  
  Database: /data/usr2/db/fasta/nr.04
    Posted date:  May 22, 2011 12:46 AM
  Number of letters in database: 842,794,627
  Number of sequences in database:  2,394,679
  
Lambda     K      H
   0.310    0.151    0.418 

Lambda     K      H
   0.267   0.0464    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 1,080,522,099
Number of Sequences: 14124377
Number of extensions: 60129938
Number of successful extensions: 766336
Number of sequences better than 10.0: 4610
Number of HSP's better than 10.0 without gapping: 2355
Number of HSP's successfully gapped in prelim test: 2255
Number of HSP's that attempted gapping in prelim test: 695550
Number of HSP's gapped (non-prelim): 49006
length of query: 95
length of database: 4,842,793,630
effective HSP length: 64
effective length of query: 31
effective length of database: 3,938,833,502
effective search space: 122103838562
effective search space used: 122103838562
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (20.6 bits)
S2: 76 (33.7 bits)