RPSBLAST alignment of GI: 254780437 and MMDB domain: 3bbn_U_

>3bbn_U (U:) Ribosomal protein S21; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Cucumis sativus}Length = 190
 Score = 72.8 bits (178), Expect = 1e-14
 Identities = 16/92 (17%), Positives = 33/92 (35%)

Query: 4   FNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRV 63
             A+          +   V+  +   E+ L   ++++   GV++E K R  +E     R 
Sbjct: 82  SLAYANTMFFRSAYNVQVVVDDNEPEERLLNRFRREVMRAGVIQECKRRRFFENTQDVRK 141

Query: 64  RLKSEAIRRSRKLMRKIAQREGAPVSRLRQHR 95
           R   EA +R+R+   +               +
Sbjct: 142 RKTREAAKRNRRRRPQARFTPQNKQDVPATKQ 173