RPS-BLAST 2.2.22 [Sep-27-2009] Database: mmdb70 33,805 sequences; 4,956,049 total letters Searching..................................................done Query= gi|254780437|ref|YP_003064850.1| 30S ribosomal protein S21 [Candidatus Liberibacter asiaticus str. psy62] (95 letters) >3bbn_U Ribosomal protein S21; small ribosomal subunit, spinach chloroplast ribosome, ribonucleoprotein particle, macromolecular complex; 9.40A {Cucumis sativus} (U:) Length = 190 Score = 72.8 bits (178), Expect = 1e-14 Identities = 16/92 (17%), Positives = 33/92 (35%) Query: 4 FNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRV 63 A+ + V+ + E+ L ++++ GV++E K R +E R Sbjct: 82 SLAYANTMFFRSAYNVQVVVDDNEPEERLLNRFRREVMRAGVIQECKRRRFFENTQDVRK 141 Query: 64 RLKSEAIRRSRKLMRKIAQREGAPVSRLRQHR 95 R EA +R+R+ + + Sbjct: 142 RKTREAAKRNRRRRPQARFTPQNKQDVPATKQ 173 >3i1m_U 30S ribosomal protein S21; ribosome structure, protein-RNA complex, ribonucleoprotein, ribosomal protein, RNA-binding, rRNA-binding, antibiotic resistance; 3.19A {Escherichia coli k-12} PDB: 1vs7_U* 2avy_U 2aw7_U 2vho_U 2vhp_U 3df1_U* 3df3_U* 3e1a_Q 3e1c_Q 1vs5_U 3i1o_U 3i1q_U 3i1s_U 3i1z_U 3i21_U 2qal_U* 2i2u_U 2i2p_U* 2qan_U* 2qb9_U* ... (U:) Length = 71 Score = 48.9 bits (117), Expect = 2e-07 Identities = 23/64 (35%), Positives = 37/64 (57%), Gaps = 1/64 (1%) Query: 22 VLVRDN-NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRKLMRKI 80 + VR+N + ALR K+ + GVL E++ R YEKP+ +R R K+ A++R K + + Sbjct: 4 IKVRENEPFDVALRRFKRSCEKAGVLAEVRRREFYEKPTTERKRAKASAVKRHAKKLARE 63 Query: 81 AQRE 84 R Sbjct: 64 NARR 67 >1msw_D DNA-directed RNA polymerase, bacteriophage T7 RNA; T7RNAP elongation complex, transcription/DNA/RNA complex; 2.10A {Enterobacteria phage T7} (D:540-565,D:690-779,D:840-883) Length = 160 Score = 24.9 bits (54), Expect = 4.3 Identities = 8/39 (20%), Positives = 16/39 (41%), Gaps = 3/39 (7%) Query: 55 YEKPSQKRVRLKSEAIRRSRKLMRKIAQREGAPVSRLRQ 93 Y+KP Q R+ L R + + + + + +Q Sbjct: 76 YKKPIQTRLNLMFLGQFRLQPTIN---TNKDSEIDAHKQ 111 >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} (D:361-595) Length = 235 Score = 24.5 bits (51), Expect = 5.4 Identities = 5/85 (5%), Positives = 15/85 (17%) Query: 11 FSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAI 70 F I + + + V ++ + + Sbjct: 1 FGSDSGIGQLAAAINRGDKTAVKTVFQQDFTDIEKRLLQSGEDYIAMLEEALAGYGRYLD 60 Query: 71 RRSRKLMRKIAQREGAPVSRLRQHR 95 + + + L R Sbjct: 61 LLQARAEPDLIIQAFNEYQLLCALR 85 >1zvp_A Hypothetical protein VC0802; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Vibrio cholerae} (A:1-22,A:68-133) Length = 88 Score = 24.4 bits (53), Expect = 5.7 Identities = 6/22 (27%), Positives = 12/22 (54%) Query: 21 YVLVRDNNVEQALRVLKKKMQG 42 ++ V+ +QAL+ L + Q Sbjct: 67 HIFVQKEKAQQALQALGEFAQA 88 >2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} (A:) Length = 97 Score = 23.7 bits (51), Expect = 8.1 Identities = 4/19 (21%), Positives = 7/19 (36%) Query: 74 RKLMRKIAQREGAPVSRLR 92 + LM + G +L Sbjct: 50 KTLMSHYEEAMGLSGRKLS 68 >3bu8_A Telomeric repeat-binding factor 2; TRF2 TRFH domain TRF2 dimerization domain TIN2 peptide, alternative splicing, cell cycle, chromosomal protein; 2.15A {Homo sapiens} (A:50-189) Length = 140 Score = 23.6 bits (51), Expect = 9.6 Identities = 9/36 (25%), Positives = 22/36 (61%) Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKM 51 + +AV + +++ E+A ++LKK M + ++L+ Sbjct: 68 KEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRN 103 Database: mmdb70 Posted date: Jun 20, 2010 3:12 AM Number of letters in database: 4,956,049 Number of sequences in database: 33,805 Lambda K H 0.323 0.136 0.367 Gapped Lambda K H 0.267 0.0701 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 33805 Number of Hits to DB: 687,025 Number of extensions: 27450 Number of successful extensions: 168 Number of sequences better than 10.0: 1 Number of HSP's gapped: 168 Number of HSP's successfully gapped: 19 Length of query: 95 Length of database: 4,956,049 Length adjustment: 55 Effective length of query: 40 Effective length of database: 3,096,774 Effective search space: 123870960 Effective search space used: 123870960 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 50 (23.1 bits)