RPS-BLAST 2.2.22 [Sep-27-2009] Database: scop70_1_75 13,730 sequences; 2,407,596 total letters Searching..................................................done Query= gi|254780437|ref|YP_003064850.1| 30S ribosomal protein S21 [Candidatus Liberibacter asiaticus str. psy62] (95 letters) >d1zhva2 d.58.18.8 (A:62-127) Hypothetical protein Atu0741 {Agrobacterium tumefaciens [TaxId: 358]} Length = 66 Score = 24.2 bits (53), Expect = 3.2 Identities = 6/19 (31%), Positives = 12/19 (63%) Query: 21 YVLVRDNNVEQALRVLKKK 39 ++LVR N++E+ +L Sbjct: 43 HLLVRSNDLEKTADLLANA 61 >d1zvpa2 d.58.18.9 (A:68-131) Hypothetical protein VC0802 {Vibrio cholerae [TaxId: 666]} Length = 64 Score = 23.9 bits (52), Expect = 4.3 Identities = 5/18 (27%), Positives = 11/18 (61%) Query: 21 YVLVRDNNVEQALRVLKK 38 ++ V+ +QAL+ L + Sbjct: 44 HIFVQKEKAQQALQALGE 61 >d1uika1 b.82.1.2 (A:148-350) Seed storage 7S protein {Soybean (Glycine max), beta-conglycinin alpha prime subunit [TaxId: 3847]} Length = 203 Score = 23.4 bits (50), Expect = 5.3 Identities = 10/48 (20%), Positives = 22/48 (45%) Query: 28 NVEQALRVLKKKMQGEGVLRELKMRGHYEKPSQKRVRLKSEAIRRSRK 75 E+ +VL + +G+ E + S+K++R S+ + S + Sbjct: 156 KFEEINKVLFGREEGQQQGEERLQESVIVEISKKQIRELSKHAKSSSR 203 >d1h6pa_ a.146.1.1 (A:) TRF2 {Human (Homo sapiens) [TaxId: 9606]} Length = 203 Score = 23.2 bits (50), Expect = 5.4 Identities = 9/36 (25%), Positives = 22/36 (61%) Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKM 51 + +AV + +++ E+A ++LKK M + ++L+ Sbjct: 116 KEAAVIICIKNKEFEKASKILKKHMSKDPTTQKLRN 151 >d1rd5a_ c.1.2.4 (A:) Trp synthase alpha-subunit {Maize (Zea mays) [TaxId: 4577]} Length = 261 Score = 23.2 bits (49), Expect = 5.7 Identities = 6/41 (14%), Positives = 16/41 (39%), Gaps = 1/41 (2%) Query: 5 NAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQGEGV 45 + + ++G+ Y+ D ++ L + + G G Sbjct: 6 DTMAALMAKGKTAFIPYITAGDPDLATTAEAL-RLLDGCGA 45 >d1ujpa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Thermus thermophilus [TaxId: 274]} Length = 271 Score = 23.2 bits (49), Expect = 6.6 Identities = 10/42 (23%), Positives = 17/42 (40%) Query: 1 MLVFNAFRGIFSEGREISAVYVLVRDNNVEQALRVLKKKMQG 42 M AF SEGR Y+ + E L+ +++ + Sbjct: 1 MTTLEAFAKARSEGRAALIPYLTAGFPSREGFLQAVEEVLPY 42 >d1b25a2 d.152.1.1 (A:1-210) Formaldehyde ferredoxin oxidoreductase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 210 Score = 22.7 bits (49), Expect = 8.3 Identities = 8/30 (26%), Positives = 14/30 (46%) Query: 1 MLVFNAFRGIFSEGREISAVYVLVRDNNVE 30 L + + EG+ VY+ + D+NV Sbjct: 100 HLRRAGYDALVVEGKAKKPVYIYIEDDNVS 129 >d3bqoa1 a.146.1.1 (A:62-265) TRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 204 Score = 22.8 bits (49), Expect = 8.4 Identities = 7/36 (19%), Positives = 15/36 (41%) Query: 16 EISAVYVLVRDNNVEQALRVLKKKMQGEGVLRELKM 51 +I A+ V + + N ++A V ++ K Sbjct: 116 KIQAIAVCMENGNFKEAEEVFERIFGDPNSHMPFKS 151 >d1byga_ d.144.1.7 (A:) Carboxyl-terminal src kinase (csk) {Human (Homo sapiens) [TaxId: 9606]} Length = 262 Score = 22.7 bits (48), Expect = 8.6 Identities = 6/32 (18%), Positives = 12/32 (37%), Gaps = 1/32 (3%) Query: 20 VYVLVRDNNVEQALRVLKKKMQGEGVLRELKM 51 V L + A++ +K + L E + Sbjct: 23 VM-LGDYRGNKVAVKCIKNDATAQAFLAEASV 53 Database: scop70_1_75 Posted date: Mar 27, 2010 6:21 PM Number of letters in database: 2,407,596 Number of sequences in database: 13,730 Lambda K H 0.323 0.136 0.367 Gapped Lambda K H 0.267 0.0646 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 13730 Number of Hits to DB: 330,646 Number of extensions: 13648 Number of successful extensions: 75 Number of sequences better than 10.0: 1 Number of HSP's gapped: 75 Number of HSP's successfully gapped: 21 Length of query: 95 Length of database: 2,407,596 Length adjustment: 58 Effective length of query: 37 Effective length of database: 1,611,256 Effective search space: 59616472 Effective search space used: 59616472 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.5 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.5 bits) S2: 47 (22.1 bits)