HHsearch alignment for GI: 254780438 and conserved domain: COG0854

>COG0854 PdxJ Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism].
Probab=100.00  E-value=0  Score=657.31  Aligned_cols=240  Identities=39%  Similarity=0.597  Sum_probs=229.8

Q ss_pred             CCCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHH
Q ss_conf             45332214432232207886899899999999749989998247883348889999988740001367415888348568
Q gi|254780438|r    3 TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNET   82 (261)
Q Consensus         3 t~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e   82 (261)
T Consensus         1 ~~LgVNidhIAtLRnaR~t~~Pd~v~aa~iA~~aGAdgITvHlReDrRHI~d~Dv~~lr~~~-----~~~~NlE~a~teE   75 (243)
T COG0854           1 MLLGVNIDHIATLRNARGTPYPDPVEAAFIAEQAGADGITVHLREDRRHIQDRDVRILRALI-----DTRFNLEMAPTEE   75 (243)
T ss_pred             CCCEECHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCEEECCCCCCCCCCHHHHHHHHHHC-----CCCEECCCCCHHH
T ss_conf             93100189999999724999998799999999739872371458540215144589999971-----3544004374489


Q ss_pred             HHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEEECC
Q ss_conf             99999850721289710165553335782213337889999986202696389972544441479999740661465112
Q gi|254780438|r   83 FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYT  162 (261)
Q Consensus        83 ~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VElhT  162 (261)
T Consensus        76 ml~ia~~~kP~~vtLVPe~r~evTTegGlD~~~~~~~l~~~v~~L~~~GirVSLFiD~d~~q--i~aa~~~gA~~IELhT  153 (243)
T COG0854          76 MLAIALKTKPHQVTLVPEKREEVTTEGGLDVAGQLDKLRDAVRRLKNAGIRVSLFIDPDPEQ--IEAAAEVGAPRIELHT  153 (243)
T ss_pred             HHHHHHHCCCCEEEECCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCHHH--HHHHHHHCCCEEEEEC
T ss_conf             99999855987478578964641455563355002469999999985797699972799899--9999984998799843


Q ss_pred             CCCHHHHH--HHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHH
Q ss_conf             11102444--3564336668899987665415623520789898779999973699638842599999999940999999
Q gi|254780438|r  163 GPYGACYN--NPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF  240 (261)
Q Consensus       163 G~Ya~a~~--~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~  240 (261)
T Consensus       154 G~Ya~~~~~~~~~~~~~el~rl~~~a~~A~~lGL~VnAGHgLty~Nv~~~a-~~~~i~ElnIGH~iia~Av~~Gl~~aV~  232 (243)
T COG0854         154 GPYADAHDAAEQARADAELERLAKAAKLAAELGLKVNAGHGLTYHNVKPLA-AIPPLAELNIGHSIIARAVFVGLEEAVR  232 (243)
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHCCCEEECCCCCCCCCHHHHH-CCCCCEEECCCHHHHHHHHHHHHHHHHH
T ss_conf             665664786778879999999999999999739457458886503628785-4675103411089999999960799999


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999997410
Q gi|254780438|r  241 CFRRACGQHL  250 (261)
Q Consensus       241 ~~~~ii~~~~  250 (261)
T Consensus       233 ~m~~~~~~~~  242 (243)
T COG0854         233 EMKRLMKRAR  242 (243)
T ss_pred             HHHHHHHHCC
T ss_conf             9999987633