HHsearch alignment for GI: 254780438 and conserved domain: PRK05581

>PRK05581 ribulose-phosphate 3-epimerase; Validated.
Probab=93.41  E-value=0.86  Score=26.95  Aligned_cols=162  Identities=15%  Similarity=0.194  Sum_probs=101.2

Q ss_pred             CCCCCCHHHHHHHHCCCCCC--------CCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEE
Q ss_conf             53322144322322078868--------9989999999974998999824788334888999998874000136741588
Q gi|254780438|r    4 SVSVNLNAVAVLRNRRNLPW--------PNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNI   75 (261)
Q Consensus         4 ~LsVNidhiAtLRnaRg~~~--------P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNi   75 (261)
T Consensus        45 n~t~g~~~v~~i~~~--t~~~~DvHLMv~~P~~~i~~~~~~g~d~I~~H~Ea~~------~~~~~i~~ik~~--g~k~Gl  114 (220)
T PRK05581         45 NLTIGPPVVEAIRKV--TKLPLDVHLMVENPDRYVPDFAKAGADIITFHVEASE------HIHRLLQLIKEA--GIKAGL  114 (220)
T ss_pred             CCCCCHHHHHHHHHH--CCCCEEEEEEEECHHHHHHHHHHCCCCEEEECCCCCC------CHHHHHHHHHHC--CCCEEE
T ss_conf             556399999999841--8996478999718888799999739988998167502------799999999974--997046


Q ss_pred             EECCCHHH---HHHHHHHCCCEEEEEECCCCCCCCCCCCCHHH-HHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHH
Q ss_conf             83485689---99998507212897101655533357822133-378899999862026963899725444414799997
Q gi|254780438|r   76 EGYPNETF---LNLCERYKPEQITLVPDDPHQLTSDHGWDFLQ-NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAK  151 (261)
Q Consensus        76 Eg~p~~e~---i~ia~~ikP~qvtLVPe~r~elTTegGldv~~-~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~  151 (261)
T Consensus       115 alnp~T~~~~l~~~l~~--iD~VlvMtV~PGf----~GQ~f~~~~l~ki~~l~~~~~~~~~~~~I~VDGGIn~~~i~~l~  188 (220)
T PRK05581        115 VLNPATPLEYLEYVLPL--LDLVLLMSVNPGF----GGQKFIPEVLEKIREVRKLIDERGLDILIEVDGGVNAENIKECA  188 (220)
T ss_pred             EECCCCCHHHHHHHHHH--HCEEEEEEECCCC----CCCCCCHHHHHHHHHHHHHHHHCCCCEEEEEECCCCHHHHHHHH
T ss_conf             76699998999999874--1525899865887----87645566999999999999845997559997898989999999


Q ss_pred             HCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             40661465112111024443564336668899987
Q gi|254780438|r  152 LTGADCIELYTGPYGACYNNPQQERIFLNKLAITA  186 (261)
Q Consensus       152 ~~Gad~VElhTG~Ya~a~~~~~~~~~el~~i~~aa  186 (261)
T Consensus       189 ~~Gad~~V~GS~iF----~~~d-~~~~i~~lk~~~  218 (220)
T PRK05581        189 EAGADVFVAGSAVF----GAPD-YKEAIDELRAEL  218 (220)
T ss_pred             HCCCCEEEECHHHH----CCCC-HHHHHHHHHHHH
T ss_conf             77999999794885----7999-999999999985