HHsearch alignment for GI: 254780438 and conserved domain: PRK09389

>PRK09389 (R)-citramalate synthase; Provisional.
Probab=93.46  E-value=0.43  Score=29.01  Aligned_cols=168  Identities=13%  Similarity=0.130  Sum_probs=100.3

Q ss_pred             CCHHHHHHHHHHCCCCEEEE-ECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEEE-EECC
Q ss_conf             99899999999749989998-247883348889999988740001367415888348568999998507212897-1016
Q gi|254780438|r   24 PNLVHIGKIALQSGASGLTV-HPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITL-VPDD  101 (261)
Q Consensus        24 P~~~~~a~~~~~~GadgITv-H~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvtL-VPe~  101 (261)
T Consensus        23 eeKl~ia~~L~~lGv~~IE~G~P~~s-----~~d~e~v~~i~~~~~-~~~i~~~~r~~~~di~~~~~a~~~~v~i~~~tS   96 (487)
T PRK09389         23 EEKLEIARKLDELGVDVIEAGSAITS-----KGERESIKLVAEQGL-NAEICSFARALKVDIDAALECDVDSVHLVVPTS   96 (487)
T ss_pred             HHHHHHHHHHHHCCCCEEEECCCCCC-----HHHHHHHHHHHHCCC-CCEEEEECCCCHHHHHHHHHCCCCEEEEEECCC
T ss_conf             99999999999769999997588788-----439999999984799-978998755648769999857979899996268


Q ss_pred             CCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEC------CCCCCHHHHHHHHCCCCEEEECCCCCHHHH--HHHH
Q ss_conf             55533357822133378899999862026963899725------444414799997406614651121110244--4356
Q gi|254780438|r  102 PHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFAD------GNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQ  173 (261)
Q Consensus       102 r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFID------pd~~q~~i~~a~~~Gad~VElhTG~Ya~a~--~~~~  173 (261)
T Consensus        97 ~~h~~~~l~~s~ee~l~~~~~~v~~ak~~g~~v~~~~ED~sr~~~~fl~e~~~~a~~aga~~i~l-----~DTvG~~~P~  171 (487)
T PRK09389         97 DLHIEYKLRKTREEVLEMAVEAVEYAKDHGLIVELSGEDASRADLDFLKELYRAGIEAGADRICF-----CDTVGILTPE  171 (487)
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEEEECCCCCCHHHHHHHHHHHHHHCCCCCCC-----CCCCCCCCHH
T ss_conf             99999886799999999999999999974977999210665557799999999999738996224-----8888887999


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHH
Q ss_conf             433666889998766541562352078989877
Q gi|254780438|r  174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQN  206 (261)
Q Consensus       174 ~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~N  206 (261)
T Consensus       172 ~~~~~i~~l~~----~~~~~i~vH~HND~GlAv  200 (487)
T PRK09389        172 RSYELFKRLSE----SLKIPISIHCHNDFGLAT  200 (487)
T ss_pred             HHHHHHHHHCC----CCCCEEEEEECCCCCHHH
T ss_conf             99999863004----678548997059977799