HHsearch alignment for GI: 254780438 and conserved domain: pfam00682

>pfam00682 HMGL-like HMGL-like. This family contains a diverse set of enzymes. These include various aldolases and a region of pyruvate carboxylase.
Probab=92.84  E-value=1  Score=26.40  Aligned_cols=170  Identities=13%  Similarity=0.129  Sum_probs=102.2

Q ss_pred             CHHHHHHHHHHCCCCEEEE-ECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEEC----CCHHHHHHHHHHCCCEEEEE-
Q ss_conf             9899999999749989998-24788334888999998874000136741588834----85689999985072128971-
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTV-HPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGY----PNETFLNLCERYKPEQITLV-   98 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITv-H~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~----p~~e~i~ia~~ikP~qvtLV-   98 (261)
T Consensus        15 ~K~~i~~~L~~~Gv~~IEvg~~~-----~~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~e~~~~~g~~~i~i~~   88 (237)
T pfam00682        15 EKLAIARALDEAGVDEIEVGFPF-----MSPTDFESVRAIAE-VLKKAKIQALLRPVEHDIDAAVEAAKGAGADRVHVFI   88 (237)
T ss_pred             HHHHHHHHHHHCCCCEEEEECCC-----CCCCHHHHHHHHHH-HCCCCCCCCEEECCCHHHHHHHHHHHHCCCCEEEEEE
T ss_conf             99999999998498989995775-----89735999997765-0258751010003410499999999967999999961


Q ss_pred             ECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEE------CCCCCCHHHHHHHHCCCCEEEEC-CCCCHHHHHH
Q ss_conf             0165553335782213337889999986202696389972------54444147999974066146511-2111024443
Q gi|254780438|r   99 PDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFA------DGNGNEHSLQAAKLTGADCIELY-TGPYGACYNN  171 (261)
Q Consensus        99 Pe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFI------Dpd~~q~~i~~a~~~Gad~VElh-TG~Ya~a~~~  171 (261)
T Consensus        89 ~~se~~~~~n~~~s~~~~l~~~~~~i~~a~~~g~~v~f~~~~~~~~~~~~~~~~~~~~~~~G~~~i~l~DT~G~----~~  164 (237)
T pfam00682        89 ATSDLHRKYKLNKDREEVADRAVAAVEAARSAGIDVELGCEDAGRTDLAFLIEVVEVAQEAGATRINIADTVGV----LT  164 (237)
T ss_pred             ECCHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCCCCCHHHHHHHHHHHHHCCCCEEEECCCCCC----CC
T ss_conf             05787899885789999999999999999986990588405123247889999999998619857973686455----79


Q ss_pred             HHHHHHHHHHHHHHHHHHHHCCCEEEE--CCCCCHHHH
Q ss_conf             564336668899987665415623520--789898779
Q gi|254780438|r  172 PQQERIFLNKLAITAQLAQKMDLQINA--GHDLTIQNI  207 (261)
Q Consensus       172 ~~~~~~el~~i~~aa~~A~~lgL~VnA--GHgLn~~Nl  207 (261)
T Consensus       165 P~~v~~lv~~l~~~~---~~~~i~~H~Hn~~Gla~aN~  199 (237)
T pfam00682       165 PNEAADLISALKDRV---PPVIIEVHCHNDLGMAVANS  199 (237)
T ss_pred             HHHHHHHHHHHHHCC---CCCCEEEEECCCCCHHHHHH
T ss_conf             899999999999708---98715887448867299999