HHsearch alignment of GI: 254780438 and MMDB domain: 1m5w_A_

>1m5w_A (A:) Pyridoxal phosphate biosynthetic protein PDXJ; TIM barrel, protein-substrate complex, multi-binding states; HET: DXP; 1.96A {Escherichia coli}
Probab=100.00  E-value=0  Score=701.56  Aligned_cols=241  Identities=34%  Similarity=0.526  Sum_probs=231.8

Q ss_pred             CC-CCCCCCCHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECC
Q ss_conf             98-45332214432232207886899899999999749989998247883348889999988740001367415888348
Q gi|254780438|r    1 MS-TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYP   79 (261)
Q Consensus         1 M~-t~LsVNidhiAtLRnaRg~~~P~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p   79 (261)
                      |+ ++||||||||||||||||+++|||+++|.+|+++||||||+|||||||||||+||+.|++++     ++||||||+|
T Consensus         1 m~~~~LgVNidhvAtLRnaR~~~~Pd~v~aA~~a~~aGAdgITvHlReDrRHI~d~Dv~~L~~~~-----~~~lNlE~a~   75 (243)
T 1m5w_A            1 MAELLLGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL-----DTRMNLEMAV   75 (243)
T ss_dssp             -CCCEEEEECHHHHHHHHTSSCCCSCHHHHHHHHHTTTCSEEEEECCTTCSSSCHHHHHHHHHHC-----SSEEEEEECS
T ss_pred             CCCCEEEEEECCEEEHHHCCCCCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHHH-----HHHHHCCCCC
T ss_conf             98525774300121012058999989999999999839985894468876544158999999865-----5665226777


Q ss_pred             CHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHCCCCEEE
Q ss_conf             56899999850721289710165553335782213337889999986202696389972544441479999740661465
Q gi|254780438|r   80 NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE  159 (261)
Q Consensus        80 ~~e~i~ia~~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~Gad~VE  159 (261)
                      +++|+++|+++||+|||||||+|+|+|||||||+.++.++|++++++|+++|||||||||||++|  |++|+++|||+||
T Consensus        76 t~emi~ia~~~kP~~vtLVPE~r~E~TTegGldv~~~~~~L~~~i~~l~~~gI~VSLFidP~~~q--i~~A~~~GAd~VE  153 (243)
T 1m5w_A           76 TEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDACKRLADAGIQVSLFIDADEEQ--IKAAAEVGAPFIE  153 (243)
T ss_dssp             SHHHHHHHHHHCCSEEEECCCCSSCSSCCSCCCSGGGHHHHHHHHHHHHHTTCEEEEEECSCHHH--HHHHHHTTCSEEE
T ss_pred             CHHHHHHHHHCCCCEEEECCCCCCCCCCCCCEEECCHHHHHHHHHHHHHHCCCEEEEEECCCHHH--HHHHHHCCCCEEE
T ss_conf             48899899876998789767887755877745320338899999999986597079983688899--9999970999575


Q ss_pred             ECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHH
Q ss_conf             11211102444356433666889998766541562352078989877999997369963884259999999994099999
Q gi|254780438|r  160 LYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV  239 (261)
Q Consensus       160 lhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI  239 (261)
                      ||||+||++|..+.+. .||++|+.++++|+++||+|||||||||+|++. +++||+|.||||||||||+|+|+||++||
T Consensus       154 LhTG~ya~a~~~~~~~-~el~~l~~aa~~a~~lGL~VnAGHgL~y~Nv~~-i~~ip~i~ElnIGHsiia~Al~~Gl~~AV  231 (243)
T 1m5w_A          154 IHTGCYADAKTDAEQA-QELARIAKAATFAASLGLKVNAGHGLTYHNVKA-IAAIPEMHELNIGHAIIGRAVMTGLKDAV  231 (243)
T ss_dssp             EECHHHHHCCSHHHHH-HHHHHHHHHHHHHHHTTCEEEEESSCCTTTHHH-HHTCTTEEEEEECHHHHHHHHHHCHHHHH
T ss_pred             ECCHHHHCCCCCHHHH-HHHHHHHHHHHHHHHCCCCEECCCCCCHHHHHH-HHCCCCCEEEECCHHHHHHHHHHHHHHHH
T ss_conf             1000211323320257-899999999999986698443799988666899-84389976984579999999997399999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99999997410
Q gi|254780438|r  240 FCFRRACGQHL  250 (261)
Q Consensus       240 ~~~~~ii~~~~  250 (261)
                      ++|+++|++.|
T Consensus       232 ~~m~~~i~~ar  242 (243)
T 1m5w_A          232 AEMKRLMLEAR  242 (243)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHCC
T ss_conf             99999998715