HHsearch alignment of GI: 254780438 and MMDB domain: 2q02_A_

>2q02_A (A:) Putative cytoplasmic protein; NP_463296.1, structural genomics, joint center for structural genomics, JCSG; 2.40A {Salmonella typhimurium LT2}
Probab=92.84  E-value=0.52  Score=28.00  Aligned_cols=138  Identities=9%  Similarity=-0.007  Sum_probs=80.5

Q ss_pred             CCCHHHHHHHHHHCCCCEEEEECCCCC-CCCCHHHHHHHHHHHCCCCCCCEE-EEEECCC------------HHHHHHHH
Q ss_conf             899899999999749989998247883-348889999988740001367415-8883485------------68999998
Q gi|254780438|r   23 WPNLVHIGKIALQSGASGLTVHPRPDQ-RHIRYTDLPEIRRLIDEQFPKAEL-NIEGYPN------------ETFLNLCE   88 (261)
Q Consensus        23 ~P~~~~~a~~~~~~GadgITvH~R~Dr-RHI~~~Dv~~l~~~~~~~~~~~el-NiEg~p~------------~e~i~ia~   88 (261)
                      .-++.++...+.++|.++|=+...... -...+.++..+++.+..+  ++++ .+.....            .+.++++.
T Consensus        18 ~~~~~~~~~~~~~~G~~~iel~~~~~~~~~~~~~~~~~~~~~l~~~--gl~i~~~~~~~~~~~~~~~~~~~~~~~~~~a~   95 (272)
T 2q02_A           18 GLSIEAFFRLVKRLEFNKVELRNDXPSGSVTDDLNYNQVRNLAEKY--GLEIVTINAVYPFNQLTEEVVKKTEGLLRDAQ   95 (272)
T ss_dssp             TSCHHHHHHHHHHTTCCEEEEETTSTTSSTTTTCCHHHHHHHHHHT--TCEEEEEEEETTTTSCCHHHHHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHHHHCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHC--CCCEEEEECCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             9999999999997099989996266643234777799999999983--99668861136777855889998999999999


Q ss_pred             HHCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECC-------CCCCHHHHHHHHCCCC-EEEE
Q ss_conf             5072128971016555333578221333788999998620269638997254-------4441479999740661-4651
Q gi|254780438|r   89 RYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADG-------NGNEHSLQAAKLTGAD-CIEL  160 (261)
Q Consensus        89 ~ikP~qvtLVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDp-------d~~q~~i~~a~~~Gad-~VEl  160 (261)
                      ......+.+-+-...   .+..|  ..-.+.++.......+.|+++.+=..+       +++ ...+....++.+ .+-+
T Consensus        96 ~lg~~~i~~~~~~~~---~~~~~--~~~~~~l~~l~~~a~~~Gv~~~~E~~~~~~~~~~~~~-~~~~l~~~~~~~~gi~~  169 (272)
T 2q02_A           96 GVGARALVLCPLNDG---TIVPP--EVTVEAIKRLSDLFARYDIQGLVEPLGFRVSSLRSAV-WAQQLIREAGSPFKVLL  169 (272)
T ss_dssp             HHTCSEEEECCCCSS---BCCCH--HHHHHHHHHHHHHHHTTTCEEEECCCCSTTCSCCCHH-HHHHHHHHHTCCCEEEE
T ss_pred             HHCCCEEEEECCCCC---CCHHH--HHHHHHHHHHHHHHHHCCEEEEEEECCCCCCCCCCHH-HHHHHHHHCCCCEEEEC
T ss_conf             862878999638887---50249--9999999999987521483899984676676448899-99999986099723312


Q ss_pred             CCCCCHHH
Q ss_conf             12111024
Q gi|254780438|r  161 YTGPYGAC  168 (261)
Q Consensus       161 hTG~Ya~a  168 (261)
                      =||.+...
T Consensus       170 D~~h~~~~  177 (272)
T 2q02_A          170 DTFHHHLY  177 (272)
T ss_dssp             EHHHHHHC
T ss_pred             CHHHHHHH
T ss_conf             01567870