HHsearch alignment of GI: 254780438 and MMDB domain: 3lot_A_

>3lot_A (A:) Uncharacterized protein; protein of unknown function, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.89A {Archaeoglobus fulgidus}
Probab=96.29  E-value=0.028  Score=36.71  Aligned_cols=174  Identities=17%  Similarity=0.165  Sum_probs=99.5

Q ss_pred             HHHHHHHHHHCCCCEEEEECCC--CCCCCCHHHHHH-HHHHHCCCCCCCEEEEE--E-----CCCHHHHHHHHHHCCCEE
Q ss_conf             8999999997499899982478--833488899999-88740001367415888--3-----485689999985072128
Q gi|254780438|r   26 LVHIGKIALQSGASGLTVHPRP--DQRHIRYTDLPE-IRRLIDEQFPKAELNIE--G-----YPNETFLNLCERYKPEQI   95 (261)
Q Consensus        26 ~~~~a~~~~~~GadgITvH~R~--DrRHI~~~Dv~~-l~~~~~~~~~~~elNiE--g-----~p~~e~i~ia~~ikP~qv   95 (261)
                      +.+.|..|.++||.-+-+|+|.  |-+|-.|-+++. +-..+.+.. ++-+|+-  +     ...++-+..+...+|+++
T Consensus        34 ia~~A~~c~~AGAsivHlH~Rdp~dG~~s~d~~~y~eii~~Ir~~~-d~ii~~TTg~~g~~~~~~e~r~~~i~~~~Pd~a  112 (314)
T 3lot_A           34 IVEEAVKAAEAGAGXVHIHARDPKDGRPTTDVEVFRYICREIKKQS-DVVINVTTGGGGTLGIPVEERAKVVPALKPEIA  112 (314)
T ss_dssp             HHHHHHHHHHHTCSEEEECEECTTTCCEECCHHHHHHHHHHHHHHC-CCEEEECSSTTGGGTCCHHHHTTHHHHHCCSEE
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCCCCCCCCHHHHHHHHHHHHHCC-CCEEEEECCCCCCCCCCHHHHHHHHHHHCCCCC
T ss_conf             9999999998256389977257778981789899999999998618-977998458887778898999999876182100


Q ss_pred             EEEEC------CCCCCCC-CCCC-------------CHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHH---H
Q ss_conf             97101------6555333-5782-------------2133378899999862026963899725444414799997---4
Q gi|254780438|r   96 TLVPD------DPHQLTS-DHGW-------------DFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAK---L  152 (261)
Q Consensus        96 tLVPe------~r~elTT-egGl-------------dv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~---~  152 (261)
                      ++=+=      ....... +.|+             -.......+..+...+++.||++++=+. |+.  .+..+.   +
T Consensus       113 sln~Gs~nf~~~~~~~~~~~~~~~~~~~~~~~~~d~v~~N~~~~~~~~~~~~~e~gi~pe~e~f-d~g--~l~~~~~l~~  189 (314)
T 3lot_A          113 TFNXGSXNFAIHPLLKKYKEFKYDWEPEYLEXTRDIVFRNTFKDLEALSRIFKENDTKPELECY-DIG--QIYNTAFXFH  189 (314)
T ss_dssp             EEECCCEECBCTTHHHHCCCCSSTHHHHHHHHGGGCEECCCHHHHHHHHHHHHHHTCEEEEEEC-SHH--HHHHHHHHHH
T ss_pred             CCCCCCCCCCCCHHHHHCCCCCCCCCHHHHCCCCCEEECCCHHHHHHHHHHHHHCCCCEEEEEC-CHH--HHHHHHHHHH
T ss_conf             2443455445411232000022333503223455503218999999999999983996248953-788--9999999997


Q ss_pred             CCC----CEEEEC---CCCCHHHHHHHHHHHHHHH-----------------HHHHHHHHHHHCCCEEEECCCCC
Q ss_conf             066----146511---2111024443564336668-----------------89998766541562352078989
Q gi|254780438|r  153 TGA----DCIELY---TGPYGACYNNPQQERIFLN-----------------KLAITAQLAQKMDLQINAGHDLT  203 (261)
Q Consensus       153 ~Ga----d~VElh---TG~Ya~a~~~~~~~~~el~-----------------~i~~aa~~A~~lgL~VnAGHgLn  203 (261)
                      .|.    -.+-|.   .|-+......-......+.                 .--.+...|..+|..|-.|=.=|
T Consensus       190 ~G~l~~p~~~~~vlG~~~g~~~~~~~l~~~~~~~~~~~~~~~~~wsv~~~G~~~~~~~~~Ai~~GGhvRVGlED~  264 (314)
T 3lot_A          190 EGYLEPPLRLQFIHGILGGIGTAVEDVLFXKQTADRLIGRENYTWSLVGAGRFQXPLGTLAVIXGGDVRVGLEDS  264 (314)
T ss_dssp             TTCSCSSEEEEEEECCBTSCCCCHHHHHHHHHHHHHHTCGGGEEEEEEECGGGHHHHHHHHHHTTCEEEESTTTC
T ss_pred             CCCCCCCCEEEEEEEECCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHHHHHHCCCEEECCCCC
T ss_conf             578789956999861057889974568999998775066779638996377555199999998399639726755