HHsearch results for GI: 254780438 and protein with PDBid: 1h1y_A

>1h1y_A D-ribulose-5-phosphate 3-epimerase; oxidative pentose phosphate pathway, isomerase; 1.87A {Oryza sativa} SCOP: c.1.2.2 PDB: 1h1z_A
Probab=92.89  E-value=0.62  Score=26.44  Aligned_cols=205  Identities=12%  Similarity=0.106  Sum_probs=140.0

Q ss_pred             CCCCHHHHHHHHHHCCCCEEEE-----ECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECCCHHHHHHHHHHCCCEEE
Q ss_conf             6899899999999749989998-----24788334888999998874000136741588834856899999850721289
Q gi|254780438|r   22 PWPNLVHIGKIALQSGASGLTV-----HPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQIT   96 (261)
Q Consensus        22 ~~P~~~~~a~~~~~~GadgITv-----H~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p~~e~i~ia~~ikP~qvt   96 (261)
                      ++=++-+....++++|+|.|-+     |-=|.- -+..+.+..+++....   ..+..+-+..-+.++.-..+..++.+|
T Consensus        17 d~~~L~~~i~~l~~~~~d~iHiDimDG~Fvpn~-t~~~~~i~~i~~~~~~---~~dvHlMv~~p~~~i~~~~~~g~~~i~   92 (228)
T 1h1y_A           17 DFANLAAEADRMVRLGADWLHMDIMDGHFVPNL-TIGAPVIQSLRKHTKA---YLDCHLMVTNPSDYVEPLAKAGASGFT   92 (228)
T ss_dssp             CGGGHHHHHHHHHHTTCSEEEEEEEBSSSSSCB-CBCHHHHHHHHTTCCS---EEEEEEESSCGGGGHHHHHHHTCSEEE
T ss_pred             CHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCC-CCCHHHHHHHHHHCCC---CEEEEEEECCHHHHHHHHHHCCCCEEE
T ss_conf             999999999999975999899988679667755-7098999999861675---446889971657549999856997799


Q ss_pred             EEECCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHH--CCCCEEEECCCCCHHHHHHHHH
Q ss_conf             71016555333578221333788999998620269638997254444147999974--0661465112111024443564
Q gi|254780438|r   97 LVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKL--TGADCIELYTGPYGACYNNPQQ  174 (261)
Q Consensus        97 LVPe~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~--~Gad~VElhTG~Ya~a~~~~~~  174 (261)
                      +=+|.-.              ..+..++..+++.|+++.+=+.|+..-..++....  -.+|.|=+-|..-.  |...+.
T Consensus        93 ~H~E~~~--------------~~~~~~i~~i~~~g~k~Gial~p~t~~~~~~~~l~~~~~~d~vlim~V~PG--~~GQ~f  156 (228)
T 1h1y_A           93 FHIEVSR--------------DNWQELIQSIKAKGMRPGVSLRPGTPVEEVFPLVEAENPVELVLVMTVEPG--FGGQKF  156 (228)
T ss_dssp             EEGGGCT--------------TTHHHHHHHHHHTTCEEEEEECTTSCGGGGHHHHHSSSCCSEEEEESSCTT--CSSCCC
T ss_pred             EECCCCC--------------CCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHCCCCEEEEEEECCC--CCCCCC
T ss_conf             6050023--------------589999999997497311584489988999999865314565789985589--888635


Q ss_pred             HHHHHHHHHHHHHHHHHCCCEEEECCCCCHHHHHHHHHHCCCCEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             3366688999876654156235207898987799999736996388425999999999409999999999997410565
Q gi|254780438|r  175 ERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQHLDNT  253 (261)
Q Consensus       175 ~~~el~~i~~aa~~A~~lgL~VnAGHgLn~~Nl~~~i~~Ip~I~EvsIGHaiIseAl~~GL~~aI~~~~~ii~~~~~~~  253 (261)
                      ...-++++++.-+  ...++.+-+-=|.|.+|++.+.+  -+.+-+-.|=+|.. +  --.++++++++++++..++.+
T Consensus       157 ~~~~l~kI~~l~~--~~~~~~I~VDGGI~~~~i~~l~~--aGad~iV~GSaif~-~--~d~~~~i~~lr~~i~~~~~~~  228 (228)
T 1h1y_A          157 MPEMMEKVRALRK--KYPSLDIEVDGGLGPSTIDVAAS--AGANCIVAGSSIFG-A--AEPGEVISALRKSVEGSQNKS  228 (228)
T ss_dssp             CGGGHHHHHHHHH--HCTTSEEEEESSCSTTTHHHHHH--HTCCEEEESHHHHT-S--SCHHHHHHHHHHHHHHC----
T ss_pred             CCHHHHHHHHHHH--CCCCCEEEEECCCCHHHHHHHHH--CCCCEEEECHHHHC-C--CCHHHHHHHHHHHHHHHHHCC
T ss_conf             7047899999996--69986499966869888999998--69999997769878-9--999999999999999876159