HHsearch results for GI: 254780438 and protein with PDBid: 2zvr_A

>2zvr_A Uncharacterized protein TM_0416; hyperthermophIle, ketohexose 3- epimerase, D-tagatose 3-epimerase, isomerase; 2.20A {Thermotoga maritima}
Probab=92.59  E-value=0.67  Score=26.17  Aligned_cols=206  Identities=12%  Similarity=0.068  Sum_probs=94.4

Q ss_pred             CHHHHHHHHHHCCCCEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCCEEEEEECC-------------C-----------
Q ss_conf             9899999999749989998247883348889999988740001367415888348-------------5-----------
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYP-------------N-----------   80 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R~DrRHI~~~Dv~~l~~~~~~~~~~~elNiEg~p-------------~-----------   80 (261)
                      |+-++-+.+.++|-|||-++..+.    ...|...+++.+.+.  ++++.--+.+             +           
T Consensus        42 ~l~~~l~~ak~~Gfd~VEl~~~~~----~~~~~~~lk~~l~~~--gL~v~s~~~~~~~~~~~~~~~~~d~~~r~~~i~~~  115 (290)
T 2zvr_A           42 DLRKGMELAKRVGYQAVEIAVRDP----SIVDWNEVKILSEEL--NLPICAIGTGQAYLADGLSLTHPNDEIRKKAIERV  115 (290)
T ss_dssp             HHHHHHHHHHHHTCSEEEEECSCG----GGSCHHHHHHHHHHH--TCCEEEEECTHHHHTTCCCTTCSSHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHCCCEEEECCCCC----CCCCHHHHHHHHHHC--CCEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHH
T ss_conf             999999999985999999788894----617899999999983--99089984562102477777897999999999999


Q ss_pred             HHHHHHHHHHCCCEEEEEECCCC-CCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCC------CCCHHHHHHHHC
Q ss_conf             68999998507212897101655-53335782213337889999986202696389972544------441479999740
Q gi|254780438|r   81 ETFLNLCERYKPEQITLVPDDPH-QLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGN------GNEHSLQAAKLT  153 (261)
Q Consensus        81 ~e~i~ia~~ikP~qvtLVPe~r~-elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd------~~q~~i~~a~~~  153 (261)
                      .+.++++.......++..|-.+. ..+.+..|+.  -.+.|+.+.....+.|+.+- +..+.      .....++...++
T Consensus       116 ~~~i~~a~~lG~~~i~~~~~~~~~~~~~~~~~~~--~~~~l~~l~~~a~~~gv~le-~~~~~~~~~~~t~~~~~~li~~v  192 (290)
T 2zvr_A          116 VKHTEVAGMFGALVIIGLVRGRREGRSYEETEEL--FIESMKRLLELTEHAKFVIE-PLNRYETDFINTIDDALRILRKI  192 (290)
T ss_dssp             HHHHHHHHHHTCEEEESGGGCCCTTSCHHHHHHH--HHHHHHHHHHHCSSCCEEEC-CCCTTTCSSCCSHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHH--HHHHHHHHHHHHHHHHCEEE-EECCCCCEEEECHHHHHHHHHHH
T ss_conf             9999999973993799568988888999999999--99999999999775221485-20353513330388899999980


Q ss_pred             CCCEE--EECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCE----EEECCC-CCHHHHHHHHHHCCCCEEEEEHHHH
Q ss_conf             66146--5112111024443564336668899987665415623----520789-8987799999736996388425999
Q gi|254780438|r  154 GADCI--ELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQ----INAGHD-LTIQNIPNLINAIPYISEISVGHAF  226 (261)
Q Consensus       154 Gad~V--ElhTG~Ya~a~~~~~~~~~el~~i~~aa~~A~~lgL~----VnAGHg-Ln~~Nl~~~i~~Ip~I~EvsIGHai  226 (261)
                      +.+.+  .+-+|....+   .....   +.+.....+....-+.    ..-|.| ++|..+-..+.+..+=-=+++=.+ 
T Consensus       193 ~~~~~g~~~D~~H~~~~---g~d~~---~~i~~~~~~i~~vHi~D~~r~~pG~G~id~~~il~~L~~~gy~G~~~~E~~-  265 (290)
T 2zvr_A          193 NSNRVGILADTFHMNIE---EVNIP---ESLKRAGEKLYHFHVADSNRWAPGCGHFDFRSVFNTLKEIGYNRYVSVECL-  265 (290)
T ss_dssp             CCTTEEEEEEHHHHHHH---CSSHH---HHHHHHGGGEEEEEECCTTSSSTTSSCCCHHHHHHHHHHTTCCSEEEECCC-
T ss_pred             CCCCCCCCCCCHHHHHC---CCCHH---HHHHHHCCCEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHCCCEEEEEEEC-
T ss_conf             98446666671888853---89999---999983371789999679999999865099999999998499817999845-


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999940999999999999741
Q gi|254780438|r  227 AATALECGVKEAVFCFRRACGQH  249 (261)
Q Consensus       227 IseAl~~GL~~aI~~~~~ii~~~  249 (261)
                         ...-+.+++.++.++.+++-
T Consensus       266 ---~~~~~~~~~~~~s~~~lk~~  285 (290)
T 2zvr_A          266 ---PLPGGMEEAAEIAFKTLKEL  285 (290)
T ss_dssp             ---STTTSHHHHHHHHHHHHHHH
T ss_pred             ---CCCCCHHHHHHHHHHHHHHH
T ss_conf             ---68999899999999999999