HHsearch results for GI: 254780438 and protein with PDBid: 3chv_A

>3chv_A Prokaryotic domain of unknown function (DUF849) W barrel fold; TIM barrel fold, structural genomics, joint center for struc genomics; HET: MSE; 1.45A {Silicibacter pomeroyi dss-3} PDB: 3fa5_A
Probab=96.10  E-value=0.03  Score=35.49  Aligned_cols=135  Identities=13%  Similarity=0.062  Sum_probs=88.4

Q ss_pred             CHHHHHHHHHHCCCCEEEEECC-CCCCCCCHHHHH-HHHHHHCCCCCCCEEEEEE---CCCHHHHHHHHHHCCCEEEEEE
Q ss_conf             9899999999749989998247-883348889999-9887400013674158883---4856899999850721289710
Q gi|254780438|r   25 NLVHIGKIALQSGASGLTVHPR-PDQRHIRYTDLP-EIRRLIDEQFPKAELNIEG---YPNETFLNLCERYKPEQITLVP   99 (261)
Q Consensus        25 ~~~~~a~~~~~~GadgITvH~R-~DrRHI~~~Dv~-~l~~~~~~~~~~~elNiEg---~p~~e~i~ia~~ikP~qvtLVP   99 (261)
                      .+++.|..|.++||.-+-+|+| +|-||..|-+++ ++-.-+....+++.+++-.   +..++....++..+|+.+.+--
T Consensus        35 Eia~~A~~c~~AGAsivH~H~Rd~~G~~sld~~~y~e~i~~ir~~~p~~ii~~tt~g~~~~~e~r~~~~~~~p~~~s~~~  114 (284)
T 3chv_A           35 EQVESTQEAFEAGAAIAHCHVRNDDGTPSSDPDRFARLTEGLHTHCPGMIVQFSTGGRSGAGQARGGMLPLKPDMASLSV  114 (284)
T ss_dssp             HHHHHHHHHHHHTCCEEEECEECTTSCEECCHHHHHHHHHHHHHHSTTCEEEECCCTTTCCGGGGGTTGGGCCSEEEECC
T ss_pred             HHHHHHHHHHHHCCCEEEEEECCCCCCCCCCHHHHHHHHHHHHHHCCEEEEEECCCCCCCHHHHHHHHHHCCCCCCCCCC
T ss_conf             99999999998188689986418993977788999999999998678028975578777607887653212356554664


Q ss_pred             CCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCCCHHHHHHHHC---C----CCEEEECCCCCH
Q ss_conf             165553335782213337889999986202696389972544441479999740---6----614651121110
Q gi|254780438|r  100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLT---G----ADCIELYTGPYG  166 (261)
Q Consensus       100 e~r~elTTegGldv~~~~~~L~~~i~~l~~~girvSLFIDpd~~q~~i~~a~~~---G----ad~VElhTG~Ya  166 (261)
                      -..+  .++..+  ....+.+..+.+.+++.||..++-+- |+..  +..+..+   |    .-.+.|+-|.|.
T Consensus       115 ~s~n--~~~~~~--~n~~~~~~~~~~~~~~~gi~pe~~~~-d~~~--l~~~~~l~~~g~l~~p~~~~~vlG~~~  181 (284)
T 3chv_A          115 GSNN--FPSRVY--ENPPDLVDWLAAQMRSYRVTPEIEAF-DLSH--ILRAIDMHGRGLLYGKLYVQFVMGVKN  181 (284)
T ss_dssp             SCEE--CSSSEE--CCCHHHHHHHHHHHHHHTCEEEEEES-SHHH--HHHHHHHHHTTCSCSSCEEEEEECCTT
T ss_pred             CCCC--CCCCCC--CCCHHHHHHHHHHHHHHCCCCEEEEE-CHHH--HHHHHHHHHCCCCCCCCEEEEEEECCC
T ss_conf             4345--545000--38799999999999984755125787-4999--999999997388678850799981677