BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780438|ref|YP_003064851.1| pyridoxine 5'-phosphate
synthase [Candidatus Liberibacter asiaticus str. psy62]
         (261 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780438|ref|YP_003064851.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter asiaticus
           str. psy62]
 gi|254040115|gb|ACT56911.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter asiaticus
           str. psy62]
          Length = 261

 Score =  543 bits (1400), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 261/261 (100%), Positives = 261/261 (100%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI
Sbjct: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL
Sbjct: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN
Sbjct: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF
Sbjct: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240

Query: 241 CFRRACGQHLDNTMRLTHPVK 261
           CFRRACGQHLDNTMRLTHPVK
Sbjct: 241 CFRRACGQHLDNTMRLTHPVK 261


>gi|315122113|ref|YP_004062602.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
 gi|313495515|gb|ADR52114.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter
           solanacearum CLso-ZC1]
          Length = 251

 Score =  421 bits (1081), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/248 (79%), Positives = 221/248 (89%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MST+VS+NLNAVA+LRNRRNLPWP+LVHIG+IALQSGASGLTVHPRPDQRHIRYTDLP+I
Sbjct: 1   MSTNVSINLNAVAMLRNRRNLPWPDLVHIGRIALQSGASGLTVHPRPDQRHIRYTDLPKI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R+LIDE+FPKAELNIEGYPNE FL LCE YKPEQ TLVPDDP+QLTSDHGWDF+ NQ LL
Sbjct: 61  RQLIDEEFPKAELNIEGYPNEKFLFLCENYKPEQATLVPDDPNQLTSDHGWDFVNNQKLL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T+TV++LH+LG R+SLFADG+G++  LQ AKLTGADCIELYTGPYGACY+NPQQE I L 
Sbjct: 121 TRTVSKLHDLGCRVSLFADGDGHKDCLQRAKLTGADCIELYTGPYGACYDNPQQESILLE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KLA+TA LAQ M  +INAGHDLTIQNIP L+ +IPYISEISVGHAF   ALE G KEAV 
Sbjct: 181 KLALTAHLAQDMHFKINAGHDLTIQNIPQLVASIPYISEISVGHAFTVAALEYGTKEAVL 240

Query: 241 CFRRACGQ 248
            FR ACGQ
Sbjct: 241 RFRHACGQ 248


>gi|222149066|ref|YP_002550023.1| pyridoxine 5'-phosphate synthase [Agrobacterium vitis S4]
 gi|254781556|sp|B9JXN7|PDXJ_AGRVS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|221736051|gb|ACM37014.1| pyridoxal phosphate biosynthetic protein PdxJ [Agrobacterium vitis
           S4]
          Length = 250

 Score =  334 bits (857), Expect = 7e-90,   Method: Compositional matrix adjust.
 Identities = 150/248 (60%), Positives = 188/248 (75%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++ H G++ALQ+GA GLTVHPRPDQRH+R++DLP +
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPDVRHFGRLALQAGAQGLTVHPRPDQRHVRFSDLPLL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FPKAE NIEGYP+E FL LCE  +PEQ+TLVPDDP Q TSDHGWDF  +Q  L
Sbjct: 61  RALIDDEFPKAEFNIEGYPSEDFLQLCEEAQPEQVTLVPDDPSQATSDHGWDFAAHQVFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL   G R+SLFADG+GN  ++  AK TGAD IELYTGPYG+CY+ P++    L 
Sbjct: 121 TDVVARLKAAGMRVSLFADGDGNAQAVATAKATGADRIELYTGPYGSCYDAPEKAARELA 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + + +N GHDLTI N+P L   IP+++E+S+GHA  A ALE G+ E V 
Sbjct: 181 LLGATADAAHALGMGVNGGHDLTIANLPALAERIPFLAEVSIGHALTADALEFGMAETVR 240

Query: 241 CFRRACGQ 248
            FRRACG+
Sbjct: 241 RFRRACGE 248


>gi|86358373|ref|YP_470265.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhizobium etli CFN
           42]
 gi|86282475|gb|ABC91538.1| pyridoxal phosphate biosynthetic (pyridoxine 5`-phosphate synthase)
           protein [Rhizobium etli CFN 42]
          Length = 250

 Score =  331 bits (849), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 151/250 (60%), Positives = 189/250 (75%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+IAL SGASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVETLGRIALASGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FPKAE NIEGYP E FL LC    PEQ+TLVPDDP Q TSDHGWDF ++QA L
Sbjct: 61  RNLIDDEFPKAEFNIEGYPTEEFLELCAGAAPEQVTLVPDDPSQATSDHGWDFRKHQAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +G R+SLFADG+G+  +++ AK+ GAD IELYTGPYG CY+ P++    L 
Sbjct: 121 TDVVARLKKMGCRVSLFADGDGDAEAVKIAKVVGADRIELYTGPYGGCYDAPERAAPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT+ N+P+L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGKTADAALAIGLDVNAGHDLTVANLPDLVKRIPDLAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQHL 250
            F RACGQ +
Sbjct: 241 RFCRACGQKV 250


>gi|218682862|ref|ZP_03530463.1| pyridoxine 5'-phosphate synthase [Rhizobium etli CIAT 894]
          Length = 250

 Score =  329 bits (843), Expect = 3e-88,   Method: Compositional matrix adjust.
 Identities = 150/250 (60%), Positives = 188/250 (75%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+IAL +GASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVEALGRIALAAGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FPKAE NIEGYP E FL+LC    PEQ+TLVPDDP Q TSDHGWDF ++QA L
Sbjct: 61  RNLIDDEFPKAEFNIEGYPTEEFLDLCAGAAPEQVTLVPDDPSQATSDHGWDFRKHQAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +G R+SLFADG+G+  +++ AK  GAD IELYTGPYG CY+ P++    L 
Sbjct: 121 TDVVARLKKMGCRVSLFADGDGDVEAVEIAKAVGADRIELYTGPYGGCYDAPERAAPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGKTADAALAIGLAVNAGHDLTVANLPALVKRIPALAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQHL 250
            F RACGQ +
Sbjct: 241 RFCRACGQKV 250


>gi|241205472|ref|YP_002976568.1| pyridoxine 5'-phosphate synthase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240859362|gb|ACS57029.1| Pyridoxine 5'-phosphate synthase [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 250

 Score =  327 bits (837), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 187/248 (75%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+IAL+SGASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAVAMLRNRRDLPWPSVEALGRIALKSGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FPK E NIEGYP E F  LC    PEQ+TLVPDDP Q TSDHGWDF ++QA L
Sbjct: 61  RNLIDDEFPKTEFNIEGYPTEEFFELCAGAAPEQVTLVPDDPAQATSDHGWDFRKHQAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +G R+SLFADG+G+  +++ AK  GAD IELYTGPYG C++ P++    L 
Sbjct: 121 TDAVARLKTMGCRVSLFADGDGDAQAVEIAKAVGADRIELYTGPYGGCFDAPERAGPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A ++ L +NAGHDLT++N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGRTADAALEIGLAVNAGHDLTVENLPALVRRIPQLAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQ 248
            F RACGQ
Sbjct: 241 RFCRACGQ 248


>gi|116252964|ref|YP_768802.1| pyridoxine 5'-phosphate synthase [Rhizobium leguminosarum bv.
           viciae 3841]
 gi|115257612|emb|CAK08709.1| putative pyridoxal phosphate biosynthetic protein [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 250

 Score =  327 bits (837), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 148/248 (59%), Positives = 186/248 (75%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+IAL SGASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVEALGRIALASGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FPKAE N+EGYP E F  LC    PEQ+TLVPDDP Q TSDHGWDF ++QA L
Sbjct: 61  RNLIDDEFPKAEFNMEGYPTEEFFELCAGAAPEQVTLVPDDPAQATSDHGWDFRKHQAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +G R+SLFADG+G+  +++ AK  GAD IELYTGPYG C++ P++    L 
Sbjct: 121 TDAVARLKTMGCRVSLFADGDGDAQAVEIAKAVGADRIELYTGPYGGCFDAPERAAPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT++N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGRTADAALAIGLAVNAGHDLTVENLPALVKRIPQLAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQ 248
            F RACGQ
Sbjct: 241 RFCRACGQ 248


>gi|327191455|gb|EGE58477.1| pyridoxine 5'-phosphate synthase [Rhizobium etli CNPAF512]
          Length = 250

 Score =  324 bits (831), Expect = 6e-87,   Method: Compositional matrix adjust.
 Identities = 148/250 (59%), Positives = 185/250 (74%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+IAL +GASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAVAMLRNRRDLPWPSVESLGRIALATGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE NIEGYP   FL+LC    PEQ+TLVPDDP Q TSDHGWDF ++QA L
Sbjct: 61  RNLIDDEFPNAEFNIEGYPTAEFLDLCAGAAPEQVTLVPDDPSQATSDHGWDFRKHQAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +G R+SLFADG+G+  +++  K  GAD IELYTGPYG CY+ P++    L 
Sbjct: 121 TDVVARLKTMGCRVSLFADGDGDAQAVEIVKAVGADRIELYTGPYGGCYDAPERAAPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGKTADAALAIGLAVNAGHDLTVANLPALVKRIPALAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQHL 250
            F RACGQ +
Sbjct: 241 RFCRACGQKV 250


>gi|218462778|ref|ZP_03502869.1| pyridoxine 5'-phosphate synthase [Rhizobium etli Kim 5]
          Length = 250

 Score =  324 bits (830), Expect = 8e-87,   Method: Compositional matrix adjust.
 Identities = 149/248 (60%), Positives = 184/248 (74%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+IAL +GASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAVAMLRNRRDLPWPSVEALGRIALAAGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE NIEGYP E FL LC    PEQ+TLVPDDP Q TSDHGWDF ++Q  L
Sbjct: 61  RNLIDDEFPGAEFNIEGYPTEEFLELCAGAAPEQVTLVPDDPAQATSDHGWDFRKHQVFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +GSR+SLFADG+G+  +++ AK  GAD IELYTGPYG CY+ P++    L 
Sbjct: 121 TDVVARLKKMGSRVSLFADGDGDAQAVEIAKAVGADRIELYTGPYGGCYDAPERAAPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT+ N+  L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGKTADAALAIGLAVNAGHDLTVANLSALVKRIPDLAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQ 248
            F RACGQ
Sbjct: 241 RFCRACGQ 248


>gi|209550095|ref|YP_002282012.1| pyridoxine 5'-phosphate synthase [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209535851|gb|ACI55786.1| Pyridoxal phosphate biosynthetic protein PdxJ [Rhizobium
           leguminosarum bv. trifolii WSM2304]
          Length = 250

 Score =  323 bits (828), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 148/250 (59%), Positives = 185/250 (74%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+IAL SGASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAVAMLRNRRDLPWPSVEALGRIALASGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE NIEGYP E F  LC    PEQ+TLVPDDP Q TSDHGWDF  ++A L
Sbjct: 61  RNLIDDEFPNAEFNIEGYPTEEFFELCAGAAPEQVTLVPDDPAQATSDHGWDFRTHRAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL  +G R+SLFADG+G+  +++ AK  GAD IELYTGPYG CY+ P++    L 
Sbjct: 121 TDAVARLKTMGCRVSLFADGDGDAEAVEIAKAVGADRIELYTGPYGGCYDAPERAVPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  +  + L +NAGHDLT+ N+P+L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGRTADASLAIGLAVNAGHDLTVANLPDLVKRIPALAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQHL 250
            F RACGQ +
Sbjct: 241 RFCRACGQAV 250


>gi|325293390|ref|YP_004279254.1| Pyridoxine 5'-phosphate synthase [Agrobacterium sp. H13-3]
 gi|325061243|gb|ADY64934.1| Pyridoxine 5'-phosphate synthase [Agrobacterium sp. H13-3]
          Length = 251

 Score =  323 bits (828), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 147/250 (58%), Positives = 184/250 (73%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++ H G IAL +GASGLTVHPRPDQRHIR++DLP +
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPDVAHFGHIALAAGASGLTVHPRPDQRHIRFSDLPVL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID+ FP AE NIEGYP E FL LCE+ +PEQ+TLVPDDP Q TSDHGWDF ++   L
Sbjct: 61  RALIDDSFPSAEFNIEGYPTEDFLVLCEQTQPEQVTLVPDDPSQATSDHGWDFRKHAVFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            + V RL   G R+SLFADG+G   +++ A  TGA  IELYTGPYG C+++PQ+    L 
Sbjct: 121 REAVGRLKAGGMRVSLFADGDGEREAVELAAETGAARIELYTGPYGGCFDDPQKGDALLE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL  TA  A  + L +NAGHDLT+ N+P L+  IPY++E+S+GH   A ALE G+ E V 
Sbjct: 181 KLGQTADYAAALGLAVNAGHDLTVANLPKLMKRIPYLAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQHL 250
            F RACGQ +
Sbjct: 241 RFCRACGQAI 250


>gi|190892497|ref|YP_001979039.1| pyridoxine 5'-phosphate synthase (pyridoxal phosphate biosynthesis
           protein) [Rhizobium etli CIAT 652]
 gi|190697776|gb|ACE91861.1| pyridoxine 5'-phosphate synthase protein (pyridoxal phosphate
           biosynthesis protein) [Rhizobium etli CIAT 652]
          Length = 250

 Score =  322 bits (824), Expect = 4e-86,   Method: Compositional matrix adjust.
 Identities = 147/248 (59%), Positives = 183/248 (73%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+IAL +GASGLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVEALGRIALAAGASGLTVHPRPDQRHIRFSDLPVI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE NIEGYP   FL+LC    PEQ+TLVPDDP Q TSDHGWDF ++QA L
Sbjct: 61  RNLIDDEFPNAEFNIEGYPTAEFLDLCAGAAPEQVTLVPDDPSQATSDHGWDFRKHQAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  V RL  +G R+SLFADG+G+  ++  AK  GAD IELYTGPYG CY+ P++    L 
Sbjct: 121 TDVVGRLKTMGCRVSLFADGDGDAQAVTIAKAVGADRIELYTGPYGGCYDAPERAAPILE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ALGKTADAALAIGLAVNAGHDLTVANLPALVKRIPDLAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQ 248
            F RACGQ
Sbjct: 241 RFCRACGQ 248


>gi|227822537|ref|YP_002826509.1| pyridoxine 5'-phosphate synthase [Sinorhizobium fredii NGR234]
 gi|227341538|gb|ACP25756.1| pyridoxal phosphate biosynthetic protein PdxJ [Sinorhizobium fredii
           NGR234]
          Length = 292

 Score =  320 bits (820), Expect = 1e-85,   Method: Compositional matrix adjust.
 Identities = 145/248 (58%), Positives = 189/248 (76%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+IALQ+GASGLTVHPRPDQRHIR++DL  I
Sbjct: 43  MPAKLSVNLNAIAMLRNRRDLPWPSVTGVGRIALQAGASGLTVHPRPDQRHIRFSDLQPI 102

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP+AE N+EGYPNE FL L ER++PEQ+TLVPDDP Q TSDHGW+F +N+ALL
Sbjct: 103 RDLIDDEFPEAEFNMEGYPNEEFLQLVERHEPEQVTLVPDDPTQATSDHGWNFRENRALL 162

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL   G R+SLFADG+ +  +L+ A+ TGAD IELYTGPYG C+++P        
Sbjct: 163 ASVVGRLKKKGFRVSLFADGDPDPEALKFARETGADRIELYTGPYGGCHDDPDGAERIAG 222

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L  TA++A  + L +NAGHDL + N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 223 ELGRTAEIAIGLGLGVNAGHDLRVANLPLLVKHIPALAEVSIGHGLTADALEYGMAETVR 282

Query: 241 CFRRACGQ 248
            FRRACG+
Sbjct: 283 RFRRACGE 290


>gi|150397184|ref|YP_001327651.1| pyridoxine 5'-phosphate synthase [Sinorhizobium medicae WSM419]
 gi|150028699|gb|ABR60816.1| Pyridoxal phosphate biosynthetic protein PdxJ [Sinorhizobium
           medicae WSM419]
          Length = 250

 Score =  318 bits (815), Expect = 5e-85,   Method: Compositional matrix adjust.
 Identities = 145/248 (58%), Positives = 187/248 (75%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+IALQ+GASGLTVHPRPDQRHIR++DL  I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVTGLGRIALQAGASGLTVHPRPDQRHIRFSDLQPI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE N+EG+PNE FL L ER++PEQ+TLVPDDP Q TSDHGWDF ++  LL
Sbjct: 61  RNLIDDEFPAAEFNMEGFPNEAFLELVERHEPEQVTLVPDDPAQATSDHGWDFHKSHNLL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V  L   G R+SLFADG  +  +L+ AK TGAD IELYTGPYG CY++P++      
Sbjct: 121 GNVVGSLKKKGYRVSLFADGTPDLQALKIAKETGADRIELYTGPYGGCYDDPEKAERVAT 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L  TA++A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ELGRTAEIAIGLGLAVNAGHDLTVANLPLLVKYIPELAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQ 248
            FRRACG+
Sbjct: 241 RFRRACGE 248


>gi|15965839|ref|NP_386192.1| pyridoxal phosphate biosynthetic protein PdxJ [Sinorhizobium
           meliloti 1021]
 gi|307309596|ref|ZP_07589249.1| Pyridoxine 5'-phosphate synthase [Sinorhizobium meliloti BL225C]
 gi|307321873|ref|ZP_07601258.1| Pyridoxine 5'-phosphate synthase [Sinorhizobium meliloti AK83]
 gi|20139052|sp|Q92NT6|PDXJ_RHIME RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|15075108|emb|CAC46665.1| Probable pyridoxal phosphate biosynthetic protein [Sinorhizobium
           meliloti 1021]
 gi|306892484|gb|EFN23285.1| Pyridoxine 5'-phosphate synthase [Sinorhizobium meliloti AK83]
 gi|306899931|gb|EFN30553.1| Pyridoxine 5'-phosphate synthase [Sinorhizobium meliloti BL225C]
          Length = 250

 Score =  317 bits (811), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 145/248 (58%), Positives = 187/248 (75%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+ ALQ+GASGLTVHPRPDQRHIR++DL  I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVTGLGRTALQAGASGLTVHPRPDQRHIRFSDLQPI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE N+EG+PNE FL L ER++PEQ+TLVPDDP Q TSDHGWDF ++  LL
Sbjct: 61  RDLIDDEFPAAEFNMEGFPNEAFLELVERHEPEQVTLVPDDPAQATSDHGWDFRKSHNLL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL   G R+SLFADG  +  +L+ AK TGAD IELYTGPYG CY++P++      
Sbjct: 121 GNVVGRLKKRGFRVSLFADGIPDPEALKLAKETGADRIELYTGPYGGCYDDPEKAERIAI 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L  TA++A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A ALE G+ E V 
Sbjct: 181 ELGRTAEIAIGLGLAVNAGHDLTVANLPLLVEHIPELAEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACGQ 248
            FRRACG+
Sbjct: 241 RFRRACGE 248


>gi|159185015|ref|NP_354993.2| pyridoxal phosphate biosynthetic protein PdxJ [Agrobacterium
           tumefaciens str. C58]
 gi|22653931|sp|Q8UDU5|PDXJ_AGRT5 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|159140289|gb|AAK87778.2| pyridoxal phosphate biosynthesis protein [Agrobacterium tumefaciens
           str. C58]
          Length = 251

 Score =  313 bits (803), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 142/248 (57%), Positives = 182/248 (73%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++ H G+IAL +GASGLTVHPRPDQRHIR++DLP +
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPDVAHFGQIALSAGASGLTVHPRPDQRHIRFSDLPVL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE NIEGYP E FL LCE+ +PEQ+TLVPDDP Q TSDHGWDF ++   L
Sbjct: 61  RALIDDRFPGAEFNIEGYPTEDFLVLCEKTQPEQVTLVPDDPSQATSDHGWDFRKHAVFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL   G R+SLFADG+G    ++ A  TGA  IELYTGPYG C+++ Q+  + + 
Sbjct: 121 KDVVGRLKAGGMRVSLFADGDGEREPVELAAETGAARIELYTGPYGGCFDDTQKADLLVE 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL  TA  A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A A+E G+ E V 
Sbjct: 181 KLGQTADHAAALGLAVNAGHDLTVANLPKLMKRIPNLAEVSIGHGLTADAMEYGMAETVR 240

Query: 241 CFRRACGQ 248
            F +ACGQ
Sbjct: 241 RFCQACGQ 248


>gi|110633846|ref|YP_674054.1| pyridoxal phosphate biosynthetic protein PdxJ [Mesorhizobium sp.
           BNC1]
 gi|123353678|sp|Q11I86|PDXJ_MESSB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|110284830|gb|ABG62889.1| pyridoxine 5'-phosphate synthase [Chelativorans sp. BNC1]
          Length = 248

 Score =  306 bits (784), Expect = 2e-81,   Method: Compositional matrix adjust.
 Identities = 140/246 (56%), Positives = 180/246 (73%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+IAL +GA GLTVHPRPDQRHIR++DLP I
Sbjct: 1   MPVKLSVNLNAVAMLRNRRDLPWPSVTALGRIALGAGAHGLTVHPRPDQRHIRFSDLPHI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP  E NIEGYP+E FL L E  +PEQ+TLVPDDP Q TSDHGW F +++  L
Sbjct: 61  RALIDDEFPDREFNIEGYPSEDFLRLVEETQPEQVTLVPDDPSQATSDHGWQFQEHERFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL   G R+SLFAD + +E +L  AK  GAD +ELYTGPYGACY++ ++    L 
Sbjct: 121 AAAVGRLKRRGFRVSLFADPDADEAALAVAKAVGADRVELYTGPYGACYDDAEKAAKELR 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL  TA+ AQ + L +NAGHDLT+ N+P L+  +P ++E+S+GHA  A ALE G+ E V 
Sbjct: 181 KLEKTAKTAQGLGLAVNAGHDLTVANLPALVEHVPSLAEVSIGHALTADALEYGMAETVR 240

Query: 241 CFRRAC 246
            +  AC
Sbjct: 241 RYLSAC 246


>gi|163759025|ref|ZP_02166111.1| Pyridoxal phosphate biosynthetic protein PdxJ [Hoeflea
           phototrophica DFL-43]
 gi|162283429|gb|EDQ33714.1| Pyridoxal phosphate biosynthetic protein PdxJ [Hoeflea
           phototrophica DFL-43]
          Length = 247

 Score =  305 bits (782), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 140/247 (56%), Positives = 180/247 (72%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+IALQ+GA GLTVHPRPDQRHIR++DLPE+
Sbjct: 1   MPAQLSVNLNAVAMLRNRRDLPWPSVTALGRIALQNGAHGLTVHPRPDQRHIRFSDLPEL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP+AE NIEGYP + FL+L E  +PEQ+TLVPDDP Q TSDHGWDF     +L
Sbjct: 61  RALIDDEFPQAEFNIEGYPTDDFLDLVEANQPEQVTLVPDDPSQATSDHGWDFEGKGNVL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL   G+R+SLF D +    +L+AAK TGAD +E YTGPYG  Y++P +    L+
Sbjct: 121 RSVVQRLKKNGARVSLFCDPDATRSALEAAKATGADRVEFYTGPYGGTYDDPARAAEELD 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL     +A ++ L +NAGHDLT+ N+P L  A+P + E+S+GH   A ALE G+ E V 
Sbjct: 181 KLKTAGSIAAELGLGVNAGHDLTVDNMPGLARALPNLLEVSIGHGLTADALEYGMAETVR 240

Query: 241 CFRRACG 247
            F RACG
Sbjct: 241 RFVRACG 247


>gi|222086360|ref|YP_002544894.1| pyridoxal phosphate biosynthetic protein PdxJ [Agrobacterium
           radiobacter K84]
 gi|221723808|gb|ACM26964.1| pyridoxal phosphate biosynthetic protein PdxJ [Agrobacterium
           radiobacter K84]
          Length = 237

 Score =  305 bits (781), Expect = 4e-81,   Method: Compositional matrix adjust.
 Identities = 136/235 (57%), Positives = 175/235 (74%)

Query: 14  VLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAEL 73
           +LRNRR+LPWP++  +G+IAL +GASGLTVHPRPDQRHIR++DLPEIR LID++FP+AE 
Sbjct: 1   MLRNRRDLPWPSVTGLGRIALAAGASGLTVHPRPDQRHIRFSDLPEIRALIDDEFPEAEF 60

Query: 74  NIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSR 133
           NIEGYP++ F +LC   +PEQ+TLVPDDP Q TSDHGWDF +N  LL   VA+   +G R
Sbjct: 61  NIEGYPSDEFFDLCASVEPEQVTLVPDDPSQATSDHGWDFRKNHNLLADVVAKYKTIGCR 120

Query: 134 ISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMD 193
           +SLFADG+G+  +++ A+  GAD IELYTGPYG CY+ P++  + L  L  TA  A    
Sbjct: 121 VSLFADGDGDAEAVKIAREVGADRIELYTGPYGGCYDAPERAAVILEALGKTADAAFASG 180

Query: 194 LQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQ 248
           L +NAGHDLT+ N+P L+  IP ++E S+GH   A ALE G+ E V  F RACGQ
Sbjct: 181 LAVNAGHDLTVANLPALLKRIPALAEASIGHGLTADALEYGMAETVRRFCRACGQ 235


>gi|114704820|ref|ZP_01437728.1| pyridoxal phosphate biosynthetic protein [Fulvimarina pelagi
           HTCC2506]
 gi|114539605|gb|EAU42725.1| pyridoxal phosphate biosynthetic protein [Fulvimarina pelagi
           HTCC2506]
          Length = 250

 Score =  302 bits (774), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 143/250 (57%), Positives = 182/250 (72%), Gaps = 2/250 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M T +SVNLNAVA+LRNRR+LPWP++  +G+IAL +GA GLTVHPRPDQRHIR++DLPEI
Sbjct: 1   MPTQLSVNLNAVAMLRNRRDLPWPSVTGLGRIALNAGAHGLTVHPRPDQRHIRFSDLPEI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R+LID++FP AELNIEG+P++ FLNL E   PEQ+TLVPDDP Q TSDHG+DF      L
Sbjct: 61  RKLIDDEFPDAELNIEGFPSDEFLNLVETISPEQVTLVPDDPSQPTSDHGFDFKAELERL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL +  +R+S+F+D + N+  ++AA  TG D IELYTGPYGA Y+NP      L 
Sbjct: 121 KPIVRRLKDGNTRVSIFSDADPNQ--MEAAAATGCDRIELYTGPYGATYDNPDAAESELR 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A  + L +NAGHDLT+ N+P LI  IP+++E+S+GH   A ALE G+ E V 
Sbjct: 179 ALGATADRALSLGLGVNAGHDLTVSNLPPLIERIPFLAEVSIGHGLTADALEFGMAETVH 238

Query: 241 CFRRACGQHL 250
            FR AC Q +
Sbjct: 239 RFRAACDQRI 248


>gi|90419217|ref|ZP_01227127.1| pyridoxal phosphate biosynthesis protein pdxJ [Aurantimonas
           manganoxydans SI85-9A1]
 gi|90336154|gb|EAS49895.1| pyridoxal phosphate biosynthesis protein pdxJ [Aurantimonas
           manganoxydans SI85-9A1]
          Length = 247

 Score =  299 bits (766), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 145/248 (58%), Positives = 183/248 (73%), Gaps = 2/248 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MST++SVNLNAVA+LRNRR+LPWP++V  G+IAL++GA GLTVHPRPDQRHIR++DLPE+
Sbjct: 1   MSTALSVNLNAVAMLRNRRDLPWPSVVDFGRIALRAGAHGLTVHPRPDQRHIRFSDLPEL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID +FP AE NIEGYP E FL L E   PEQ+TLVPDDP Q TSDHGWDF    A L
Sbjct: 61  RALIDNEFPAAEFNIEGYPTEDFLALVETVSPEQVTLVPDDPSQPTSDHGWDFAGEGAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  VARL   G+R+SLFAD + +  +++AA  TG D IELYTGPYG  + +P+  +  + 
Sbjct: 121 TPIVARLQAGGARVSLFADADPS--AMKAAAATGCDRIELYTGPYGGTHADPEAAKAEIE 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L  TA  A    L +NAGHDLT+ N+P L+  IP ++E+S+GH   A ALE G++ +V 
Sbjct: 179 RLGATADAALAAGLGVNAGHDLTVANLPALVARIPELAEVSIGHGLTADALEYGMETSVR 238

Query: 241 CFRRACGQ 248
            FR ACGQ
Sbjct: 239 RFRAACGQ 246


>gi|13471446|ref|NP_103012.1| pyridoxine 5'-phosphate synthase [Mesorhizobium loti MAFF303099]
 gi|20139099|sp|Q98KL6|PDXJ_RHILO RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|14022188|dbj|BAB48798.1| pyridoxal phosphate biosynthetic protein [Mesorhizobium loti
           MAFF303099]
          Length = 246

 Score =  294 bits (753), Expect = 8e-78,   Method: Compositional matrix adjust.
 Identities = 139/247 (56%), Positives = 181/247 (73%), Gaps = 2/247 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  IG++AL +GA GLTVHPRPD+RH R++DLPEI
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVTGIGRLALAAGAHGLTVHPRPDERHTRHSDLPEI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP+AE NIEGYP+E FL L E+++PEQ+TLVPDDP Q TSDHGW+F+ + ALL
Sbjct: 61  RALIDDEFPQAEFNIEGYPSEDFLALVEKHQPEQVTLVPDDPAQATSDHGWNFVADAALL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  V RL   G R+SLF+D   +   + AA+ TGAD IELYTGPYG+ +++  +    L 
Sbjct: 121 TPIVRRLKKGGFRVSLFSD--ADPAGMTAARDTGADRIELYTGPYGSYHSDSAKADKELE 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L  TA  A    LQ+NAGHDLT+ N+P L   IP ++E+S+GH   A ALE G+   V 
Sbjct: 179 RLGKTADAAFAAGLQVNAGHDLTVGNLPALAKRIPALAEVSIGHGLTADALEYGMAGTVG 238

Query: 241 CFRRACG 247
            F RACG
Sbjct: 239 RFLRACG 245


>gi|304392149|ref|ZP_07374091.1| pyridoxine 5'-phosphate synthase [Ahrensia sp. R2A130]
 gi|303296378|gb|EFL90736.1| pyridoxine 5'-phosphate synthase [Ahrensia sp. R2A130]
          Length = 246

 Score =  294 bits (752), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 139/248 (56%), Positives = 180/248 (72%), Gaps = 2/248 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+ ++SVNLNAVA LRNRR+LPWP++V IG+IAL++GA GLTVHPRPD+RHIR++DLP++
Sbjct: 1   MAVALSVNLNAVAQLRNRRDLPWPSVVGIGRIALENGAHGLTVHPRPDERHIRFSDLPDL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FPKAE NIEGYP + FL+LC+   PEQ+TLVPDDP Q TSDHGWDF  N  +L
Sbjct: 61  RALIDDEFPKAEFNIEGYPTDDFLDLCDTNAPEQVTLVPDDPSQATSDHGWDFKANHNML 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VARL + G R++LFAD   +   ++ A  TGAD IELYTGPY A Y++P      L+
Sbjct: 121 APIVARLKSSGFRVALFAD--ADPEGVKWAADTGADRIELYTGPYAATYDSPSAAERELD 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            L  TA  A+++ L  +AGHDLT+ N+P L+  IP + E+S+GH   A ALE G+   V 
Sbjct: 179 ALQATADAAREVGLGTHAGHDLTVANLPPLVARIPDLFEVSIGHGLTADALEFGMSATVK 238

Query: 241 CFRRACGQ 248
            F  ACG 
Sbjct: 239 RFLSACGH 246


>gi|260462194|ref|ZP_05810438.1| Pyridoxal phosphate biosynthetic protein PdxJ [Mesorhizobium
           opportunistum WSM2075]
 gi|259032054|gb|EEW33321.1| Pyridoxal phosphate biosynthetic protein PdxJ [Mesorhizobium
           opportunistum WSM2075]
          Length = 246

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 180/247 (72%), Gaps = 2/247 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP+++ +G++AL +GA GLTVHPRPD+RH R++DLPEI
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVIGVGRLALAAGAHGLTVHPRPDERHTRHSDLPEI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP+AE NIEGYP+  FL+L E+++PEQ+TLVPDDP Q TSDHGW+F  + A L
Sbjct: 61  RALIDDEFPQAEFNIEGYPSVDFLSLVEKHQPEQVTLVPDDPAQATSDHGWNFAADSAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL   G R+SLF+D   +   + AA+ TGAD IELYTGPYG+ +++ ++    L 
Sbjct: 121 IPVVRRLKKSGFRVSLFSD--ADPAGVTAARDTGADRIELYTGPYGSYHSDSEKAAKELE 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L  TA  A    LQ+NAGHDLT+ N+P L   IP ++E+S+GH   A ALE G+   V 
Sbjct: 179 RLGKTADAAFAAGLQVNAGHDLTVDNLPALARRIPALAEVSIGHGLTADALEYGMAGTVG 238

Query: 241 CFRRACG 247
            F RACG
Sbjct: 239 RFLRACG 245


>gi|319899125|ref|YP_004159218.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella
           clarridgeiae 73]
 gi|319403089|emb|CBI76644.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella
           clarridgeiae 73]
          Length = 244

 Score =  290 bits (742), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 142/242 (58%), Positives = 176/242 (72%), Gaps = 3/242 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVNLNAVAVLRNRRNLPWP++ +IG IAL +GA+GLTVHPRPD+RHIR+ DLP I
Sbjct: 1   MAIKLSVNLNAVAVLRNRRNLPWPSIENIGYIALSAGAAGLTVHPRPDERHIRFVDLPNI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L++  FP AE NIEGYP++TFLNL E+Y  +QITLVPD P Q TSDHGWDF  N   L
Sbjct: 61  RFLMNNSFPNAEFNIEGYPSDTFLNLAEKYA-DQITLVPDAPDQPTSDHGWDFASNAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + RL     R+SLFA  N    SL  AK  GADCIE YTGPYG  +N+ +++   L+
Sbjct: 120 APIIQRLKEKNIRVSLFA--NTVLDSLDIAKAIGADCIEFYTGPYGGAFNDEKKQTQELD 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL + AQ A+++ L INAGHDLTI N+P L+N IP+I+E+S+GH   A ALE G+ E V 
Sbjct: 178 KLVLAAQNARELKLDINAGHDLTIANLPALVNRIPWINEVSIGHGLIADALEYGMHETVQ 237

Query: 241 CF 242
            F
Sbjct: 238 RF 239


>gi|319407471|emb|CBI81121.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella sp. 1-1C]
          Length = 244

 Score =  284 bits (727), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 136/244 (55%), Positives = 178/244 (72%), Gaps = 3/244 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVNLNAVAVLRNRR+LPWP++ +IG IAL +GA+GLTVHPRPD+RHIR+ DLP+I
Sbjct: 1   MAIKLSVNLNAVAVLRNRRDLPWPSIENIGYIALSAGAAGLTVHPRPDERHIRFVDLPKI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+++ FP AE NIEGYP++TFL+L E+Y  +QITLVPD P Q TSDHGWDF+ +   L
Sbjct: 61  RFLMNDAFPNAEFNIEGYPSDTFLDLAEKYA-DQITLVPDSPDQSTSDHGWDFVSSAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + RL     R+SLFA  N     L  AK  GAD +E YTGPYG  +++ +++   L+
Sbjct: 120 APVIQRLKEKNIRVSLFA--NTVLDDLDIAKAIGADYVEFYTGPYGGAFDDEEKQTQELD 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL + AQ A+++ L INAGHDLTI N+P L+N IP+I+E+S+GH   A ALE G+ E V 
Sbjct: 178 KLVLAAQKARELQLHINAGHDLTIANLPALVNRIPWINEVSIGHGLIADALEYGMHETVQ 237

Query: 241 CFRR 244
            F R
Sbjct: 238 RFIR 241


>gi|319404478|emb|CBI78085.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella
           rochalimae ATCC BAA-1498]
          Length = 244

 Score =  283 bits (723), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 138/244 (56%), Positives = 176/244 (72%), Gaps = 3/244 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVAVLRNRRNLPWP++ +IG IAL +GA+GLTVHPRPD+RHIR+ DLP+I
Sbjct: 1   MVIKLSVNLNAVAVLRNRRNLPWPSIENIGYIALSAGAAGLTVHPRPDERHIRFVDLPKI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L++  FP AE NIEGYP++TFL+L E+Y  +QITLVPD P Q TSDHGWDF  +   L
Sbjct: 61  RFLMNNAFPNAEFNIEGYPSDTFLDLAEKYA-DQITLVPDTPDQSTSDHGWDFASSAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + RL     R+SLFA  N     L  AK  GAD +E YTGPYG  +++ +++   L+
Sbjct: 120 APVIQRLKAKNIRVSLFA--NTVLDDLDIAKAIGADYVEFYTGPYGGAFDDEEKQTQELD 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KLA+ AQ A+++ L INAGHDLTI N+P L+N IP+I+E+S+GH   A ALE G+ E V 
Sbjct: 178 KLALAAQKARELQLHINAGHDLTIANLPALVNRIPWINEVSIGHGLIADALEYGMHETVQ 237

Query: 241 CFRR 244
            F R
Sbjct: 238 RFIR 241


>gi|319782948|ref|YP_004142424.1| pyridoxal phosphate biosynthetic protein PdxJ [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
 gi|317168836|gb|ADV12374.1| pyridoxal phosphate biosynthetic protein PdxJ [Mesorhizobium ciceri
           biovar biserrulae WSM1271]
          Length = 246

 Score =  280 bits (716), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 135/247 (54%), Positives = 173/247 (70%), Gaps = 2/247 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+IAL +GA GLTVHPRPD+RH R +D+PEI
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVTGLGRIALAAGAHGLTVHPRPDERHTRLSDVPEI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP AE NIEGYP E FL L E+++PEQ+TLVPDDP Q TSDHGW+F    A L
Sbjct: 61  RSLIDDEFPGAEFNIEGYPTEDFLLLVEKHQPEQVTLVPDDPAQATSDHGWNFATQAAFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  V RL   G R+SLF+D + +   + AA  TGAD IELYTGPYG+ + +  +    L 
Sbjct: 121 TPIVKRLKKGGFRVSLFSDPDPD--WVAAACDTGADRIELYTGPYGSYHTDSAKAAKELE 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           +L  TA  A    LQ+NAGHDL + N+P L   IP ++E+S+GH   A ALE G+   V 
Sbjct: 179 RLGKTADAALAAGLQVNAGHDLVVSNLPALARRIPALAEVSIGHGLTADALEYGMAGTVG 238

Query: 241 CFRRACG 247
            F +ACG
Sbjct: 239 RFLKACG 245


>gi|49475824|ref|YP_033865.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella henselae
           str. Houston-1]
 gi|49238632|emb|CAF27876.1| Pyridoxal phosphate biosynthetic protein pdxj [Bartonella henselae
           str. Houston-1]
          Length = 244

 Score =  276 bits (705), Expect = 3e-72,   Method: Compositional matrix adjust.
 Identities = 136/244 (55%), Positives = 170/244 (69%), Gaps = 3/244 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVNLNAVAVLRNRRNLPWPN+  IG IAL +GA+GLTVHPRPD+RHIR+ DLP+I
Sbjct: 1   MAVKLSVNLNAVAVLRNRRNLPWPNIKSIGHIALTAGAAGLTVHPRPDERHIRFADLPDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LI+  FP AE NIEGYP++ FL+L E+Y  +QITLVPDDP Q TSDHGWDF  N   L
Sbjct: 61  RCLINSAFPTAEFNIEGYPSDRFLDLAEKYA-DQITLVPDDPAQSTSDHGWDFAHNAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + RL     R+SLFA  N     L  AK  GAD +E YTGPYG  + +  ++   L 
Sbjct: 120 APIIQRLKEKKIRVSLFA--NPLVDGLDIAKTIGADRVEFYTGPYGGAFKDKTKQDQELK 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL + A+ A+++ L +NAGHDLTI N+P L+N I ++ E+S+GH   A ALE G+ E V 
Sbjct: 178 KLILAARKAKELQLGVNAGHDLTITNLPALVNHISWLDEVSIGHGLIADALEYGMYETVQ 237

Query: 241 CFRR 244
            F R
Sbjct: 238 RFIR 241


>gi|319405977|emb|CBI79609.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella sp. AR
           15-3]
          Length = 244

 Score =  275 bits (703), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 135/242 (55%), Positives = 170/242 (70%), Gaps = 3/242 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVAVLRNRRNLPWP+L  IG IAL +GA+GLTVHPRPD+RHIR+ DLP+I
Sbjct: 1   MPIKLSVNLNAVAVLRNRRNLPWPSLEKIGYIALSAGAAGLTVHPRPDERHIRFVDLPKI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L++  FP AE NIEGYP++TFL+L E+Y  +QITLVPD P Q TSDHGWDF  +   L
Sbjct: 61  RFLMNNAFPSAEFNIEGYPSDTFLDLAEKYA-DQITLVPDSPDQSTSDHGWDFASSAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + RL     R+SLFA  N     L   K  GAD +E YTG YG  +++ +++   LN
Sbjct: 120 APIIQRLKAKNIRVSLFA--NTVLDDLDIVKAIGADRVEFYTGAYGGAFDDEEKQTQELN 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL + AQ A+++ L +NAGHDLTI N+P L+N IP+I E+S+GH   A ALE G+  AV 
Sbjct: 178 KLILAAQKARQLQLNVNAGHDLTIANLPTLVNRIPWIHEVSIGHGLIADALEYGMHGAVQ 237

Query: 241 CF 242
            F
Sbjct: 238 RF 239


>gi|218508614|ref|ZP_03506492.1| pyridoxine 5'-phosphate synthase [Rhizobium etli Brasil 5]
          Length = 212

 Score =  270 bits (691), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 124/212 (58%), Positives = 153/212 (72%)

Query: 39  SGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLV 98
           SGLTVHPRPDQRHIR++DLP IR LID++F  AE NIEGYP E FL LC    PEQ+TLV
Sbjct: 1   SGLTVHPRPDQRHIRFSDLPIIRNLIDDEFSNAEFNIEGYPTEEFLELCAGAAPEQVTLV 60

Query: 99  PDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCI 158
           PDDP Q TSDHGWDF +++A LT  VARL  +G R+SLFADG+G+  +++ AK  GAD I
Sbjct: 61  PDDPSQATSDHGWDFRKHRAFLTDVVARLKTMGCRVSLFADGDGDAQAVEIAKAVGADRI 120

Query: 159 ELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYIS 218
           ELYTGPYG CY+ P++    L  L  TA  A  + L +NAGHDLT+ N+P L+  IP ++
Sbjct: 121 ELYTGPYGGCYDAPERAAPILEALGKTADAALAIGLAVNAGHDLTVANLPALVKRIPALA 180

Query: 219 EISVGHAFAATALECGVKEAVFCFRRACGQHL 250
           E+S+GH   A ALE G+ E V  F RACGQ +
Sbjct: 181 EVSIGHGLTADALEYGMAETVRRFCRACGQKV 212


>gi|319408795|emb|CBI82452.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella
           schoenbuchensis R1]
          Length = 244

 Score =  268 bits (686), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 129/244 (52%), Positives = 171/244 (70%), Gaps = 3/244 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVNLNAVAVLRNRR+LPWP++  IG  AL +GA+GLTVHPRPD+RHI ++DLP+I
Sbjct: 1   MAVKLSVNLNAVAVLRNRRHLPWPSVTDIGYKALTAGAAGLTVHPRPDERHICFSDLPDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LI+  FP AE NIEGYP++ FL++ E+Y  +QITLVPDDP Q TSDHGWDF  +   L
Sbjct: 61  RFLINNNFPTAEFNIEGYPSDMFLDMTEKYA-DQITLVPDDPAQSTSDHGWDFSNDAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              V RL     R+SLFA  N     L   K  GAD +E YTG YG  + + ++++  L+
Sbjct: 120 IPIVQRLKEKKIRVSLFA--NPVVEGLDIVKTIGADRVEFYTGAYGGAFKDKEKQKQELD 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL + A+ A+++ L INAGHDLT+ N+P L++ IP++ E+S+GH   A ALE G+ E V 
Sbjct: 178 KLVLAAKKARELQLGINAGHDLTVSNLPALVDRIPWLDEVSIGHGLIADALEYGIHETVQ 237

Query: 241 CFRR 244
            F R
Sbjct: 238 RFTR 241


>gi|239832260|ref|ZP_04680589.1| Pyridoxine 5'-phosphate synthase [Ochrobactrum intermedium LMG
           3301]
 gi|239824527|gb|EEQ96095.1| Pyridoxine 5'-phosphate synthase [Ochrobactrum intermedium LMG
           3301]
          Length = 245

 Score =  265 bits (676), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 133/239 (55%), Positives = 174/239 (72%), Gaps = 2/239 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+ AL +GA+GLTVHPRPDQRHIR++DL EI
Sbjct: 1   MPAKLSVNLNAVAMLRNRRDLPWPSVTGLGRAALAAGAAGLTVHPRPDQRHIRFSDLGEI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP+AE NIEG+P+E FL+L E+++PEQ+TLVPDDP Q TSDHGWDF+     L
Sbjct: 61  RALIDDEFPQAEFNIEGFPSEAFLDLVEKHQPEQVTLVPDDPTQATSDHGWDFVSKSDFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VARL   G R+SLFAD   +    + AK  GAD +ELYTGPYGA Y++P      L+
Sbjct: 121 APIVARLKAGGMRVSLFAD--PDPLGYERAKAIGADRVELYTGPYGATYDDPAAAVHELD 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +L   A +A  + L INAGHDLT+ N+P L+  +P ++E+S+GH   A AL  G+  AV
Sbjct: 179 RLEKAANVATALGLAINAGHDLTVDNLPALVKRVPQLNEVSIGHGLTADALMYGMPTAV 237


>gi|118588843|ref|ZP_01546251.1| pyridoxal phosphate biosynthetic protein [Stappia aggregata IAM
           12614]
 gi|118438829|gb|EAV45462.1| pyridoxal phosphate biosynthetic protein [Stappia aggregata IAM
           12614]
          Length = 249

 Score =  262 bits (669), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 124/248 (50%), Positives = 171/248 (68%), Gaps = 6/248 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           + +SVN+NA+A+LRNRR+LPWP++  +  IA+++GA G+TVHPRPD+RHIR TD+ E+  
Sbjct: 5   SRLSVNVNAIAMLRNRRDLPWPSVTGLAAIAMEAGAKGITVHPRPDERHIRKTDVFELSE 64

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           LI+++FP  EL +EGYP   F+ L E  +PEQ+  VPDDP Q TSDHGWDF ++   L  
Sbjct: 65  LIEDRFPNKELCLEGYPAPDFMKLVEDARPEQVLFVPDDPQQTTSDHGWDFSKDTGALET 124

Query: 123 TVARLHNLGSRISLFADGN--GNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            +A        +SLF D +    EH   AA+L GA+ IE+YTGPYGACY++P +    L+
Sbjct: 125 AIAAAKEWAVTVSLFCDPDPAAPEH---AARL-GAERIEIYTGPYGACYDDPARAEKELD 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           K+  TA+ A+   L +NAGHDLT++NIP L+   P+I E+S+GH F A AL  G  E+V 
Sbjct: 181 KIVATAEAAKACGLGVNAGHDLTVENIPALMARAPFIREMSIGHGFTADALIYGFAESVA 240

Query: 241 CFRRACGQ 248
            FRRA G+
Sbjct: 241 RFRRAMGE 248


>gi|153009140|ref|YP_001370355.1| pyridoxine 5'-phosphate synthase [Ochrobactrum anthropi ATCC 49188]
 gi|166219101|sp|A6WZX2|PDXJ_OCHA4 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|151561028|gb|ABS14526.1| Pyridoxal phosphate biosynthetic protein PdxJ [Ochrobactrum
           anthropi ATCC 49188]
          Length = 245

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 132/239 (55%), Positives = 171/239 (71%), Gaps = 2/239 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNAVA+LRNRR+LPWP++  +G+ AL +GA+GLTVHPRPDQRHIR++DL +I
Sbjct: 1   MPAKLSVNLNAVAMLRNRRDLPWPSVTGLGRAALAAGAAGLTVHPRPDQRHIRFSDLGDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID++FP+AE NIEG+P+E FL+L E+++PEQ+TLVPDDP Q TSDHGWDF+     L
Sbjct: 61  RALIDDEFPQAEFNIEGFPSEAFLDLVEKHQPEQVTLVPDDPTQATSDHGWDFVSRSDFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VARL   G R+SLFAD +   +   AA   G D +ELYTGPYGA Y++P      L+
Sbjct: 121 APIVARLKAGGMRVSLFADPDPLGYERAAA--IGVDRVELYTGPYGATYDDPAAATRELD 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +L   A  A  + L INAGHDLT+ N+P L+  IP +SE+S+GH   A AL  G+   V
Sbjct: 179 RLEKAANAATALGLDINAGHDLTVDNLPALVKRIPQLSEVSIGHGLTADALMYGMPVTV 237


>gi|23502256|ref|NP_698383.1| pyridoxine 5'-phosphate synthase [Brucella suis 1330]
 gi|161619331|ref|YP_001593218.1| pyridoxal phosphate biosynthetic protein PdxJ [Brucella canis ATCC
           23365]
 gi|163843639|ref|YP_001628043.1| pyridoxal phosphate biosynthetic protein PdxJ [Brucella suis ATCC
           23445]
 gi|254704644|ref|ZP_05166472.1| pyridoxine 5'-phosphate synthase [Brucella suis bv. 3 str. 686]
 gi|260566109|ref|ZP_05836579.1| pyridoxine 5'-phosphate synthase [Brucella suis bv. 4 str. 40]
 gi|261755338|ref|ZP_05999047.1| pyridoxine 5'-phosphate synthase [Brucella suis bv. 3 str. 686]
 gi|30316054|sp|Q8FZT6|PDXJ_BRUSU RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|189036743|sp|A9M642|PDXJ_BRUC2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|189036744|sp|B0CHH2|PDXJ_BRUSI RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|23348229|gb|AAN30298.1| pyridoxal phosphate biosynthetic protein PdxJ, putative [Brucella
           suis 1330]
 gi|161336142|gb|ABX62447.1| Pyridoxal phosphate biosynthetic protein pdxJ [Brucella canis ATCC
           23365]
 gi|163674362|gb|ABY38473.1| Pyridoxal phosphate biosynthetic protein pdxJ [Brucella suis ATCC
           23445]
 gi|260155627|gb|EEW90707.1| pyridoxine 5'-phosphate synthase [Brucella suis bv. 4 str. 40]
 gi|261745091|gb|EEY33017.1| pyridoxine 5'-phosphate synthase [Brucella suis bv. 3 str. 686]
          Length = 246

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 128/239 (53%), Positives = 174/239 (72%), Gaps = 2/239 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+ AL +GA+GLTVHPRPDQRHIR++DL +I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVTGLGRAALAAGAAGLTVHPRPDQRHIRFSDLGDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID+++P+AE NIEG+P+E FL+L E+++PEQ+TLVPDDP Q TSDHGWDF+     L
Sbjct: 61  RALIDDEYPQAEFNIEGFPSEAFLDLVEKHEPEQVTLVPDDPMQATSDHGWDFMSKADFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VARL   G R+SLFAD +   +  + AK  GAD +ELYTGPYGA +++P      L+
Sbjct: 121 APIVARLKGRGMRVSLFADPDSLGY--ERAKAIGADHVELYTGPYGATHDDPAAAARELD 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +L   A+ A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A AL  G+   V
Sbjct: 179 RLEKAARAATALGLAVNAGHDLTVDNLPALVKRIPQLAEVSIGHGLTADALMYGIPVTV 237


>gi|294852713|ref|ZP_06793386.1| pyridoxal phosphate biosynthesis protein PdxJ [Brucella sp. NVSL
           07-0026]
 gi|294821302|gb|EFG38301.1| pyridoxal phosphate biosynthesis protein PdxJ [Brucella sp. NVSL
           07-0026]
          Length = 246

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 128/239 (53%), Positives = 174/239 (72%), Gaps = 2/239 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+ AL +GA+GLTVHPRPDQRHIR++DL +I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVTRLGRAALAAGAAGLTVHPRPDQRHIRFSDLGDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID+++P+AE NIEG+P+E FL+L E+++PEQ+TLVPDDP Q TSDHGWDF+     L
Sbjct: 61  RALIDDEYPQAEFNIEGFPSEAFLDLVEKHEPEQVTLVPDDPMQATSDHGWDFMSKADFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VARL   G R+SLFAD +   +  + AK  GAD +ELYTGPYGA +++P      L+
Sbjct: 121 APIVARLKGRGMRVSLFADPDSLGY--ERAKAIGADRVELYTGPYGATHDDPAAAARELD 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +L   A+ A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A AL  G+   V
Sbjct: 179 RLEKAARAATALGLAVNAGHDLTVDNLPALVKRIPQLAEVSIGHGLTADALMYGIPVTV 237


>gi|17986904|ref|NP_539538.1| pyridoxine 5'-phosphate synthase [Brucella melitensis bv. 1 str.
           16M]
 gi|62290280|ref|YP_222073.1| pyridoxine 5'-phosphate synthase [Brucella abortus bv. 1 str.
           9-941]
 gi|82700202|ref|YP_414776.1| pyridoxine 5'-phosphate synthase [Brucella melitensis biovar
           Abortus 2308]
 gi|148559026|ref|YP_001259280.1| pyridoxine 5'-phosphate synthase [Brucella ovis ATCC 25840]
 gi|189024513|ref|YP_001935281.1| pyridoxine 5'-phosphate synthase [Brucella abortus S19]
 gi|225852868|ref|YP_002733101.1| pyridoxine 5'-phosphate synthase [Brucella melitensis ATCC 23457]
 gi|237815786|ref|ZP_04594783.1| Pyridoxine 5'-phosphate synthase [Brucella abortus str. 2308 A]
 gi|254689581|ref|ZP_05152835.1| pyridoxine 5'-phosphate synthase [Brucella abortus bv. 6 str. 870]
 gi|254694071|ref|ZP_05155899.1| pyridoxine 5'-phosphate synthase [Brucella abortus bv. 3 str.
           Tulya]
 gi|254697722|ref|ZP_05159550.1| pyridoxine 5'-phosphate synthase [Brucella abortus bv. 2 str.
           86/8/59]
 gi|254708060|ref|ZP_05169888.1| pyridoxine 5'-phosphate synthase [Brucella pinnipedialis
           M163/99/10]
 gi|254710430|ref|ZP_05172241.1| pyridoxine 5'-phosphate synthase [Brucella pinnipedialis B2/94]
 gi|254714423|ref|ZP_05176234.1| pyridoxine 5'-phosphate synthase [Brucella ceti M644/93/1]
 gi|254717320|ref|ZP_05179131.1| pyridoxine 5'-phosphate synthase [Brucella ceti M13/05/1]
 gi|254730612|ref|ZP_05189190.1| pyridoxine 5'-phosphate synthase [Brucella abortus bv. 4 str. 292]
 gi|256031923|ref|ZP_05445537.1| pyridoxine 5'-phosphate synthase [Brucella pinnipedialis M292/94/1]
 gi|256045017|ref|ZP_05447918.1| pyridoxine 5'-phosphate synthase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|256061444|ref|ZP_05451588.1| pyridoxine 5'-phosphate synthase [Brucella neotomae 5K33]
 gi|256113928|ref|ZP_05454721.1| pyridoxine 5'-phosphate synthase [Brucella melitensis bv. 3 str.
           Ether]
 gi|256257830|ref|ZP_05463366.1| pyridoxine 5'-phosphate synthase [Brucella abortus bv. 9 str. C68]
 gi|256263649|ref|ZP_05466181.1| pyridoxine 5'-phosphate synthase [Brucella melitensis bv. 2 str.
           63/9]
 gi|256369800|ref|YP_003107311.1| pyridoxal phosphate biosynthetic protein [Brucella microti CCM
           4915]
 gi|260546822|ref|ZP_05822561.1| pyridoxine 5'-phosphate synthase [Brucella abortus NCTC 8038]
 gi|260565383|ref|ZP_05835867.1| pyridoxine 5'-phosphate synthase [Brucella melitensis bv. 1 str.
           16M]
 gi|260755109|ref|ZP_05867457.1| pyridoxal phosphate biosynthetic protein pdxJ [Brucella abortus bv.
           6 str. 870]
 gi|260758328|ref|ZP_05870676.1| pyridoxal phosphate biosynthetic protein pdxJ [Brucella abortus bv.
           4 str. 292]
 gi|260762154|ref|ZP_05874497.1| pyridoxal phosphate biosynthetic protein pdxJ [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260884121|ref|ZP_05895735.1| pyridoxine 5'-phosphate synthase [Brucella abortus bv. 9 str. C68]
 gi|261214367|ref|ZP_05928648.1| pyridoxal phosphate biosynthetic protein pdxJ [Brucella abortus bv.
           3 str. Tulya]
 gi|261219149|ref|ZP_05933430.1| pyridoxine 5'-phosphate synthase [Brucella ceti M13/05/1]
 gi|261315561|ref|ZP_05954758.1| pyridoxine 5'-phosphate synthase [Brucella pinnipedialis
           M163/99/10]
 gi|261318000|ref|ZP_05957197.1| pyridoxine 5'-phosphate synthase [Brucella pinnipedialis B2/94]
 gi|261322211|ref|ZP_05961408.1| pyridoxine 5'-phosphate synthase [Brucella ceti M644/93/1]
 gi|261325451|ref|ZP_05964648.1| pyridoxine 5'-phosphate synthase [Brucella neotomae 5K33]
 gi|265989030|ref|ZP_06101587.1| pyridoxine 5'-phosphate synthase [Brucella pinnipedialis M292/94/1]
 gi|265991445|ref|ZP_06104002.1| pyridoxine 5'-phosphate synthase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|265995281|ref|ZP_06107838.1| pyridoxine 5'-phosphate synthase [Brucella melitensis bv. 3 str.
           Ether]
 gi|297248668|ref|ZP_06932386.1| pyridoxal phosphate biosynthesis protein PdxJ [Brucella abortus bv.
           5 str. B3196]
 gi|20138992|sp|Q8YI24|PDXJ_BRUME RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|75496571|sp|Q57CC2|PDXJ_BRUAB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|91207223|sp|Q2YQM7|PDXJ_BRUA2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|166219085|sp|A5VRD3|PDXJ_BRUO2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|238689387|sp|B2S6L0|PDXJ_BRUA1 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|254781558|sp|C0RE25|PDXJ_BRUMB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|17982546|gb|AAL51802.1| pyridoxal phosphate biosynthetic protein pdxj [Brucella melitensis
           bv. 1 str. 16M]
 gi|62196412|gb|AAX74712.1| hypothetical PdxJ, pyridoxal phosphate biosynthetic protein
           [Brucella abortus bv. 1 str. 9-941]
 gi|82616303|emb|CAJ11360.1| Pyridoxal phosphate biosynthetic protein PdxJ [Brucella melitensis
           biovar Abortus 2308]
 gi|148370283|gb|ABQ60262.1| putative pyridoxal phosphate biosynthetic protein PdxJ [Brucella
           ovis ATCC 25840]
 gi|189020085|gb|ACD72807.1| Pyridoxal phosphate biosynthetic protein PdxJ [Brucella abortus
           S19]
 gi|225641233|gb|ACO01147.1| Pyridoxine 5'-phosphate synthase [Brucella melitensis ATCC 23457]
 gi|237789084|gb|EEP63295.1| Pyridoxine 5'-phosphate synthase [Brucella abortus str. 2308 A]
 gi|255999963|gb|ACU48362.1| pyridoxal phosphate biosynthetic protein [Brucella microti CCM
           4915]
 gi|260095872|gb|EEW79749.1| pyridoxine 5'-phosphate synthase [Brucella abortus NCTC 8038]
 gi|260151451|gb|EEW86545.1| pyridoxine 5'-phosphate synthase [Brucella melitensis bv. 1 str.
           16M]
 gi|260668646|gb|EEX55586.1| pyridoxal phosphate biosynthetic protein pdxJ [Brucella abortus bv.
           4 str. 292]
 gi|260672586|gb|EEX59407.1| pyridoxal phosphate biosynthetic protein pdxJ [Brucella abortus bv.
           2 str. 86/8/59]
 gi|260675217|gb|EEX62038.1| pyridoxal phosphate biosynthetic protein pdxJ [Brucella abortus bv.
           6 str. 870]
 gi|260873649|gb|EEX80718.1| pyridoxine 5'-phosphate synthase [Brucella abortus bv. 9 str. C68]
 gi|260915974|gb|EEX82835.1| pyridoxal phosphate biosynthetic protein pdxJ [Brucella abortus bv.
           3 str. Tulya]
 gi|260924238|gb|EEX90806.1| pyridoxine 5'-phosphate synthase [Brucella ceti M13/05/1]
 gi|261294901|gb|EEX98397.1| pyridoxine 5'-phosphate synthase [Brucella ceti M644/93/1]
 gi|261297223|gb|EEY00720.1| pyridoxine 5'-phosphate synthase [Brucella pinnipedialis B2/94]
 gi|261301431|gb|EEY04928.1| pyridoxine 5'-phosphate synthase [Brucella neotomae 5K33]
 gi|261304587|gb|EEY08084.1| pyridoxine 5'-phosphate synthase [Brucella pinnipedialis
           M163/99/10]
 gi|262766394|gb|EEZ12183.1| pyridoxine 5'-phosphate synthase [Brucella melitensis bv. 3 str.
           Ether]
 gi|263002229|gb|EEZ14804.1| pyridoxine 5'-phosphate synthase [Brucella melitensis bv. 1 str.
           Rev.1]
 gi|263093702|gb|EEZ17707.1| pyridoxine 5'-phosphate synthase [Brucella melitensis bv. 2 str.
           63/9]
 gi|264661227|gb|EEZ31488.1| pyridoxine 5'-phosphate synthase [Brucella pinnipedialis M292/94/1]
 gi|297175837|gb|EFH35184.1| pyridoxal phosphate biosynthesis protein PdxJ [Brucella abortus bv.
           5 str. B3196]
 gi|326409406|gb|ADZ66471.1| Pyridoxal phosphate biosynthetic protein PdxJ [Brucella melitensis
           M28]
 gi|326539114|gb|ADZ87329.1| pyridoxine 5'-phosphate synthase [Brucella melitensis M5-90]
          Length = 246

 Score =  260 bits (665), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 128/239 (53%), Positives = 174/239 (72%), Gaps = 2/239 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+ AL +GA+GLTVHPRPDQRHIR++DL +I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVTGLGRAALAAGAAGLTVHPRPDQRHIRFSDLGDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID+++P+AE NIEG+P+E FL+L E+++PEQ+TLVPDDP Q TSDHGWDF+     L
Sbjct: 61  RALIDDEYPQAEFNIEGFPSEAFLDLVEKHEPEQVTLVPDDPMQATSDHGWDFMSKADFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VARL   G R+SLFAD +   +  + AK  GAD +ELYTGPYGA +++P      L+
Sbjct: 121 APIVARLKGRGMRVSLFADPDSLGY--ERAKAIGADRVELYTGPYGATHDDPAAAARELD 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +L   A+ A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A AL  G+   V
Sbjct: 179 RLEKAARAATALGLAVNAGHDLTVDNLPALVKRIPQLAEVSIGHGLTADALMYGIPVTV 237


>gi|225627837|ref|ZP_03785874.1| Pyridoxine 5'-phosphate synthase [Brucella ceti str. Cudo]
 gi|256160121|ref|ZP_05457815.1| pyridoxine 5'-phosphate synthase [Brucella ceti M490/95/1]
 gi|256255327|ref|ZP_05460863.1| pyridoxine 5'-phosphate synthase [Brucella ceti B1/94]
 gi|260169059|ref|ZP_05755870.1| pyridoxine 5'-phosphate synthase [Brucella sp. F5/99]
 gi|261222529|ref|ZP_05936810.1| pyridoxine 5'-phosphate synthase [Brucella ceti B1/94]
 gi|261758563|ref|ZP_06002272.1| pyridoxine 5'-phosphate synthase [Brucella sp. F5/99]
 gi|265998494|ref|ZP_06111051.1| pyridoxine 5'-phosphate synthase [Brucella ceti M490/95/1]
 gi|225617842|gb|EEH14887.1| Pyridoxine 5'-phosphate synthase [Brucella ceti str. Cudo]
 gi|260921113|gb|EEX87766.1| pyridoxine 5'-phosphate synthase [Brucella ceti B1/94]
 gi|261738547|gb|EEY26543.1| pyridoxine 5'-phosphate synthase [Brucella sp. F5/99]
 gi|262553118|gb|EEZ08952.1| pyridoxine 5'-phosphate synthase [Brucella ceti M490/95/1]
          Length = 246

 Score =  260 bits (664), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 128/239 (53%), Positives = 174/239 (72%), Gaps = 2/239 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+ AL +GA+GLTVHPRPDQRHIR++DL +I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVTGLGRAALAAGAAGLTVHPRPDQRHIRFSDLGDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID+++P+AE NIEG+P+E FL+L E+++PEQ+TLVPDDP Q TSDHGWDF+     L
Sbjct: 61  RALIDDEYPQAEFNIEGFPSEAFLDLVEKHEPEQVTLVPDDPMQATSDHGWDFMSKADFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VARL   G R+SLFAD +   +  + AK  GAD +ELYTGPYGA +++P      L+
Sbjct: 121 APIVARLKGHGMRVSLFADPDSLGY--ERAKAIGADRVELYTGPYGATHDDPAAAARELD 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +L   A+ A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A AL  G+   V
Sbjct: 179 RLEKAARAATALGLAVNAGHDLTVDNLPALVKRIPQLAEVSIGHGLTADALMYGIPVTV 237


>gi|254702107|ref|ZP_05163935.1| pyridoxine 5'-phosphate synthase [Brucella suis bv. 5 str. 513]
 gi|261752678|ref|ZP_05996387.1| pyridoxine 5'-phosphate synthase [Brucella suis bv. 5 str. 513]
 gi|261742431|gb|EEY30357.1| pyridoxine 5'-phosphate synthase [Brucella suis bv. 5 str. 513]
          Length = 246

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 128/239 (53%), Positives = 174/239 (72%), Gaps = 2/239 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+ AL +GA+GLTVHPRPDQRHIR++DL +I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVTGLGRAALAAGAAGLTVHPRPDQRHIRFSDLGDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID+++P+AE NIEG+P+E FL+L E+++PEQ+TLVPDDP Q TSDHGWDF+     L
Sbjct: 61  RALIDDEYPQAEFNIEGFPSEAFLDLVEKHEPEQVTLVPDDPMQATSDHGWDFMSKADFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VARL   G R+SLFAD +   +  + AK  GAD +ELYTGPYGA +++P      L+
Sbjct: 121 APIVARLKGRGMRVSLFADPDSLGY--ERAKAIGADRVELYTGPYGATHDDPAAAARELD 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +L   A+ A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A AL  G+   V
Sbjct: 179 RLEKAARAATALGLAVNAGHDLTVYNLPALVKRIPQLAEVSIGHGLTADALMYGIPVTV 237


>gi|306844283|ref|ZP_07476875.1| pyridoxal phosphate biosynthetic protein PdxJ [Brucella sp. BO1]
 gi|306275355|gb|EFM57096.1| pyridoxal phosphate biosynthetic protein PdxJ [Brucella sp. BO1]
          Length = 246

 Score =  260 bits (664), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 128/239 (53%), Positives = 174/239 (72%), Gaps = 2/239 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP+++ +G+ AL +GA+GLTVHPRPDQRHIR++DL +I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVIGLGRAALAAGAAGLTVHPRPDQRHIRFSDLGDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID+++P+AE NIEG+P+E FL+L E+++PEQ+TLVPDDP Q TSDHGWDF+     L
Sbjct: 61  RALIDDEYPQAEFNIEGFPSEAFLDLVEKHEPEQVTLVPDDPMQATSDHGWDFMSKADFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VARL   G R+SLFAD   +    + AK  GAD +ELYTGPYGA +++P      L+
Sbjct: 121 APIVARLKGRGMRVSLFAD--PDPLGYERAKAIGADRVELYTGPYGATHDDPAAAVRELD 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +L   A+ A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A AL  G+   V
Sbjct: 179 RLEEAARAATALGLAVNAGHDLTVDNLPALVKHIPQLAEVSIGHGLTADALMYGIPVTV 237


>gi|254719418|ref|ZP_05181229.1| pyridoxine 5'-phosphate synthase [Brucella sp. 83/13]
 gi|265984422|ref|ZP_06097157.1| pyridoxine 5'-phosphate synthase [Brucella sp. 83/13]
 gi|306839194|ref|ZP_07472011.1| pyridoxal phosphate biosynthetic protein PdxJ [Brucella sp. NF
           2653]
 gi|264663014|gb|EEZ33275.1| pyridoxine 5'-phosphate synthase [Brucella sp. 83/13]
 gi|306405741|gb|EFM62003.1| pyridoxal phosphate biosynthetic protein PdxJ [Brucella sp. NF
           2653]
          Length = 246

 Score =  259 bits (662), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 128/239 (53%), Positives = 173/239 (72%), Gaps = 2/239 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+ AL +GA+GLTVHPRPDQRHIR++DL +I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVTGLGRAALAAGAAGLTVHPRPDQRHIRFSDLGDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID+++P+AE NIEG+P+E FL+L E+++PEQ+TLVPDDP Q TSDHGWDF+     L
Sbjct: 61  RALIDDEYPQAEFNIEGFPSEAFLDLVEKHEPEQVTLVPDDPMQATSDHGWDFMSKADFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VARL   G R+SLFAD   +    + AK  GAD +ELYTGPYGA +++P      L+
Sbjct: 121 APIVARLKGRGMRVSLFAD--PDPLGYERAKAIGADRVELYTGPYGATHDDPAAAARELD 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +L   A+ A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A AL  G+   V
Sbjct: 179 RLEEAARAATTLGLAVNAGHDLTVDNLPALVKHIPQLAEVSIGHGLTADALMYGIPVTV 237


>gi|49474429|ref|YP_032471.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella quintana
           str. Toulouse]
 gi|49239933|emb|CAF26334.1| pyridoxal phosphate biosynthetic protein pdxj [Bartonella quintana
           str. Toulouse]
          Length = 244

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 134/245 (54%), Positives = 170/245 (69%), Gaps = 5/245 (2%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVNLNAVAVLRNRRNLPWPN+ +IG IAL +GA+GLTVHPRPD+RHIR+ DL +I
Sbjct: 1   MAVKLSVNLNAVAVLRNRRNLPWPNIKNIGHIALTAGAAGLTVHPRPDERHIRFADLRDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LI+  FP AE NIEGYP++ FL+L E+Y  +QITLVPD P Q TSDHGWDF  +   L
Sbjct: 61  RCLINSTFPAAEFNIEGYPSDRFLDLAEKY-ADQITLVPDHPTQSTSDHGWDFAHDAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFL 179
              + RL +   R+SLFA  N     L  AK  GAD +E YTG YG AC    +Q +  L
Sbjct: 120 APIIQRLKDKKIRVSLFA--NPLVDGLDIAKTIGADRVEFYTGLYGNACQEKTKQGQ-EL 176

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +KL + A+ A+++ L +NAGHDLTI N+P LI  I ++ E+S+GH   A ALE G+ + V
Sbjct: 177 DKLTLAAKRAKELQLGVNAGHDLTISNLPALIKRISWLDEVSIGHGLIADALEYGMHKTV 236

Query: 240 FCFRR 244
             F R
Sbjct: 237 QRFIR 241


>gi|306843278|ref|ZP_07475887.1| pyridoxal phosphate biosynthetic protein PdxJ [Brucella sp. BO2]
 gi|306286544|gb|EFM58127.1| pyridoxal phosphate biosynthetic protein PdxJ [Brucella sp. BO2]
          Length = 246

 Score =  259 bits (661), Expect = 4e-67,   Method: Compositional matrix adjust.
 Identities = 128/239 (53%), Positives = 173/239 (72%), Gaps = 2/239 (0%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVNLNA+A+LRNRR+LPWP++  +G+ AL +GA+GLTVHPRPDQRHIR++DL +I
Sbjct: 1   MPAKLSVNLNAIAMLRNRRDLPWPSVTGLGRAALAAGAAGLTVHPRPDQRHIRFSDLGDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LID+++P+AE NIEG+P+E FL+L E+++PEQ+TLVPDDP Q TSDHGWDF+     L
Sbjct: 61  RALIDDEYPQAEFNIEGFPSEAFLDLVEKHEPEQVTLVPDDPMQATSDHGWDFMSKADFL 120

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VARL   G R+SLFAD   +    + AK  GAD +ELYTGPYGA +++P      L+
Sbjct: 121 APIVARLKGRGMRVSLFAD--PDPLGYERAKAIGADRVELYTGPYGATHDDPAAAVRELD 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +L   A+ A  + L +NAGHDLT+ N+P L+  IP ++E+S+GH   A AL  G+   V
Sbjct: 179 RLEEAARAATALGLAVNAGHDLTVDNLPALVKHIPQLAEVSIGHGLTADALMYGIPVTV 237


>gi|121601694|ref|YP_989201.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella
           bacilliformis KC583]
 gi|120613871|gb|ABM44472.1| putative pyridoxal phosphate biosynthesis protein PdxJ [Bartonella
           bacilliformis KC583]
          Length = 244

 Score =  258 bits (658), Expect = 8e-67,   Method: Compositional matrix adjust.
 Identities = 131/244 (53%), Positives = 174/244 (71%), Gaps = 3/244 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVNLNA+AVLRNRR+LPWPN++ +G IAL +GA+GLTVHPRPD+RHIR++DLP++
Sbjct: 1   MAVKLSVNLNAIAVLRNRRHLPWPNVIDMGHIALAAGAAGLTVHPRPDERHIRFSDLPDM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R LI+  FP AE NIEGYP++TFL+L E+Y  +QITLVPD P Q TSDHGWDF ++   L
Sbjct: 61  RFLINHNFPAAEFNIEGYPSDTFLDLAEKYA-DQITLVPDSPDQSTSDHGWDFAKDAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  + RL     R+SLFA  N     L  AK  GAD +E YTG YG  + + +     L+
Sbjct: 120 TPIIQRLKEKKIRVSLFA--NPVLEGLDIAKKIGADRVEFYTGLYGGAFKDKKTRDHELD 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL + A+ A++++L INAGHDLT+ N+P LI+ IP+  E+SVGH   A AL+ G+ E V 
Sbjct: 178 KLFLAAKKAKELELGINAGHDLTVANLPALISQIPWFDEVSVGHGLIADALKYGMHETVQ 237

Query: 241 CFRR 244
            F +
Sbjct: 238 RFTK 241


>gi|240850860|ref|YP_002972260.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella grahamii
           as4aup]
 gi|240267983|gb|ACS51571.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella grahamii
           as4aup]
          Length = 244

 Score =  256 bits (654), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 133/244 (54%), Positives = 171/244 (70%), Gaps = 3/244 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVNLNAVAVLRNRRNLPWP++ +IG IAL +GA+GLTVHPRPD+RHIR+ DLP+I
Sbjct: 1   MAVKLSVNLNAVAVLRNRRNLPWPSITNIGHIALAAGAAGLTVHPRPDERHIRFADLPDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
             LI   FP AELNIEGYP++ FL++ E+Y  +QITLVPDDP Q TSDHGW+F  +   L
Sbjct: 61  YCLIKNNFPTAELNIEGYPSDQFLDIAEKYA-DQITLVPDDPAQSTSDHGWNFAHDAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  +  L     R+SLFA  N     L  AK  GAD +E YTGPYG  + +  ++   LN
Sbjct: 120 TPIIQHLKKRKIRVSLFA--NPTIDGLDTAKAIGADRVEFYTGPYGGAFQDKIKQDQELN 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL + A+ A+++ L INAGHDLTI N+P L+  IP++ E+S+GH   A ALE G+ + V 
Sbjct: 178 KLVLAAKKAKELQLGINAGHDLTIANLPALVKNIPWLDEVSIGHGLIADALEYGMHDTVQ 237

Query: 241 CFRR 244
            F R
Sbjct: 238 RFIR 241


>gi|163868681|ref|YP_001609890.1| pyridoxine 5'-phosphate synthase [Bartonella tribocorum CIP 105476]
 gi|161018337|emb|CAK01895.1| pyridoxal phosphate biosynthetic protein PdxJ [Bartonella
           tribocorum CIP 105476]
          Length = 244

 Score =  254 bits (649), Expect = 8e-66,   Method: Compositional matrix adjust.
 Identities = 132/244 (54%), Positives = 169/244 (69%), Gaps = 3/244 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVNLNAVAVLRNRRNLPWPN+ +IG IAL +GA+GLTVHPRPD+RHIR+ DLP+I
Sbjct: 1   MAVKLSVNLNAVAVLRNRRNLPWPNIKNIGHIALAAGAAGLTVHPRPDERHIRFADLPDI 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
             LI   FP AE NIEGYP++ FL++ E Y  +Q+TLVPDDP Q TSDHGW+F  +   L
Sbjct: 61  YGLIKNIFPPAEFNIEGYPSDQFLDIAENYA-DQMTLVPDDPDQSTSDHGWNFAHDAEFL 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + RL     R+SLFA  N     L  AK  GAD +E YTGPYGA + +   +   LN
Sbjct: 120 APIIQRLKKRKIRVSLFA--NPTIDGLDIAKAIGADRVEFYTGPYGAAFQDKTTQDQELN 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           KL + A+ A+++ L +NAGHDLTI N+P L+  IP++ E+S+GH   A ALE G+ + V 
Sbjct: 178 KLVLAAKRAKELQLGMNAGHDLTIMNLPALVKNIPWLDEVSIGHGLIADALEYGMHKTVQ 237

Query: 241 CFRR 244
            F R
Sbjct: 238 RFIR 241


>gi|254470223|ref|ZP_05083627.1| pyridoxal phosphate biosynthesis protein PdxJ [Pseudovibrio sp.
           JE062]
 gi|211960534|gb|EEA95730.1| pyridoxal phosphate biosynthesis protein PdxJ [Pseudovibrio sp.
           JE062]
          Length = 252

 Score =  254 bits (649), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 123/249 (49%), Positives = 177/249 (71%), Gaps = 2/249 (0%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           + +SVN+NAVAVLRNRR++PWP++ H+  +AL +GA G+TVHPRPD+RHIR TD+ +I +
Sbjct: 5   SRLSVNVNAVAVLRNRRDVPWPSVTHLAALALNAGAKGITVHPRPDERHIRRTDVEDISK 64

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++ E+    EL +EGYP+E F+ L +  +P Q+  VPDDP Q TSDHGWDF +N  LL  
Sbjct: 65  MLREELHGKELCLEGYPDERFMELVKEVRPTQVLFVPDDPSQQTSDHGWDFSENMDLLKD 124

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A+  + G R SLF D   ++  L A    GA+ IE+YTGPYGAC+++ + E++ L K+
Sbjct: 125 VIAQAKSWGVRTSLFVDPEPSQPPLAAE--AGAERIEIYTGPYGACHSDKEAEKVELEKV 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
             TA+ A+   L +NAGHDLT++N+P LI  +PYISE+S+GH F A ALE G  ++V  F
Sbjct: 183 VATAEAAKAAGLMVNAGHDLTVENLPALIERVPYISEVSIGHGFTADALEHGFTQSVRRF 242

Query: 243 RRACGQHLD 251
           R+A G+ ++
Sbjct: 243 RKALGEPVE 251


>gi|313575254|emb|CBI71194.1| hypothetical protein [uncultured bacterium]
          Length = 247

 Score =  253 bits (647), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 127/241 (52%), Positives = 165/241 (68%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVNLNAVA LRNRR+LPWP++V + ++ L +GASG+TVHPRPD+RHIR +D+ ++  
Sbjct: 2   TLLSVNLNAVAQLRNRRDLPWPSVVGMARVVLDAGASGVTVHPRPDERHIRRSDVFDLSA 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ +++P+AE NIEGYP+E F+ L E   P+Q+TLVPDDP Q TSDHGWDF  N   LT 
Sbjct: 62  LLRDEYPEAEFNIEGYPSEDFIALIETVNPQQVTLVPDDPAQATSDHGWDFHANNNFLTS 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V +L   G RISLF D +     + AAK TGAD +ELYTGPYG CY++P +    L  L
Sbjct: 122 VVQKLKQPGRRISLFCDPDAGAKGISAAKATGADRVELYTGPYGGCYDDPARAEAELAAL 181

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A TA  A    L +NAGHDLT++N+P    A+  + E S+GH   A AL  G  EAV  +
Sbjct: 182 ADTAAAAHAAGLGLNAGHDLTLENLPAFQAAVKGVDEASIGHGLTADALLMGFPEAVRRY 241

Query: 243 R 243
           R
Sbjct: 242 R 242


>gi|307945881|ref|ZP_07661217.1| pyridoxal phosphate biosynthesis protein PdxJ [Roseibium sp.
           TrichSKD4]
 gi|307771754|gb|EFO30979.1| pyridoxal phosphate biosynthesis protein PdxJ [Roseibium sp.
           TrichSKD4]
          Length = 249

 Score =  249 bits (635), Expect = 3e-64,   Method: Compositional matrix adjust.
 Identities = 116/246 (47%), Positives = 172/246 (69%), Gaps = 2/246 (0%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           + +SVN+NA+A+LRNRR+LPWP++  +  +A+++GA G+TVHPRPD+RHIR +D+ E+  
Sbjct: 5   SRLSVNVNAIAMLRNRRDLPWPSVTGLAALAMEAGAKGITVHPRPDERHIRKSDVFELSE 64

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           LI+++FP  EL +EGYP+  F+ L E  +P+Q+  VPD+P Q TSDHGWDF ++ + L  
Sbjct: 65  LIEDRFPNKELCLEGYPSPDFMKLVEDARPDQVLFVPDEPEQTTSDHGWDFSKDTSRLAD 124

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A   +    +SLF D + +  +  AAK+ GA+ IE+YTGPYGACY++  +    L+K+
Sbjct: 125 AIAMSKDCAVTVSLFCDPDPSAPA-HAAKM-GAERIEIYTGPYGACYDDQDRALKELDKV 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
             TA+ AQ + L +NAGHDLT++NIP L+   P+I E+S+GH F A AL  G   +V  F
Sbjct: 183 VATAESAQAVGLGVNAGHDLTVENIPPLLAKAPFIREMSIGHGFTADALIHGFAASVNRF 242

Query: 243 RRACGQ 248
           R A G+
Sbjct: 243 RCAMGE 248


>gi|254502130|ref|ZP_05114281.1| pyridoxal phosphate biosynthesis protein PdxJ [Labrenzia alexandrii
           DFL-11]
 gi|222438201|gb|EEE44880.1| pyridoxal phosphate biosynthesis protein PdxJ [Labrenzia alexandrii
           DFL-11]
          Length = 249

 Score =  247 bits (631), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 123/246 (50%), Positives = 166/246 (67%), Gaps = 2/246 (0%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           + +SVN+NAVA+LRNRR+LPWP++  +  IA+++GA G+TVHPRPD+RHIR TD+ E+  
Sbjct: 5   SRLSVNVNAVAMLRNRRDLPWPSVAGLAAIAMEAGAKGITVHPRPDERHIRKTDVFELAE 64

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           LI+E+FP  EL +EGYP+  F+ L E  +PEQ+  VPDDP Q TSDHGWDF ++  LL  
Sbjct: 65  LIEERFPNKELCLEGYPSPDFMKLVEEARPEQVLFVPDDPDQTTSDHGWDFSKDIGLLET 124

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A        +SLF   N +      A   GA+ IE+YTGPYGACY+ P      L+K+
Sbjct: 125 AIAAAKEWAVTVSLFC--NPDPADPDHAARIGAERIEIYTGPYGACYDTPDLAAKELDKI 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A TA+ A+   L +NAGHDLT++NIP L+   P+I E+S+GH F A AL  G  E+V  F
Sbjct: 183 AATAKAAKAAGLGVNAGHDLTVENIPALLQRAPFIREMSIGHGFTADALVYGFAESVRRF 242

Query: 243 RRACGQ 248
           R A G+
Sbjct: 243 RTAMGE 248


>gi|163733677|ref|ZP_02141119.1| pyridoxal phosphate biosynthetic protein PdxJ [Roseobacter
           litoralis Och 149]
 gi|161392788|gb|EDQ17115.1| pyridoxal phosphate biosynthetic protein PdxJ [Roseobacter
           litoralis Och 149]
          Length = 255

 Score =  246 bits (628), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 118/253 (46%), Positives = 166/253 (65%), Gaps = 2/253 (0%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N  A+LRNRR+  WP++V +G+ ALQ+GA G+TVHPRPDQRHIR +D+ ++R 
Sbjct: 2   THLSVNVNVAALLRNRRDHAWPDIVGLGRTALQAGAFGITVHPRPDQRHIRPSDVWDLRT 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++D +FP  ELN+EG+P   FL L    + +QITLVPDDP Q TSDHGWDF   +A L  
Sbjct: 62  MLDAEFPDRELNVEGFPTSDFLALAHDVRADQITLVPDDPAQATSDHGWDFTAEKAFLMP 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A L     R++LFAD +     ++AA  TGAD +ELYTGPYG+ Y++P  +   L++L
Sbjct: 122 IIADLKFNRHRVALFADPDATH--MKAAAETGADRVELYTGPYGSAYDDPVAQTRALDRL 179

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+ A    L INAGHDLT++    L+  +P I E+S+GHA    AL  G+ E V  +
Sbjct: 180 EDAARAAANEGLGINAGHDLTVEGTARLVGRVPSIDEVSIGHALFCDALSHGMAETVRRY 239

Query: 243 RRACGQHLDNTMR 255
             +C   ++ + R
Sbjct: 240 LVSCDGQMNPSTR 252


>gi|254464738|ref|ZP_05078149.1| pyridoxal phosphate biosynthesis protein PdxJ [Rhodobacterales
           bacterium Y4I]
 gi|206685646|gb|EDZ46128.1| pyridoxal phosphate biosynthesis protein PdxJ [Rhodobacterales
           bacterium Y4I]
          Length = 261

 Score =  244 bits (624), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 125/252 (49%), Positives = 161/252 (63%), Gaps = 10/252 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+NAVA LRNRR +PWPNL  I +  LQ+GA G+TVHPRPD+RHIR++DLP++ R
Sbjct: 10  TLLSVNVNAVAYLRNRREVPWPNLTDIARAILQAGAHGITVHPRPDERHIRFSDLPDLSR 69

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           LI E+FP+AE NIEGYP   F++L    KP Q+TLVPD P Q TSDHGWDF  +  +L  
Sbjct: 70  LIAEEFPQAEFNIEGYPTRHFIDLVLENKPHQVTLVPDTPEQSTSDHGWDFAADGGMLLP 129

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
                   G R+S F D N  + +L  A+  GAD IE YTGPY A   +P      L ++
Sbjct: 130 IAQEFKAAGIRVSYFVDPNPADPAL--AQQAGADRIEFYTGPY-ANQTSPDATGRELARI 186

Query: 183 AITAQLAQKMD-------LQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
             TA  A+++        L +NAGHDLT+ N+P L  AIP ++E+S+GHA  A AL  G 
Sbjct: 187 KATADAARQLGAEGASTALMMNAGHDLTVDNLPALRQAIPDLAEVSIGHAITADALMLGF 246

Query: 236 KEAVFCFRRACG 247
            EAV  + R  G
Sbjct: 247 PEAVRRYLRVLG 258


>gi|328543021|ref|YP_004303130.1| Pyridoxine 5'-phosphate synthase [polymorphum gilvum SL003B-26A1]
 gi|326412767|gb|ADZ69830.1| Pyridoxine 5'-phosphate synthase [Polymorphum gilvum SL003B-26A1]
          Length = 248

 Score =  240 bits (613), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 164/247 (66%), Gaps = 2/247 (0%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           ++ +SVN+NAVA+LRNRRNLPWP++  +  IAL++GA G+TVHPRPD+RHIR +D+ ++ 
Sbjct: 3   ASRLSVNVNAVAMLRNRRNLPWPSVTGLAAIALEAGAKGITVHPRPDERHIRRSDVYDLA 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            LI+++FP  EL +EGYP   FL L E  +P+Q+  VPD P Q TSDHGW F  +   L 
Sbjct: 63  ELIEDRFPHKELCLEGYPAPDFLKLVEEARPDQVLFVPDAPEQSTSDHGWRFDTDAGPLA 122

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + +A   +    +SLF D +      + A   GA+ IE+YTGPYGACY++P      L++
Sbjct: 123 EAIAAARDWSVAVSLFLDPDPTLP--EGAAAIGAERIEIYTGPYGACYDDPAAAARELDR 180

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +  TA+ A+   L +NAGHDLT+ NIP LI   P+I E+S+GH F A AL  G  E+V  
Sbjct: 181 IVATAEAARAAGLGVNAGHDLTVDNIPALIARAPFIREMSIGHGFTADALIYGFAESVRR 240

Query: 242 FRRACGQ 248
           FR A G+
Sbjct: 241 FRHAMGE 247


>gi|163793306|ref|ZP_02187281.1| Pyridoxal phosphate biosynthetic protein PdxJ [alpha
           proteobacterium BAL199]
 gi|159181108|gb|EDP65623.1| Pyridoxal phosphate biosynthetic protein PdxJ [alpha
           proteobacterium BAL199]
          Length = 273

 Score =  228 bits (581), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 114/256 (44%), Positives = 167/256 (65%), Gaps = 6/256 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVNLN VA LRN R+   P+++   +I L++GA+G+TVHPRPD RHIR  D+ ++  
Sbjct: 17  TALSVNLNKVATLRNTRHHDAPSVLKAARIVLEAGAAGVTVHPRPDARHIRERDVFDLAE 76

Query: 63  LIDE-QFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           L+   ++   E N+EGYP++ FL+L ER +P+Q+TLVPD P Q TSDHGWD   +  +L 
Sbjct: 77  LLKAPEWADREFNVEGYPDDRFLDLIERVRPDQVTLVPDAPEQSTSDHGWDLPADAGILA 136

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             VARL  +G R+SLFAD + +   ++ AK  GAD +ELYTGPY   +  P+Q  + L  
Sbjct: 137 PIVARLKKIGCRVSLFADPDVS--VIEGAKAVGADRVELYTGPYYDAFGGPKQAEV-LAV 193

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               AQ A+ + L +NAGHDLT+ N+P L +AIP+I E+S+GH     AL  G+  +V  
Sbjct: 194 FVGAAQRARDLGLGLNAGHDLTLDNLPTLSSAIPWIDEVSIGHHLIGDALWMGLAASVKA 253

Query: 242 FRRA--CGQHLDNTMR 255
           +++    GQ L  +++
Sbjct: 254 YQKCLEAGQSLRASLK 269


>gi|83643040|ref|YP_431475.1| pyridoxine 5'-phosphate synthase [Hahella chejuensis KCTC 2396]
 gi|83631083|gb|ABC27050.1| Pyridoxal phosphate biosynthesis protein [Hahella chejuensis KCTC
           2396]
          Length = 242

 Score =  215 bits (548), Expect = 4e-54,   Method: Compositional matrix adjust.
 Identities = 111/239 (46%), Positives = 151/239 (63%), Gaps = 5/239 (2%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M T +SVNLN +A++RN R   +P++   G+ ALQ+GA G+T+HPRPDQRH RY+D+ ++
Sbjct: 1   MKTVLSVNLNKIALIRNSRGRDYPSVKAFGRRALQAGAGGVTIHPRPDQRHARYSDIADL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
             L+ E F  AELNIEGYP E  +    RYKP Q TLVPD P Q+TSDHGWD  Q+   +
Sbjct: 61  SELVKE-FADAELNIEGYPEEELIEQVLRYKPHQFTLVPDKPDQITSDHGWDLNQDGEFV 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T  V ++   G R+SLF D   +E  ++ A+ TGA  IELYT  Y   Y  PQ + I   
Sbjct: 120 TDIVRKVQAAGVRVSLFMD--PDEAQIKLAQETGAKRIELYTEEYAHAYGAPQFDAIAAK 177

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            LA  A+ A  + L +NAGHDL ++N+  L+ A   I+E+S+GHA    ALE G  + +
Sbjct: 178 YLA-CARYAVSLGLTVNAGHDLNLENLAPLV-AEGTIAEVSIGHALTVEALEMGFDQVI 234


>gi|121595566|ref|YP_987462.1| pyridoxine 5'-phosphate synthase [Acidovorax sp. JS42]
 gi|120607646|gb|ABM43386.1| pyridoxine 5'-phosphate synthase [Acidovorax sp. JS42]
          Length = 259

 Score =  202 bits (515), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 151/248 (60%), Gaps = 4/248 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA++RN R+L  P+++   ++ L++GA G+TVHPRPD+RHIR  D+ ++  
Sbjct: 8   TALSVNVNKVALVRNTRHLGIPSVLRAAQLCLEAGAQGITVHPRPDERHIRAHDVYQLAE 67

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ +Q+P+AE NIEG P    +    + +P Q T VPD   Q TSDHGW F Q+   L  
Sbjct: 68  LL-KQWPQAEYNIEGNPTHNLMEFIRQVRPHQATFVPDSQDQFTSDHGWSFPQDAERLAP 126

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A    LG R+SLF D    +  + AA   GAD +ELYT PY A +  PQQ  + L + 
Sbjct: 127 LIAECRQLGVRVSLFMDPVPEQ--MAAAHAVGADRVELYTEPYAAAWGTPQQA-VQLERY 183

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQ A  + L +NAGHDL+  N+ + +  +P + E+S+GHA  A ALE G  + V  +
Sbjct: 184 RAAAQAALDVGLGVNAGHDLSRDNLADFLAHVPGVLEVSIGHALIADALELGYGDTVRAY 243

Query: 243 RRACGQHL 250
           +R   Q +
Sbjct: 244 QRCIAQGM 251


>gi|222111787|ref|YP_002554051.1| pyridoxine 5'-phosphate synthase [Acidovorax ebreus TPSY]
 gi|221731231|gb|ACM34051.1| Pyridoxal phosphate biosynthetic protein PdxJ [Acidovorax ebreus
           TPSY]
          Length = 259

 Score =  202 bits (513), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 151/248 (60%), Gaps = 4/248 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA++RN R+L  P+++   ++ L++GA G+TVHPRPD+RHIR  D+ ++  
Sbjct: 8   TALSVNVNKVALVRNTRHLGIPSVLRAAQLCLEAGAQGITVHPRPDERHIRAHDVYQLAE 67

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ +Q+P+AE NIEG P    +    + +P Q T VPD   Q TSDHGW F Q+   L  
Sbjct: 68  LL-KQWPQAEYNIEGNPTHNLMEFIRQVRPHQATFVPDSQDQFTSDHGWSFPQDAERLAP 126

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A    LG R+SLF D    +  + AA+  GAD +ELYT PY A +  PQQ    L + 
Sbjct: 127 LIAECRQLGVRVSLFMDPLPEQ--MAAARAVGADRVELYTEPYAAAWGTPQQA-AQLERY 183

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQ A  + L +NAGHDL+  N+ + +  +P + E+S+GHA  A ALE G  + V  +
Sbjct: 184 RAAAQAALDVGLGVNAGHDLSRDNLADFLAHVPGVLEVSIGHALIADALELGYGDTVRAY 243

Query: 243 RRACGQHL 250
           +R   Q +
Sbjct: 244 QRCIAQGM 251


>gi|332525370|ref|ZP_08401533.1| pyridoxine 5'-phosphate synthase [Rubrivivax benzoatilyticus JA2]
 gi|332108642|gb|EGJ09866.1| pyridoxine 5'-phosphate synthase [Rubrivivax benzoatilyticus JA2]
          Length = 263

 Score =  202 bits (513), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 104/243 (42%), Positives = 151/243 (62%), Gaps = 4/243 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA+LRN R+L  P++V    + LQ+GA G+TVHPRPD+RHIR  D+ ++  
Sbjct: 15  TKLSVNVNKVALLRNTRHLGIPSVVRAATLCLQAGADGITVHPRPDERHIRGHDVHDLAA 74

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ + +P+AE NIEG P    +      +P+Q+T VPD   Q TSDHGW+  ++   L  
Sbjct: 75  LLRD-WPQAEYNIEGNPFHNLMAYVRELRPQQVTFVPDSEAQFTSDHGWNLPEDAERLRP 133

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A  H+ G R+SLF D      ++  A+  GAD +ELYT PY A +  P+Q  + L + 
Sbjct: 134 VIAEAHSFGVRVSLFMD--PIPEAMAIAREIGADRVELYTEPYAAAWGTPRQAEV-LERF 190

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A   + A    LQ+NAGHDL   N+P+ + A+P + E+S+GHA  A ALE G+ E V  +
Sbjct: 191 AAAGRAALAAGLQLNAGHDLNCDNLPDFLRAVPGVQEVSIGHALIADALELGLPETVRAY 250

Query: 243 RRA 245
           +RA
Sbjct: 251 QRA 253


>gi|296122565|ref|YP_003630343.1| pyridoxine 5'-phosphate synthase [Planctomyces limnophilus DSM
           3776]
 gi|296014905|gb|ADG68144.1| Pyridoxine 5'-phosphate synthase [Planctomyces limnophilus DSM
           3776]
          Length = 255

 Score =  201 bits (511), Expect = 7e-50,   Method: Compositional matrix adjust.
 Identities = 105/243 (43%), Positives = 149/243 (61%), Gaps = 4/243 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA+LRN R+L  P+++    + + +GA G+TVHPRPD+RHIR +D+ E+  
Sbjct: 5   TKLSVNVNKVALLRNSRHLGIPSVLRAASLCIAAGAEGITVHPRPDERHIRRSDVRELSA 64

Query: 63  LIDEQFPKAELNIEGYP-NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           LI +  P  ELNIEG P  + FL+L     P+Q T+VPD P Q TSDHGW+ L ++  L 
Sbjct: 65  LIRQHHPHIELNIEGNPLADGFLDLVFEVVPDQCTMVPDSPEQSTSDHGWNVLADREKLV 124

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             + +L   G R SLF D +  +  + AAK  GAD IELYT PY + Y       I L +
Sbjct: 125 PVLEKLRAAGIRSSLFLDPDVTQ--VAAAKEVGADRIELYTEPYASSYGKENAGEI-LEQ 181

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
              TA++A +  L +NAGHDL ++N+   +  +P + E+S+GHA  A ALE G    V  
Sbjct: 182 YVATAKMALEHGLGVNAGHDLNLENLGKFLREVPAVLEVSIGHALIADALELGYATTVAA 241

Query: 242 FRR 244
           +R+
Sbjct: 242 YRK 244


>gi|311745579|ref|ZP_07719364.1| pyridoxine 5'-phosphate synthase [Algoriphagus sp. PR1]
 gi|126578140|gb|EAZ82360.1| pyridoxine 5'-phosphate synthase [Algoriphagus sp. PR1]
          Length = 238

 Score =  199 bits (507), Expect = 3e-49,   Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 151/242 (62%), Gaps = 9/242 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PN+V +   A + GA G+TVHPRPD+RHIR+ D+ ++ +
Sbjct: 2   TKLSVNINKIATLRNARGANNPNVVQVALDAERFGAEGITVHPRPDERHIRHQDVFDLAK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEGYP++ F++L +  KP Q TLVPD P+ +TS+ GWD + NQ +L  
Sbjct: 62  VVTTEF-----NIEGYPDQRFMDLVKEVKPAQATLVPDPPNAITSNTGWDTISNQGMLKD 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V+ L   G R+S+F   N      + AKLTG D +ELYT PY   ++  +++ +     
Sbjct: 117 IVSELQEAGIRVSIFI--NPEIKYFEPAKLTGTDRVELYTEPYAVGFHQDKEKAV--KAY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A++A+++ L +NAGHDL + N+  L  +IPY+ E+S+GHA    AL  G++  +  +
Sbjct: 173 VEVAEIAKELGLGLNAGHDLDLHNLAFLKKSIPYLDEVSIGHALVCDALYYGLENTIQMY 232

Query: 243 RR 244
           RR
Sbjct: 233 RR 234


>gi|319763842|ref|YP_004127779.1| pyridoxal phosphate biosynthetic protein pdxj [Alicycliphilus
           denitrificans BC]
 gi|330823894|ref|YP_004387197.1| pyridoxal phosphate biosynthetic protein PdxJ [Alicycliphilus
           denitrificans K601]
 gi|317118403|gb|ADV00892.1| pyridoxal phosphate biosynthetic protein PdxJ [Alicycliphilus
           denitrificans BC]
 gi|329309266|gb|AEB83681.1| pyridoxal phosphate biosynthetic protein PdxJ [Alicycliphilus
           denitrificans K601]
          Length = 255

 Score =  197 bits (501), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 105/248 (42%), Positives = 148/248 (59%), Gaps = 4/248 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA++RN R+L  P++    ++ LQ+GA G+TVHPRPD+RHIR  D+ E+  
Sbjct: 7   TALSVNVNKVALVRNTRHLGIPSVTRAAQLCLQAGAQGITVHPRPDERHIRAQDVHELAA 66

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ +Q+P+AE NIEG P    +    +  P Q T VPD   Q TSDHGW F ++   L  
Sbjct: 67  LL-KQWPQAEFNIEGNPTHNLMEFICQVLPAQATFVPDSVGQFTSDHGWRFPEDAERLAP 125

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VA    LG R+SLF D    +  + AA+  GAD +ELYT PY A +  P+Q    L + 
Sbjct: 126 LVAECKALGVRVSLFMDPVPEQ--MAAARAVGADRVELYTEPYAAAWGTPRQS-AELARY 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQ A    L +NAGHDL   N+ + + A+P + E+S+GHA  A ALE G  + V  +
Sbjct: 183 RDAAQAALDAGLGVNAGHDLNRDNLADFLAAVPGVLEVSIGHALIADALELGYGDTVRAY 242

Query: 243 RRACGQHL 250
           +R   Q +
Sbjct: 243 QRCIDQGM 250


>gi|87119199|ref|ZP_01075097.1| pyridoxal phosphate biosynthetic protein [Marinomonas sp. MED121]
 gi|86165590|gb|EAQ66857.1| pyridoxal phosphate biosynthetic protein [Marinomonas sp. MED121]
          Length = 241

 Score =  196 bits (499), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/240 (41%), Positives = 148/240 (61%), Gaps = 5/240 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVNLN + +LRN R   +PN+V + K  L+ GA G+T+HPRPDQRH  Y D  +++ 
Sbjct: 2   THLSVNLNKIGLLRNSRGRDYPNMVEVAKKTLELGAFGITIHPRPDQRHATYQDARDLKA 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+   +P  ELNIEG+P++TF+++     PEQ TLVPDDP+QLTSDHGW+  ++   L  
Sbjct: 62  LL-ANYPGKELNIEGFPDQTFIDVVLEVVPEQCTLVPDDPNQLTSDHGWNLGRDSETLVP 120

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            + ++   G R+ LF D + +  +++ AK TGAD +ELYT  Y   Y   + E + L   
Sbjct: 121 IIQKMQAAGIRVCLFMDPDAS--AMKMAKDTGADRVELYTEAYANAYGTEEVENV-LADY 177

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQ A    L++NAGHDL ++N+  L ++   I+E+S+GHA    +L+ G    V  +
Sbjct: 178 NSAAQAAVDAGLEVNAGHDLDLENVKALCDS-GLITEVSIGHALTVESLDLGWNNVVKAY 236


>gi|89900541|ref|YP_523012.1| pyridoxine 5'-phosphate synthase [Rhodoferax ferrireducens T118]
 gi|122479394|sp|Q21XM2|PDXJ_RHOFD RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|89345278|gb|ABD69481.1| Pyridoxal phosphate biosynthetic protein PdxJ [Rhodoferax
           ferrireducens T118]
          Length = 252

 Score =  196 bits (497), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 107/253 (42%), Positives = 152/253 (60%), Gaps = 9/253 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+T +SVNLN VA++RN R+L  P++     + LQ+GA+G+TVHPRPD+RHIR  D+ ++
Sbjct: 1   MTTKLSVNLNKVALVRNTRHLGIPSVTRAATLCLQAGANGITVHPRPDERHIRTDDVRDL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLN----LCERYKP-EQITLVPDDPHQLTSDHGWDFLQ 115
             L+ + +P  E NIEG P    ++    L E+  P  Q+T VPD   Q TSDHGW+F  
Sbjct: 61  ALLM-QAWPDREFNIEGNPLHNLMDVVHGLVEKKLPVHQVTFVPDSEGQFTSDHGWNFPG 119

Query: 116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE 175
           + + L   +A+ H  G R+SLF D   +  ++  A+  GAD +ELYT PY A +   QQ 
Sbjct: 120 DASRLRPLIAQAHAWGLRVSLFMD--ADPAAMAGAQAVGADRVELYTEPYAAAWGTAQQT 177

Query: 176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
              L + A TA+ A K+ L +NAGHDL   N+   I A+P ++E+S+GHA  A ALE G 
Sbjct: 178 PQ-LARFAETARAALKLGLGVNAGHDLNRDNLSAFIQAVPGVAEVSIGHALIADALELGY 236

Query: 236 KEAVFCFRRACGQ 248
              V  + R   Q
Sbjct: 237 SATVQAYLRCIAQ 249


>gi|320104291|ref|YP_004179882.1| pyridoxine 5'-phosphate synthase [Isosphaera pallida ATCC 43644]
 gi|319751573|gb|ADV63333.1| pyridoxine 5'-phosphate synthase [Isosphaera pallida ATCC 43644]
          Length = 245

 Score =  195 bits (495), Expect = 6e-48,   Method: Compositional matrix adjust.
 Identities = 109/248 (43%), Positives = 150/248 (60%), Gaps = 7/248 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R+   PNL  + +IAL +GA+G+T+HPRPD+RHIR  D+P++ +
Sbjct: 2   TKLSVNVNKIATLRNTRHYEVPNLERLARIALDAGAAGITIHPRPDRRHIRPGDVPKLAK 61

Query: 63  LIDEQFPKAELNIEGYP-NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQAL-- 119
           ++ E FP AE NIEG P    +L      +P Q T VPD   Q TSDHG+D    Q    
Sbjct: 62  VVAE-FPDAEFNIEGNPFGAEYLQHLANVRPTQATFVPDADDQFTSDHGFDLSDPQVCQS 120

Query: 120 LTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFL 179
           L   +A +  LG R+SLF D   +     AA+L GAD IELYT PY   +  PQ   + L
Sbjct: 121 LKPKIAEVQGLGCRVSLFLDPRPDLVP-HAARL-GADRIELYTAPYAQAFPTPQLNSV-L 177

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                TAQ A +  L +NAGHDL++ N+   ++++P + E+S+GHAF A ALE G+ E V
Sbjct: 178 ELYIQTAQAAVEHGLGVNAGHDLSLDNLARFLSSVPKVLEVSIGHAFIADALEFGMAETV 237

Query: 240 FCFRRACG 247
             +R   G
Sbjct: 238 RRYRAITG 245


>gi|160900690|ref|YP_001566272.1| pyridoxine 5'-phosphate synthase [Delftia acidovorans SPH-1]
 gi|160366274|gb|ABX37887.1| Pyridoxal phosphate biosynthetic protein PdxJ [Delftia acidovorans
           SPH-1]
          Length = 257

 Score =  194 bits (492), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 146/248 (58%), Gaps = 4/248 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA+LRN R+L  P++    +I L++GA G+T+HPRPDQRHIR  D+ E++ 
Sbjct: 10  TALSVNVNKVALLRNTRHLGIPSVTRAARICLEAGAQGITIHPRPDQRHIRSEDVYELQA 69

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ +Q+P+AE NIEG P +  ++     +P Q T VPD   Q TSDHGW+F Q+   L  
Sbjct: 70  LM-KQWPQAEFNIEGNPTQNLMDFIRDTRPHQATFVPDSEDQFTSDHGWNFPQDAERLKP 128

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A    LG R+SLF D    +  + AA+  GAD +ELYT PY A +    QE       
Sbjct: 129 LIAECRQLGVRVSLFMDPVPAQ--MAAARAVGADRVELYTEPYAAAWGTADQEAQLQAYA 186

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A          L INAGHDL+  N+   +  +P + E+S+GHA  A ALE G  E V  +
Sbjct: 187 AAAQAALDAG-LGINAGHDLSRDNLAAFVARVPGLLEVSIGHALIADALELGYAETVRAY 245

Query: 243 RRACGQHL 250
           ++   Q +
Sbjct: 246 QQCIDQGM 253


>gi|254424227|ref|ZP_05037945.1| pyridoxal phosphate biosynthesis protein PdxJ [Synechococcus sp.
           PCC 7335]
 gi|196191716|gb|EDX86680.1| pyridoxal phosphate biosynthesis protein PdxJ [Synechococcus sp.
           PCC 7335]
          Length = 242

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 110/245 (44%), Positives = 151/245 (61%), Gaps = 8/245 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVNLN VA+LRN R L  P++V +G+I++ +GA GLTVHPRPD+RHIR TD+ ++  
Sbjct: 2   TNLSVNLNKVAMLRNARPLTIPSVVKMGEISIAAGAHGLTVHPRPDERHIRRTDVYDLAS 61

Query: 63  LIDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           L++E  P  E NIEG P E  F+++    KP+Q TLVPDDP Q TSDHGW+  ++   L 
Sbjct: 62  LLEEH-PTIEYNIEGNPLEFPFMDIIREVKPDQCTLVPDDPTQNTSDHGWNVTRDGETLK 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF-LN 180
             +  L+ LG R+SLF D +  +  ++     G + IELYT PY   Y   +    F + 
Sbjct: 121 PIIGELNALGCRVSLFMDPDIEQ--IKLVPRLGCERIELYTEPYATAYREGKGRESFEIY 178

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           K A  A  AQ + L IN GHDL + N+P +   IP + E+S+GHA  A ALE G   AV 
Sbjct: 179 KAA--AACAQSVGLGINGGHDLNLDNLP-MFKEIPNLLEVSIGHALTADALEMGYANAVK 235

Query: 241 CFRRA 245
            +  A
Sbjct: 236 AYLEA 240


>gi|326316030|ref|YP_004233702.1| pyridoxal phosphate biosynthetic protein PdxJ [Acidovorax avenae
           subsp. avenae ATCC 19860]
 gi|323372866|gb|ADX45135.1| pyridoxal phosphate biosynthetic protein PdxJ [Acidovorax avenae
           subsp. avenae ATCC 19860]
          Length = 258

 Score =  193 bits (491), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 143/244 (58%), Gaps = 4/244 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           + T++SVN+N VA++RN R+L  P +     + L++GA G+T+HPRPD RHIR  D+P +
Sbjct: 6   VRTALSVNVNKVALVRNTRHLGIPGVERAALLCLEAGAQGITIHPRPDGRHIRAEDVPAL 65

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
             L+  Q+P  E NIEG P++  +      +P Q T VPD   Q TSDHGW F Q+   L
Sbjct: 66  AALL-RQWPDREFNIEGNPSQNLMEFIRAVRPHQATFVPDGEDQFTSDHGWSFPQDAERL 124

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VA    LG R+SLF D    +  + AA+  GAD +ELYT PY A +  P QE   L 
Sbjct: 125 APLVAECRGLGVRVSLFMDAEPAQ--MAAARAVGADRVELYTEPYAAAWGTPAQE-AQLV 181

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           + A  A+ A +  L +NAGHDL   N+   +  +P + E+S+GHAF A ALE G    V 
Sbjct: 182 RYAEAARAALEAGLGVNAGHDLNRDNLAAFVARVPGLMEVSIGHAFVADALELGYAATVQ 241

Query: 241 CFRR 244
            ++R
Sbjct: 242 AYQR 245


>gi|264677120|ref|YP_003277026.1| pyridoxal phosphate biosynthetic protein PdxJ [Comamonas
           testosteroni CNB-2]
 gi|262207632|gb|ACY31730.1| Pyridoxal phosphate biosynthetic protein PdxJ [Comamonas
           testosteroni CNB-2]
          Length = 516

 Score =  193 bits (490), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 149/244 (61%), Gaps = 5/244 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA+LRN R+L  P+++   +I L++GA G+T+HPRPD+RHIR  D+ E+  
Sbjct: 268 TALSVNVNKVALLRNTRHLGIPSVMRAAQICLEAGAQGITIHPRPDERHIRAQDVFELHE 327

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ + +P AE NIEG P +  ++   + +P Q T VPD   Q TSDHGW F Q+   L  
Sbjct: 328 LL-KNWPGAEFNIEGNPTQNLMDFIRQTRPHQATFVPDSEDQFTSDHGWSFPQDAERLKP 386

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A    LG R+SLF D    +  + AAK  GAD +ELYT P+ A +   +QE+  L   
Sbjct: 387 LIAECKALGVRVSLFMDPIPEQ--MAAAKAVGADRVELYTEPFAANWGKAEQEQQ-LQTY 443

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  AQ A    L INAGHDL   N+   +  +P ++E+S+GHA  A ALE G  E V  +
Sbjct: 444 ARAAQAALDAGLGINAGHDLNRDNLAAFVARVPGLAEVSIGHALIADALELGYAETVKAY 503

Query: 243 RRAC 246
            +AC
Sbjct: 504 -QAC 506


>gi|299530662|ref|ZP_07044077.1| pyridoxine 5'-phosphate synthase [Comamonas testosteroni S44]
 gi|298721178|gb|EFI62120.1| pyridoxine 5'-phosphate synthase [Comamonas testosteroni S44]
          Length = 257

 Score =  192 bits (488), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 106/244 (43%), Positives = 148/244 (60%), Gaps = 5/244 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA+LRN R+L  P++    +I L++GA G+T+HPRPD+RHIR  D+ E+  
Sbjct: 9   TALSVNVNKVALLRNTRHLGIPSVTRAAQICLEAGAQGITIHPRPDERHIRAQDVFELHE 68

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ + +P AE NIEG P +  ++   + +P Q T VPD   Q TSDHGW F Q+   L  
Sbjct: 69  LL-KNWPGAEFNIEGNPTQNLMDFIRQTRPHQATFVPDSEDQFTSDHGWSFPQDAERLKP 127

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A    LG R+SLF D    +  + AAK  GAD +ELYT P+ A +   +QE+  L   
Sbjct: 128 LIAECKALGVRVSLFMDPIPEQ--MAAAKAVGADRVELYTEPFAANWGKAEQEQQ-LQTY 184

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  AQ A    L INAGHDL   N+   +  +P ++E+S+GHA  A ALE G  E V  +
Sbjct: 185 ARAAQAALDAGLGINAGHDLNRDNLAAFVARVPGLAEVSIGHALIADALELGYAETVKAY 244

Query: 243 RRAC 246
            +AC
Sbjct: 245 -QAC 247


>gi|313675884|ref|YP_004053880.1| pyridoxine 5'-phosphate synthase [Marivirga tractuosa DSM 4126]
 gi|312942582|gb|ADR21772.1| pyridoxine 5'-phosphate synthase [Marivirga tractuosa DSM 4126]
          Length = 239

 Score =  191 bits (486), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 102/242 (42%), Positives = 150/242 (61%), Gaps = 9/242 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           TS+SVN+N +A LRN R    PN+V++ K   + GA G+T+HPRPD+RHI   D+ ++  
Sbjct: 2   TSLSVNINKIATLRNARGGENPNVVNVAKDCERFGAQGITIHPRPDERHITTKDVYDLAP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEGYP+E FL L +   P Q TLVPD P  LTS+ GWD +++Q  L  
Sbjct: 62  IVTTEF-----NIEGYPDERFLELVKNNNPAQATLVPDPPGVLTSNAGWDTVKHQDFLKD 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +++L N+G R S+F  G   +H   AAKL G D IELYT PY A Y   +++ +     
Sbjct: 117 VISQLKNMGVRTSIFT-GTDLKHIEAAAKL-GTDRIELYTEPYAANYAKDREKAV--EPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
            + A+ AQ++ L INAGHDL+++N+  L   IP++ E+S+GHA    AL  G++  +  +
Sbjct: 173 VLAAKKAQEVGLGINAGHDLSLENLKFLKEKIPFLDEVSIGHALICDALYFGLENTIQLY 232

Query: 243 RR 244
            R
Sbjct: 233 LR 234


>gi|319941431|ref|ZP_08015759.1| pyridoxal phosphate biosynthetic protein PdxJ [Sutterella
           wadsworthensis 3_1_45B]
 gi|319805051|gb|EFW01881.1| pyridoxal phosphate biosynthetic protein PdxJ [Sutterella
           wadsworthensis 3_1_45B]
          Length = 258

 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 106/241 (43%), Positives = 145/241 (60%), Gaps = 6/241 (2%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           + T +SVNLN VA++RN R   WP+ V  G+IAL++GA+GLTVHPRPD+RHIR TDL  +
Sbjct: 2   IRTQLSVNLNKVALVRNSREGNWPDPVFFGRIALEAGAAGLTVHPRPDERHIRRTDLAPL 61

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDF--LQNQA 118
           + L+ E +P  E NIEG P E  + + +  +P Q T VPD   Q TSDHG++F   + + 
Sbjct: 62  KALV-EAYPGREFNIEGNPFENLMPILKEIRPHQATFVPDAADQKTSDHGFEFNNPEVRE 120

Query: 119 LLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF 178
            L   VA   + G R+SLF D        + AK TGAD IELYT  Y A Y    ++ I 
Sbjct: 121 KLAAVVAEAQSYGCRVSLFMD--PEPEFTRWAKETGADRIELYTEGYAAAYGTALEDDI- 177

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           L     +A L  ++ L +NAGHDL++ N+  L+ A   I E+S+GHA    AL+ G  E 
Sbjct: 178 LQPYVDSALLCDELALGVNAGHDLSLDNLEKLLTACGNIKEVSIGHALTVEALQFGFAET 237

Query: 239 V 239
           +
Sbjct: 238 I 238


>gi|120609887|ref|YP_969565.1| pyridoxine 5'-phosphate synthase [Acidovorax citrulli AAC00-1]
 gi|120588351|gb|ABM31791.1| pyridoxine 5'-phosphate synthase [Acidovorax citrulli AAC00-1]
          Length = 258

 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 104/244 (42%), Positives = 144/244 (59%), Gaps = 4/244 (1%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           + T++SVN+N VA++RN R+L  P++       L++GA G+T+HPRPD RHIR  D+P +
Sbjct: 6   VRTALSVNVNKVALVRNTRHLGIPSVERAALRCLEAGAQGITIHPRPDGRHIRADDVPVL 65

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
             L+  Q+P  E NIEG P++  +      +P Q T VPD   Q TSDHGW F Q+   L
Sbjct: 66  AALL-RQWPDREFNIEGNPSQNLMEFICAVRPHQATFVPDGEDQFTSDHGWSFPQDAERL 124

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              VA    LG R+SLF D    +  + AA+  GAD +ELYT PY A +  P QE   L 
Sbjct: 125 APLVAECRGLGVRVSLFMDAEPAQ--MAAARAVGADRVELYTEPYAAAWGTPAQE-AQLV 181

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           + A  A+ A +  L +NAGHDL   N+   +  +P + E+S+GHAF A ALE G   AV 
Sbjct: 182 RYADAARAALEAGLGVNAGHDLNRDNLAAFVARVPGLMEVSIGHAFVADALELGYAAAVQ 241

Query: 241 CFRR 244
            ++R
Sbjct: 242 AYQR 245


>gi|152996842|ref|YP_001341677.1| pyridoxine 5'-phosphate synthase [Marinomonas sp. MWYL1]
 gi|150837766|gb|ABR71742.1| Pyridoxal phosphate biosynthetic protein PdxJ [Marinomonas sp.
           MWYL1]
          Length = 241

 Score =  191 bits (486), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 103/240 (42%), Positives = 145/240 (60%), Gaps = 5/240 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVNLN + +LRN R   +PNL+ + +  L+ GA G+T+HPRPDQRH  Y D  +++ 
Sbjct: 2   THLSVNLNKIGLLRNSRGRDYPNLIDMAERTLELGAFGITIHPRPDQRHATYQDAYDLKE 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ ++FPKAELNIEG+P+  FL++    +P+Q TLVPDDP+QLTSDHGW+  ++Q  L  
Sbjct: 62  LL-KRFPKAELNIEGFPDAQFLDVVLEVEPDQCTLVPDDPNQLTSDHGWNIARDQDALRP 120

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A+L   G R+ LF D +     L  AK  GAD +ELYT  Y   +     E + L+  
Sbjct: 121 VIAKLKAKGIRVVLFMDPDPENMVL--AKEVGADRVELYTEAYANGFGKEGFEDV-LDTY 177

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQ A    L++NAGHDL + N+  L      I E+S+GHA    AL+ G    V  +
Sbjct: 178 QHAAQAALDAGLEVNAGHDLDLNNVQALCEQ-GRIMEVSIGHALTVEALDLGWNNVVKAY 236


>gi|332828774|gb|EGK01466.1| pyridoxine 5'-phosphate synthase [Dysgonomonas gadei ATCC BAA-286]
          Length = 250

 Score =  191 bits (485), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 96/241 (39%), Positives = 149/241 (61%), Gaps = 9/241 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P++V +     + GA G+TVHPRPD+RHIR+ D+ +++ 
Sbjct: 8   TKLSVNINKIATLRNARGGNIPDVVKVALDCEKFGAQGITVHPRPDERHIRFKDVYDLKA 67

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            I     K ELNIEGYP++ F++L    +P Q+TLVPD P  +TS+ GWD ++NQ LL+ 
Sbjct: 68  KI-----KTELNIEGYPSQKFVDLITTIRPTQVTLVPDKPDAITSNAGWDTIENQQLLSD 122

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V     +G R S+F     +   ++ A  TG D IELYT PY + Y+  ++  I     
Sbjct: 123 LVDEFKAVGVRTSIFT--GTDLKIIEFAAKTGTDRIELYTEPYASDYSKDKEAAI--ASF 178

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+ A+K+ L +NAGHDL+++N+  L   IP++ E+S+GHA  + AL  G+++ +  +
Sbjct: 179 IEAAKYAKKLGLGVNAGHDLSLENLHFLYKNIPWLDEVSIGHALISDALYLGLEKTIKAY 238

Query: 243 R 243
           +
Sbjct: 239 K 239


>gi|221068685|ref|ZP_03544790.1| Pyridoxal phosphate biosynthetic protein PdxJ [Comamonas
           testosteroni KF-1]
 gi|220713708|gb|EED69076.1| Pyridoxal phosphate biosynthetic protein PdxJ [Comamonas
           testosteroni KF-1]
          Length = 257

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 105/244 (43%), Positives = 149/244 (61%), Gaps = 5/244 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA+LRN R+L  P++    +I L++GA G+T+HPRPD+RHIR  D+ E+  
Sbjct: 9   TALSVNVNKVALLRNTRHLGIPSVTRAAQICLEAGAQGITIHPRPDERHIRAQDVFELHD 68

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+   +P+AE NIEG P +  ++   + +P Q T VPD   Q TSDHGW F Q+   L  
Sbjct: 69  LL-RNWPEAEFNIEGNPTQNLMDFIRQTRPHQATFVPDSEDQFTSDHGWSFPQDAERLQP 127

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A    LG R+SLF D    +  + AA+  GAD +ELYT P+ A +   +QE+  L   
Sbjct: 128 LIAECKALGVRVSLFMDPIPEQ--MAAARAVGADRVELYTEPFAANWGKAEQEQQ-LQTY 184

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  AQ A +  L INAGHDL   N+   +  +P ++E+S+GHA  A ALE G  E V  +
Sbjct: 185 ARAAQAALEAGLGINAGHDLNRDNLAAFVARVPGLAEVSIGHALIADALELGYAETVKAY 244

Query: 243 RRAC 246
            +AC
Sbjct: 245 -QAC 247


>gi|90021358|ref|YP_527185.1| pyridoxine 5'-phosphate synthase [Saccharophagus degradans 2-40]
 gi|89950958|gb|ABD80973.1| Pyridoxal phosphate biosynthetic protein PdxJ [Saccharophagus
           degradans 2-40]
          Length = 251

 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 110/256 (42%), Positives = 153/256 (59%), Gaps = 16/256 (6%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVNLN +A++RN R   +P++   G+++L +GA+GLTVHPRPDQRHI   D+  +
Sbjct: 1   MAIDLSVNLNKIALIRNSREGNYPDVTAFGRLSLDAGAAGLTVHPRPDQRHITPDDVRNL 60

Query: 61  RRLIDEQFPKAELNIEGYP-------NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDF 113
             L  E +P+ E NIEG P           + L     PEQ TLVPD+  Q TSDHG+D 
Sbjct: 61  AALRTE-YPRTEFNIEGNPFAPARGTYPGLIELVAETNPEQCTLVPDNDAQKTSDHGFDL 119

Query: 114 LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ 173
             +   L   + +LH+LG+R+SLF D +  + +L  AK  GAD IELYTGPY   +   +
Sbjct: 120 KTDGERLIPLIEKLHSLGARVSLFMDPDPEQIAL--AKQIGADRIELYTGPYAWAFGRNK 177

Query: 174 QE---RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATA 230
           +E   +  L+K A  A+ A    L INAGHDL +QN+P L + +P + E+S+GHA    A
Sbjct: 178 EEGEQQFLLHKAA--AEAALLCGLGINAGHDLNLQNLP-LYSQLPGLQEVSIGHALTVDA 234

Query: 231 LECGVKEAVFCFRRAC 246
           L  G  EAV  +R  C
Sbjct: 235 LLMGYSEAVAAYRAIC 250


>gi|313205321|ref|YP_004043978.1| pyridoxine 5'-phosphate synthase [Paludibacter propionicigenes WB4]
 gi|312444637|gb|ADQ80993.1| pyridoxine 5'-phosphate synthase [Paludibacter propionicigenes WB4]
          Length = 237

 Score =  190 bits (483), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 147/242 (60%), Gaps = 9/242 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA +RN R    PN+  +     + GA G+TVHPRPD+RHIRY D+ +++ 
Sbjct: 2   TKLSVNINKVATIRNARGGNVPNVCQVALDCEKFGAEGITVHPRPDERHIRYADVWDLKP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     K E NIEGYP+  F+ L +  KP Q+TLVPD P  +TS  GWD + +   L +
Sbjct: 62  LL-----KTEFNIEGYPSPDFIKLVKSVKPHQVTLVPDPPEAITSSAGWDTITHLEFLKE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VA   ++G R+S+F D +    +++ A  TG D +ELYT PY   Y  P+     +   
Sbjct: 117 VVADFQSVGIRVSIFIDTDLK--NIEFAAKTGTDRVELYTEPYATDY--PKDREKAIAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+LA+ + L +NAGHDL+++N+  +   IP+I E+S+GHA  A AL  G+++ +  +
Sbjct: 173 VAAAKLAKGLGLGLNAGHDLSLENLAYMHKFIPWIDEVSIGHALIADALYFGLEDTIKRY 232

Query: 243 RR 244
           ++
Sbjct: 233 KK 234


>gi|256421081|ref|YP_003121734.1| pyridoxine 5'-phosphate synthase [Chitinophaga pinensis DSM 2588]
 gi|256035989|gb|ACU59533.1| pyridoxal phosphate biosynthetic protein PdxJ [Chitinophaga
           pinensis DSM 2588]
          Length = 245

 Score =  190 bits (482), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 100/246 (40%), Positives = 147/246 (59%), Gaps = 12/246 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N  A LRN R    P+++ + +   + GA G+TVHPRPD+RHIRY D+ +++ 
Sbjct: 2   TKLSVNINKFATLRNARGGNMPDILKVAQDCERFGADGITVHPRPDERHIRYQDVIDLKP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+  +F     NIEGYP++ F++L    KP Q TLVPD P  +TS+ GWD +Q+Q+ L +
Sbjct: 62  LVTTEF-----NIEGYPSKEFMDLVLSVKPHQATLVPDPPDAITSNTGWDTIQHQSFLRE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY----NNPQQERIF 178
            +  L   G R+S+F   N     ++AAK  GAD IELYTGPY   +      PQ  ++F
Sbjct: 117 VIGTLKAAGIRVSIFL--NAETDKVEAAKTAGADRIELYTGPYAEEFERARTQPQNLQLF 174

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
            N    TA+ A    L++NAGHDL + N+      IP + E+S+GHA    AL  G++  
Sbjct: 175 -NAYKDTARAATATGLELNAGHDLNLDNLRFFKLHIPQLKEVSIGHALVCDALYYGLENT 233

Query: 239 VFCFRR 244
           +  ++R
Sbjct: 234 IQLYKR 239


>gi|90416531|ref|ZP_01224462.1| pyridoxal phosphate biosynthetic protein [marine gamma
           proteobacterium HTCC2207]
 gi|90331730|gb|EAS46958.1| pyridoxal phosphate biosynthetic protein [marine gamma
           proteobacterium HTCC2207]
          Length = 248

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 102/252 (40%), Positives = 150/252 (59%), Gaps = 12/252 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +S+NLN +A++RN R   +P++V   K+ +  GA+G+TVHPRPDQRHIR  D+  +  
Sbjct: 2   TDLSINLNKIALIRNSREGNYPDVVEFAKVCIDQGANGITVHPRPDQRHIRPDDVRRLAA 61

Query: 63  LIDEQFPKAELNIEGYP-------NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQ 115
           L+ +     E N+EG P          F+ L     P+Q TLVPD   QLTSDHG+D   
Sbjct: 62  LV-KPLTNVEFNVEGNPFAPAIGDYPGFIELVAETMPDQCTLVPDGDDQLTSDHGFDLTS 120

Query: 116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE 175
           +   L   + RLH+LG R+SLF D +  +  ++ AK  GAD IELYTGPY A + + Q E
Sbjct: 121 SGEQLQPIIERLHSLGMRVSLFMDPDLAQ--IELAKEIGADRIELYTGPYAAAWGSDQLE 178

Query: 176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
            +F   LA  A+L+ ++ + +NAGHDL + N+     +IP + E+S+GHAF   +L  G+
Sbjct: 179 PLFQQHLA-AAELSTRLGMGVNAGHDLNLHNLAKFA-SIPNLLEVSIGHAFTVDSLSLGM 236

Query: 236 KEAVFCFRRACG 247
            + V  ++   G
Sbjct: 237 AQTVQRYKALLG 248


>gi|241763853|ref|ZP_04761898.1| Pyridoxal phosphate biosynthetic protein PdxJ [Acidovorax
           delafieldii 2AN]
 gi|241366897|gb|EER61311.1| Pyridoxal phosphate biosynthetic protein PdxJ [Acidovorax
           delafieldii 2AN]
          Length = 260

 Score =  189 bits (479), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 143/240 (59%), Gaps = 4/240 (1%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA++RN R+L  P++    ++ LQ+GA G+TVHPRPD+RHIR  D+ E+  
Sbjct: 11  TALSVNVNKVALVRNTRHLGIPSVTRAAELCLQAGAQGITVHPRPDERHIRSQDVFELAA 70

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ + +P  E N+EG P++  +    + +P Q T VPD   Q TSDHGW F Q+   L  
Sbjct: 71  LM-KAWPDREYNVEGNPSQNLMEFIRQVRPHQATFVPDSEDQFTSDHGWSFPQDAERLAP 129

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VA   +LG R+SLF D    +  + AA+  GAD +ELYT P+ A +  PQQ    L + 
Sbjct: 130 LVAECRSLGVRVSLFMDPVPGQ--MAAARAVGADRVELYTEPFAAAWGTPQQA-AELRRY 186

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  AQ A    L +NAGHDL   N+   +  +P + E+S+GHA  A ALE G    V  +
Sbjct: 187 ADAAQAALDAGLGVNAGHDLNRDNLAAFVREVPGVLEVSIGHALIADALELGYAATVRAY 246


>gi|228469868|ref|ZP_04054807.1| pyridoxine 5'-phosphate synthase [Porphyromonas uenonis 60-3]
 gi|228308503|gb|EEK17291.1| pyridoxine 5'-phosphate synthase [Porphyromonas uenonis 60-3]
          Length = 242

 Score =  188 bits (478), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 98/237 (41%), Positives = 142/237 (59%), Gaps = 7/237 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PN+V   +   + GA G+TVHPRPD+RHI Y D+ ++R 
Sbjct: 2   TRLSVNINKIATLRNARGGDTPNVVLAARRCQEFGAEGITVHPRPDERHITYQDVRDLRE 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEGYP+++FL+L    +PEQ+TLVPD P  LTSD GW     + LL  
Sbjct: 62  VVTTEF-----NIEGYPSDSFLDLVCSVRPEQVTLVPDKPDALTSDSGWAVADCRDLLKP 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL   G R+SLF  G    H ++AA   GAD +ELYT PY +        ++ +   
Sbjct: 117 IVERLKQAGIRVSLFV-GTDPRH-IEAAAEIGADRVELYTEPYASQMAQSGDPKVIVAPF 174

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           A  A++AQ++ L +NAGHDL   N+   +  +  + E+S+GHA  + AL  G++E +
Sbjct: 175 AEAARVAQRVGLGVNAGHDLNRDNLAYFVQHVTPLDEVSIGHALISDALYLGLEETI 231


>gi|124006235|ref|ZP_01691070.1| pyridoxal phosphate biosynthetic protein PdxJ [Microscilla marina
           ATCC 23134]
 gi|123988159|gb|EAY27817.1| pyridoxal phosphate biosynthetic protein PdxJ [Microscilla marina
           ATCC 23134]
          Length = 237

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 100/242 (41%), Positives = 145/242 (59%), Gaps = 9/242 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    P+++ + +   + GA G+TVHPRPD+RHIRY D+ ++++
Sbjct: 2   TKLSVNINKVATLRNARGGNNPDVIKVAQDCERFGAQGITVHPRPDERHIRYQDVMDLQK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEG PN  FL L ++ KP Q+TLVPD    LTSD GWD ++ +  LT+
Sbjct: 62  VVTTEF-----NIEGNPNGRFLELVKKIKPTQVTLVPDAEDVLTSDTGWDTIKYEVFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
           T+A L + G R S+F   N  +  +  A   GAD IE YTGPY   Y+   ++ I     
Sbjct: 117 TIAELKSYGMRTSIFI--NPAKDLITGAAKVGADRIEFYTGPYAEQYSKDCEQAI--EAY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+LA  + L INAGHDL + N+  L + IP + E+S+GHA    AL  G++  +  +
Sbjct: 173 VECAKLANSLGLGINAGHDLDLTNLQYLKHQIPALKEVSIGHALICDALYYGLENTIQMY 232

Query: 243 RR 244
            R
Sbjct: 233 LR 234


>gi|58579635|ref|YP_198651.1| pyridoxine 5'-phosphate synthase [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|188574282|ref|YP_001911211.1| pyridoxine 5'-phosphate synthase [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|75437374|sp|Q5H704|PDXJ_XANOR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|238689465|sp|B2SUX4|PDXJ_XANOP RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|58424229|gb|AAW73266.1| pyridoxal phosphate biosynthetic protein [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|188518734|gb|ACD56679.1| pyridoxal phosphate biosynthesis protein PdxJ [Xanthomonas oryzae
           pv. oryzae PXO99A]
          Length = 255

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 107/249 (42%), Positives = 143/249 (57%), Gaps = 12/249 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+T +SVN+N +AVLRN R    P+++   +  + +GA G+TVHPRPDQRHIR  D+  +
Sbjct: 1   MTTQLSVNVNKIAVLRNSRGGTDPDVLQAARTCIAAGAHGITVHPRPDQRHIRAGDVLAL 60

Query: 61  RRLIDEQFPKAELNIEGYPNE-------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDF 113
             L  E     E NIEG P           L LC   +PEQITLVPD   QLTSDHG+DF
Sbjct: 61  SALTREH--AVEFNIEGNPFAPPRAGYPGLLELCRATRPEQITLVPDGDGQLTSDHGFDF 118

Query: 114 LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ 173
            Q+   L + +A    +GSR+SLF D  GN     AA L GAD +ELYTGPY   + + Q
Sbjct: 119 AQDTTQLAELIAAFKAVGSRVSLFVDA-GNPDIAGAAAL-GADRVELYTGPYAHAHASGQ 176

Query: 174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALEC 233
            +   L   A   + A    L INAGHDL+  N+ + + A+P + E+S+GHA    AL  
Sbjct: 177 TDTA-LALFADAGRRASAAGLGINAGHDLSQANLGDFLAAVPGVLEVSIGHALIGEALYQ 235

Query: 234 GVKEAVFCF 242
           G++  V  +
Sbjct: 236 GLEATVRAY 244


>gi|332884758|gb|EGK05014.1| pyridoxine 5'-phosphate synthase [Dysgonomonas mossii DSM 22836]
          Length = 243

 Score =  187 bits (475), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 149/242 (61%), Gaps = 11/242 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P++V +     + GA G+TVHPRPD+RHIR+ D+ +++ 
Sbjct: 2   TKLSVNINKIATLRNARGGNVPDVVQVALDCEKFGAEGITVHPRPDERHIRFKDVYDLKA 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            I     + E NIEGYP++ F++L    +P Q+TLVPD P  +TS+ GW+ +++Q LL+ 
Sbjct: 62  KI-----RTEFNIEGYPSQKFIDLVTTIRPTQVTLVPDKPDAITSNAGWNTVEHQQLLSD 116

Query: 123 TVARLHNLGSRISLFADGNGNE-HSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
            V     +G R S+F    G E   ++AA  TG D IELYT PY + +   ++  I    
Sbjct: 117 LVDTFRAVGVRTSIFV---GTELEIIEAAAKTGTDRIELYTEPYASNFLKDKEAAI--EP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
             + A+LA+K+ L +NAGHDL+++N+  L   IP I E+S+GHA  + AL  G++  +  
Sbjct: 172 FIVAAKLAKKLGLGLNAGHDLSLENLNYLYENIPTIDEVSIGHALISDALYLGLENTIKA 231

Query: 242 FR 243
           ++
Sbjct: 232 YK 233


>gi|171057286|ref|YP_001789635.1| pyridoxine 5'-phosphate synthase [Leptothrix cholodnii SP-6]
 gi|170774731|gb|ACB32870.1| Pyridoxal phosphate biosynthetic protein PdxJ [Leptothrix cholodnii
           SP-6]
          Length = 268

 Score =  187 bits (474), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 98/247 (39%), Positives = 148/247 (59%), Gaps = 8/247 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVNLN VA+LRN R+L  P++       L++GA G+TVHPRPD+RHIR  D+ ++  
Sbjct: 16  TALSVNLNKVALLRNSRHLGIPSVTRAATCVLEAGAQGITVHPRPDERHIRAHDVTDLAE 75

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQ----A 118
           L+ + +P+ E NIEG P    +++    +P Q T VPD   Q TSDHGW    N      
Sbjct: 76  LL-KAWPQVEYNIEGNPFHNLMDVIRAVRPHQATFVPDSTDQFTSDHGWQLGGNSPDDAE 134

Query: 119 LLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF 178
            L   +   H LG R+SLF D + +  +++AA+  GAD +ELYT  Y + +   +Q  + 
Sbjct: 135 RLRPLIDECHALGVRVSLFMDPDPS--AMRAAREVGADRVELYTETYASAWGTVRQAEV- 191

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           L+    +A+ A  + L+INAGHDL   N+ + + A+P + E+S+GHA  A ALE G  E 
Sbjct: 192 LDGFVRSAEAALAVGLEINAGHDLNRDNLSDFLRAVPGVLEVSIGHALIADALELGYAET 251

Query: 239 VFCFRRA 245
           +  ++R+
Sbjct: 252 IRAYQRS 258


>gi|298372203|ref|ZP_06982193.1| pyridoxine 5'-phosphate synthase [Bacteroidetes oral taxon 274 str.
           F0058]
 gi|298275107|gb|EFI16658.1| pyridoxine 5'-phosphate synthase [Bacteroidetes oral taxon 274 str.
           F0058]
          Length = 238

 Score =  187 bits (474), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 96/241 (39%), Positives = 148/241 (61%), Gaps = 11/241 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +SVN+N +A LRN R    PN++ +     + GA G+TVHPRPD+RHIRY+D+  ++  I
Sbjct: 4   LSVNVNKIATLRNSRGGDVPNVLKVALDCEKFGADGITVHPRPDERHIRYSDVYVLKSNI 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +F     NIEG P   F++L ER KP Q+TLVPD P  LTS+ GWD +++ + L+  V
Sbjct: 64  TTEF-----NIEGNPVNKFIDLIERIKPTQVTLVPDAPDALTSNAGWDCIEHFSYLSDLV 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY-NNPQQERIFLNKLA 183
                LG R+S+F     +  +++AA  T  D IELYT PY + Y +NP+     +    
Sbjct: 119 THFKELGVRVSIFV--GTDIKNIEAAAKTDTDRIELYTEPYASLYRSNPEAA---IKDFV 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
           +  ++A+K  L++NAGHDL+++N+      IP +SE+S+GHA  A AL  G+ + +  ++
Sbjct: 174 LATEVARKCGLKVNAGHDLSLENLKYFAGNIPMLSEVSIGHALIADALYLGLAKTIAEYK 233

Query: 244 R 244
           +
Sbjct: 234 K 234


>gi|88800660|ref|ZP_01116220.1| Pyridoxal phosphate biosynthesis protein [Reinekea sp. MED297]
 gi|88776621|gb|EAR07836.1| Pyridoxal phosphate biosynthesis protein [Reinekea sp. MED297]
          Length = 250

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 105/242 (43%), Positives = 143/242 (59%), Gaps = 8/242 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A+LRN R    PN+V   +  ++ G +G+T+HPR D+RHI   D  ++  
Sbjct: 2   TKLSVNVNKIALLRNSRGHDAPNVVEFARRFIELGVTGITIHPRQDERHITRQDARDLGD 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           LI       ELNIEGYP+ETFL L E  +P+Q TLVPD P QLTSDHG+DF      L  
Sbjct: 62  LI-RPLNDIELNIEGYPSETFLQLIEEVRPDQTTLVPDAPDQLTSDHGFDFHTQAEFLDP 120

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            + RL   G+R+S+F D +  +  L A   T  D IELYT  Y + ++ PQ   +   + 
Sbjct: 121 ILTRLKATGTRVSVFLDPDVEQVKLAAQSKT--DRIELYTEEYASQFHRPQHTEVH-QRF 177

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A  AQK+ L +NAGHDL ++N+P  +N IP I E+S+GHA     LE G+    F  
Sbjct: 178 HDAAVEAQKLGLGVNAGHDLNLENLPAFLN-IPGILEVSIGHALIVECLEYGMP---FVA 233

Query: 243 RR 244
           RR
Sbjct: 234 RR 235


>gi|149198630|ref|ZP_01875674.1| pyridoxal phosphate biosynthetic protein [Lentisphaera araneosa
           HTCC2155]
 gi|149138345|gb|EDM26754.1| pyridoxal phosphate biosynthetic protein [Lentisphaera araneosa
           HTCC2155]
          Length = 238

 Score =  186 bits (473), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 100/237 (42%), Positives = 143/237 (60%), Gaps = 8/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA+LRN R    PN++   +  ++ GA G+T+HPRPD RH  Y+D+ E+++
Sbjct: 2   TALSVNINKVALLRNSRGCDEPNVLQFSQDLIKLGAEGITLHPRPDGRHALYSDVYELKK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            ID      ELN+EGYP+E FL +    KP+Q TLVPD P  LTSD GWD  +N   L K
Sbjct: 62  NID-----VELNVEGYPSEDFLEMVCEVKPDQCTLVPDPPGALTSDSGWDCEKNMDFLQK 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VARL   G R+S+F D +  +  +  A  TG D IELYT  Y   Y     E++F    
Sbjct: 117 VVARLQAEGVRVSIFLDPDPVQ--VNFAMKTGTDRIELYTQSYAESYGTDSFEKVFAGYF 174

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           A TA  A ++ + +NAGHDL  +N+  L   +P ++E+S+GHA  +  L  G++  +
Sbjct: 175 A-TAARAVELGVGVNAGHDLNQENLTYLKQNLPGLAEVSIGHALISEMLYQGMETTI 230


>gi|224535817|ref|ZP_03676356.1| hypothetical protein BACCELL_00681 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224522540|gb|EEF91645.1| hypothetical protein BACCELL_00681 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 262

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 142/239 (59%), Gaps = 9/239 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           + T +SVN+N +A LRN R    PN+V +       GA G+TVHPRPD+RHIR  D+ ++
Sbjct: 25  IMTRLSVNINKIATLRNARGGDVPNVVKVALDCESFGAEGITVHPRPDERHIRQRDVYDL 84

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD  QN   L
Sbjct: 85  RPLL-----RTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDSPTQLTSNAGWDTKQNLEFL 139

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T+ +   ++ G R S+F   +     ++ A   GAD +ELYT PY   Y  PQ +   + 
Sbjct: 140 TEVLETFNDAGIRTSVFVSADA--EMIEYAAKAGADRVELYTEPYATAY--PQNKEAAVA 195

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                A++A+ + L +NAGHDL++ N+  L   IP++ E+S+GH+  + AL  G++  +
Sbjct: 196 PFVEAAKVARSLGLGLNAGHDLSLVNLNYLYQNIPWMDEVSIGHSLISDALYLGLERTI 254


>gi|166709907|ref|ZP_02241114.1| pyridoxal phosphate biosynthetic protein PdxJ [Xanthomonas oryzae
           pv. oryzicola BLS256]
          Length = 255

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 107/251 (42%), Positives = 146/251 (58%), Gaps = 16/251 (6%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+T +SVN+N +AVLRN R    P+++   +  + +GA G+TVHPRPDQRHIR  D+  +
Sbjct: 1   MTTQLSVNVNKIAVLRNSRGGTDPDVLQAARTCIAAGAHGITVHPRPDQRHIRAGDVLAL 60

Query: 61  RRLIDEQFPKAELNIEG---------YPNETFLNLCERYKPEQITLVPDDPHQLTSDHGW 111
             L  E     E NIEG         YP    L LC   +PEQITLVPD   QLTSDHG+
Sbjct: 61  SALTREH--AVEFNIEGNPFAPPRAGYPG--LLELCRATRPEQITLVPDGDGQLTSDHGF 116

Query: 112 DFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN 171
           DF Q+   L + +A    +GSR+SLF D  G+    +AA L GAD +ELYTGPY   + +
Sbjct: 117 DFAQDTTQLAELIAAFKAVGSRVSLFLDA-GSPDIARAAAL-GADRVELYTGPYAHAHAS 174

Query: 172 PQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATAL 231
            Q +   L   A   + A    L INAGHDL+  N+ + + A+P + E+S+GHA  + AL
Sbjct: 175 GQTDTA-LALFADAGRRASAAGLGINAGHDLSQANLGDFLAAVPGVLEVSIGHALISEAL 233

Query: 232 ECGVKEAVFCF 242
             G++  V  +
Sbjct: 234 YQGLEATVRAY 244


>gi|189463783|ref|ZP_03012568.1| hypothetical protein BACINT_00116 [Bacteroides intestinalis DSM
           17393]
 gi|189438733|gb|EDV07718.1| hypothetical protein BACINT_00116 [Bacteroides intestinalis DSM
           17393]
          Length = 262

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 142/239 (59%), Gaps = 9/239 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           + T +SVN+N +A LRN R    PN+V +       GA G+TVHPRPD+RHIR  D+ ++
Sbjct: 25  IMTRLSVNINKIATLRNARGGDVPNVVKVALDCESFGAEGITVHPRPDERHIRQRDVYDL 84

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD  QN   L
Sbjct: 85  RPLL-----RTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDSPTQLTSNAGWDTKQNLEFL 139

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T+ +   ++ G R S+F   +     ++ A   GAD +ELYT PY   Y  PQ +   + 
Sbjct: 140 TEVLETFNDAGIRTSVFVSADA--EMIEYAAKAGADRVELYTEPYATAY--PQNKEAAVA 195

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                A++A+ + L +NAGHDL++ N+  L   IP++ E+S+GH+  + AL  G++  +
Sbjct: 196 PFVEAAKVARSLGLGLNAGHDLSLVNLNYLYQNIPWMDEVSIGHSLISDALYLGLERTI 254


>gi|331005721|ref|ZP_08329083.1| Pyridoxine 5'-phosphate synthase [gamma proteobacterium IMCC1989]
 gi|330420474|gb|EGG94778.1| Pyridoxine 5'-phosphate synthase [gamma proteobacterium IMCC1989]
          Length = 264

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 104/263 (39%), Positives = 150/263 (57%), Gaps = 22/263 (8%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MST +SVN+N +A+LRN R   +PN+V   + A+ +GA G+TVHPRPDQRHIR +D+ ++
Sbjct: 1   MSTVLSVNMNKIALLRNSREGNYPNVVSFAERAITAGAKGITVHPRPDQRHIRPSDVEQL 60

Query: 61  RRLIDEQFPKAELNIEGYPNET-----------------FLNLCERYKPEQITLVPDDPH 103
           + L D+     E N+EG P ET                 F+ + +R +P+Q TLVPD   
Sbjct: 61  KHLTDKH-DGCEFNVEGNPFETSLSNPSASNGIDKEYPGFMAIIDRIRPDQATLVPDSND 119

Query: 104 QLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTG 163
           QLTSDHG+D  ++ + L   + +L     R+SLF D +  +  L  AK  GAD IE YTG
Sbjct: 120 QLTSDHGFDLKEDTSELAIIIQQLKQWNVRVSLFMDPDIEQIDL--AKAIGADRIEFYTG 177

Query: 164 PYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVG 223
           PY A +N  ++ +  +N     AQ A  + L INAGHDL   N+   +   P I+E+S+G
Sbjct: 178 PYAANFNT-EEHQATVNTYRKAAQHAHAIGLTINAGHDLNQANLAGFLTIAP-IAEVSIG 235

Query: 224 HAFAATALECGVKEAVFCFRRAC 246
           HA    +L  G  + V  + + C
Sbjct: 236 HALTVESLLMGYTKTVEAYSKIC 258


>gi|325922769|ref|ZP_08184503.1| pyridoxine 5'-phosphate synthase [Xanthomonas gardneri ATCC 19865]
 gi|325922952|ref|ZP_08184664.1| pyridoxine 5'-phosphate synthase [Xanthomonas gardneri ATCC 19865]
 gi|325923264|ref|ZP_08184939.1| pyridoxine 5'-phosphate synthase [Xanthomonas gardneri ATCC 19865]
 gi|325546288|gb|EGD17467.1| pyridoxine 5'-phosphate synthase [Xanthomonas gardneri ATCC 19865]
 gi|325546560|gb|EGD17702.1| pyridoxine 5'-phosphate synthase [Xanthomonas gardneri ATCC 19865]
 gi|325546765|gb|EGD17885.1| pyridoxine 5'-phosphate synthase [Xanthomonas gardneri ATCC 19865]
          Length = 265

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 111/249 (44%), Positives = 147/249 (59%), Gaps = 12/249 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           ++T +SVN+N +AVLRN R    P++V   +  + +GA G+TVHPRPDQRHIR  D+  +
Sbjct: 11  VTTQLSVNVNKIAVLRNSRGGHDPDVVQAARTCIAAGAHGITVHPRPDQRHIRADDVLAL 70

Query: 61  RRLIDEQFPKAELNIEGYP-------NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDF 113
             L  EQ  + E NIEG P           L LC   +PEQ+TLVPD   QLTSDHG+DF
Sbjct: 71  SALTREQ--RVEFNIEGNPFAPPRDGYPGLLELCRLTRPEQVTLVPDGDGQLTSDHGFDF 128

Query: 114 LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ 173
            Q+ A L   +A    +G+R+SLF D  GN    QAA L GAD IELYTGPY   + + Q
Sbjct: 129 AQDPAQLAALIASFKAIGARVSLFVDA-GNAEIAQAAVL-GADRIELYTGPYAQAHLSGQ 186

Query: 174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALEC 233
            +       A  AQ A    L INAGHDL+  N+ + +NA+P + E+S+GHA  + AL  
Sbjct: 187 PDAA-FALFAGAAQRASAAGLGINAGHDLSQDNLGDFLNAVPGVLEVSIGHALISEALYR 245

Query: 234 GVKEAVFCF 242
           G+   V  +
Sbjct: 246 GLDATVRAY 254


>gi|121609302|ref|YP_997109.1| pyridoxine 5'-phosphate synthase [Verminephrobacter eiseniae
           EF01-2]
 gi|121553942|gb|ABM58091.1| Pyridoxal phosphate biosynthetic protein PdxJ [Verminephrobacter
           eiseniae EF01-2]
          Length = 262

 Score =  186 bits (472), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 101/241 (41%), Positives = 140/241 (58%), Gaps = 4/241 (1%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +T++SVN+N VA+LRN R+L  P +    ++ LQ+GA G+TVHPRPD+RHIR  D+ E+ 
Sbjct: 14  ATALSVNVNKVALLRNTRHLAIPCVTKAARLCLQAGAQGITVHPRPDERHIRRQDVFELA 73

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+ + +P  E NIEG P +  ++     +P Q T VPD   Q TSDHGW   Q+   L 
Sbjct: 74  DLM-QAWPDREYNIEGNPAQNLMDFIRTLRPRQATFVPDGADQFTSDHGWSLPQDAERLA 132

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             +A    L  R+SLF D +  +  + AAK  GAD +ELYT PY A +  PQQ  + L +
Sbjct: 133 PWIAECKALAVRVSLFMDPDPAQ--MAAAKALGADRVELYTEPYAAAWGQPQQAAV-LAR 189

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               AQ A    L +NAGHDL   N+   +  +P + E+S+GHA  A ALE G    V  
Sbjct: 190 YRAAAQAALDAGLGVNAGHDLNRDNLATFVREVPGLLEVSIGHALIADALELGYGATVRA 249

Query: 242 F 242
           +
Sbjct: 250 Y 250


>gi|84621669|ref|YP_449041.1| pyridoxal phosphate biosynthetic protein PdxJ [Xanthomonas oryzae
           pv. oryzae MAFF 311018]
 gi|91207577|sp|Q2P9L0|PDXJ_XANOM RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|84365609|dbj|BAE66767.1| pyridoxal phosphate biosynthetic protein [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
          Length = 255

 Score =  185 bits (470), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 106/249 (42%), Positives = 143/249 (57%), Gaps = 12/249 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVN+N +AVLRN R    P+++   +  + +GA G+TVHPRPDQRHIR  D+  +
Sbjct: 1   MTIQLSVNVNKIAVLRNSRGGTDPDVLQAARTCIAAGAHGITVHPRPDQRHIRAGDVLAL 60

Query: 61  RRLIDEQFPKAELNIEGYPNE-------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDF 113
             L  E     E NIEG P           L LC   +PEQITLVPD   QLTSDHG+DF
Sbjct: 61  SALTREH--AVEFNIEGNPFAPPRAGYPGLLELCRATRPEQITLVPDGDGQLTSDHGFDF 118

Query: 114 LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ 173
            Q+   L + +A    +GSR+SLF D  GN     AA L GAD +ELYTGPY   + + Q
Sbjct: 119 AQDTTQLAELIAAFKAVGSRVSLFVDA-GNPDIAGAAAL-GADRVELYTGPYAHAHASGQ 176

Query: 174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALEC 233
            +   L   A   + A    L INAGHDL+  N+ + + A+P + E+S+GHA  + AL  
Sbjct: 177 TDTA-LALFADAGRRASAAGLGINAGHDLSQANLGDFLAAVPGVLEVSIGHALISEALYQ 235

Query: 234 GVKEAVFCF 242
           G++  V  +
Sbjct: 236 GLEATVRAY 244


>gi|326794777|ref|YP_004312597.1| pyridoxal phosphate biosynthetic protein PdxJ [Marinomonas
           mediterranea MMB-1]
 gi|326545541|gb|ADZ90761.1| pyridoxal phosphate biosynthetic protein PdxJ [Marinomonas
           mediterranea MMB-1]
          Length = 241

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 101/240 (42%), Positives = 146/240 (60%), Gaps = 5/240 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVNLN + +LRN R   +PN+V + K  L  GA G+T+HPRPDQRH  Y D  +++ 
Sbjct: 2   THLSVNLNKIGLLRNSRGRDYPNVVEMAKRTLDLGAFGVTIHPRPDQRHATYKDAHDLKN 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+ +++P  ELNIEG+P++ FLN+    +P+Q TLVPDDP+QLTSDHGW+  ++Q  L  
Sbjct: 62  LL-KKYPGKELNIEGFPDKEFLNVVLEAQPDQCTLVPDDPNQLTSDHGWNIARDQDALRP 120

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            + +L   G R+ LF D      +++ AK  GAD +ELYT  Y + Y+  ++  + L + 
Sbjct: 121 VIGKLKAQGIRVVLFMDPIA--ENMKLAKEVGADRVELYTEEYASQYDTEERAAV-LQRY 177

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQ A    L +NAGHDL + N+  L      I+E+S+GHA    ALE G    V  +
Sbjct: 178 QDAAQAALDAGLGVNAGHDLDLSNVEALCEN-GAITEVSIGHALTVEALEYGWDNVVKMY 236


>gi|313886188|ref|ZP_07819918.1| pyridoxine 5'-phosphate synthase [Porphyromonas asaccharolytica
           PR426713P-I]
 gi|312924367|gb|EFR35146.1| pyridoxine 5'-phosphate synthase [Porphyromonas asaccharolytica
           PR426713P-I]
          Length = 242

 Score =  185 bits (470), Expect = 5e-45,   Method: Compositional matrix adjust.
 Identities = 96/237 (40%), Positives = 140/237 (59%), Gaps = 7/237 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PN+V   +   + GA G+TVHPRPD+RHI Y D+ ++R 
Sbjct: 2   TRLSVNINKIATLRNARGGDTPNVVLAARRCQEFGAEGITVHPRPDERHITYQDVRDLRE 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEGYP+++FL+L    +PEQ+TLVPD P  LTSD GW     + LL  
Sbjct: 62  VVTTEF-----NIEGYPSDSFLDLVCSVRPEQVTLVPDKPDALTSDSGWAVADCRDLLKP 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            + RL   G R+SLF  G    H ++AA   GAD +ELYT PY +        ++ +   
Sbjct: 117 IIERLKQAGIRVSLFV-GTDPRH-IEAAAEIGADRVELYTEPYASQMAQSGDPKMIVAPF 174

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              AQ+A ++ L +NAGHDL   N+   +  +  + E+S+GHA  + AL  G++E +
Sbjct: 175 VEAAQVAHRVGLGVNAGHDLNRDNLAYFVQHVTPLDEVSIGHALISDALYLGLEETI 231


>gi|160883173|ref|ZP_02064176.1| hypothetical protein BACOVA_01142 [Bacteroides ovatus ATCC 8483]
 gi|237714381|ref|ZP_04544862.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp. D1]
 gi|260171937|ref|ZP_05758349.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. D2]
 gi|262408213|ref|ZP_06084760.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_22]
 gi|294646282|ref|ZP_06723934.1| pyridoxine 5'-phosphate synthase [Bacteroides ovatus SD CC 2a]
 gi|294806769|ref|ZP_06765596.1| pyridoxine 5'-phosphate synthase [Bacteroides xylanisolvens SD CC
           1b]
 gi|299148206|ref|ZP_07041268.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_23]
 gi|315920249|ref|ZP_07916489.1| conserved hypothetical protein [Bacteroides sp. D2]
 gi|156111398|gb|EDO13143.1| hypothetical protein BACOVA_01142 [Bacteroides ovatus ATCC 8483]
 gi|229445545|gb|EEO51336.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp. D1]
 gi|262353765|gb|EEZ02858.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_22]
 gi|292638363|gb|EFF56729.1| pyridoxine 5'-phosphate synthase [Bacteroides ovatus SD CC 2a]
 gi|294446051|gb|EFG14691.1| pyridoxine 5'-phosphate synthase [Bacteroides xylanisolvens SD CC
           1b]
 gi|298512967|gb|EFI36854.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_23]
 gi|313694124|gb|EFS30959.1| conserved hypothetical protein [Bacteroides sp. D2]
          Length = 238

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 97/239 (40%), Positives = 146/239 (61%), Gaps = 13/239 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P++V +       GA G+TVHPRPD+RHIR +D+ ++R 
Sbjct: 2   TKLSVNINKIATLRNARGGNVPDVVKVALDCESFGADGITVHPRPDERHIRRSDVYDLRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     + E NIEGYP+  F++L  + KP Q+TLVPDDP Q+TS+ GWD   NQ  LT+
Sbjct: 62  LL-----RTEFNIEGYPSPEFIDLVLKVKPHQVTLVPDDPSQITSNSGWDTKANQEFLTE 116

Query: 123 TVARLHNLGSRISLF--ADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            + + ++ G R S+F  AD    E++ +A    GAD +ELYT PY   Y  P+     + 
Sbjct: 117 VLDQFNSAGIRTSVFVAADPEMVEYAAKA----GADRVELYTEPYATDY--PKNPEAAIA 170

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                A+ A+K+ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +
Sbjct: 171 PFIEAAKTARKLGIGLNAGHDLSLVNLNYFYKNIPWVDEVSIGHALISDALYLGLERTI 229


>gi|260641976|ref|ZP_05859170.1| pyridoxine 5'-phosphate synthase [Bacteroides finegoldii DSM 17565]
 gi|260623966|gb|EEX46837.1| pyridoxine 5'-phosphate synthase [Bacteroides finegoldii DSM 17565]
          Length = 291

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 98/239 (41%), Positives = 146/239 (61%), Gaps = 13/239 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P++V +       GA G+TVHPRPD+RHIR++D+  +R 
Sbjct: 56  TKLSVNINKIATLRNARGGNVPDVVKVALDCESFGADGITVHPRPDERHIRHSDVYALRP 115

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     + E NIEGYP+  F++L  + KP Q+TLVPDDP QLTS+ GWD   N  LLT+
Sbjct: 116 LL-----RTEFNIEGYPSPEFIDLVLKVKPHQVTLVPDDPSQLTSNSGWDTKANLELLTE 170

Query: 123 TVARLHNLGSRISLF--ADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            + + ++ G R S+F  AD    E++ +A    GAD +ELYT PY   Y  P+     + 
Sbjct: 171 VLDQFNSAGIRTSVFVAADSEMVEYAAKA----GADRVELYTEPYATNY--PKNPETAIA 224

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                A+ A+K+ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +
Sbjct: 225 PFIEAAKTARKLGIGLNAGHDLSLVNLNYFYKNIPWVDEVSIGHALISDALYLGLERTI 283


>gi|218672211|ref|ZP_03521880.1| pyridoxine 5'-phosphate synthase [Rhizobium etli GR56]
          Length = 156

 Score =  185 bits (469), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 109/154 (70%)

Query: 95  ITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTG 154
           +TLVPDDP Q TSDHGWDF +++A LT  VARL  +G R+SLFADG+G+  +++ AK TG
Sbjct: 1   MTLVPDDPAQATSDHGWDFRKHEAFLTDVVARLKTMGCRVSLFADGDGDAEAVKLAKATG 60

Query: 155 ADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAI 214
           AD IELYTGPYG CY+ P++    L  L  TA  A  + L +NAGHDLT+ N+P L+  I
Sbjct: 61  ADRIELYTGPYGGCYDAPERAAPILEALGKTADAALAIGLAVNAGHDLTVANLPALVKRI 120

Query: 215 PYISEISVGHAFAATALECGVKEAVFCFRRACGQ 248
           P ++E+S+GH   A ALE G+ E V  F RACGQ
Sbjct: 121 PALAEVSIGHGLTADALEYGMAETVRRFCRACGQ 154


>gi|218128536|ref|ZP_03457340.1| hypothetical protein BACEGG_00106 [Bacteroides eggerthii DSM 20697]
 gi|317475648|ref|ZP_07934909.1| pyridoxine 5'-phosphate synthase [Bacteroides eggerthii 1_2_48FAA]
 gi|217989260|gb|EEC55574.1| hypothetical protein BACEGG_00106 [Bacteroides eggerthii DSM 20697]
 gi|316908218|gb|EFV29911.1| pyridoxine 5'-phosphate synthase [Bacteroides eggerthii 1_2_48FAA]
          Length = 237

 Score =  184 bits (468), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 141/237 (59%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR +D+ ++R 
Sbjct: 2   TKLSVNINKVATLRNARGGEVPNVVKVALDCENFGADGITVHPRPDERHIRRSDVYDLRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD   N   LT+
Sbjct: 62  LL-----RTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDSPTQLTSNSGWDTKNNLEFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +   +N G R S+F   + +   ++ A   GAD +ELYT PY   +  P+     +   
Sbjct: 117 VLDTFNNAGIRTSVFV--STDVEMIEYAAKAGADRVELYTEPYATAF--PKGREAAVAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A++A+ + L +NAGHDL+++N+      IP++ E+S+GHA  + AL  G++  +
Sbjct: 173 VEAAKMARSLGLGLNAGHDLSLENLNYFYTNIPWLDEVSIGHALISDALYLGLERTI 229


>gi|325915689|ref|ZP_08177994.1| pyridoxine 5'-phosphate synthase [Xanthomonas vesicatoria ATCC
           35937]
 gi|325538106|gb|EGD09797.1| pyridoxine 5'-phosphate synthase [Xanthomonas vesicatoria ATCC
           35937]
          Length = 255

 Score =  184 bits (468), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 108/251 (43%), Positives = 144/251 (57%), Gaps = 16/251 (6%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+T +SVN+N +AV+RN R    P+++   +  + +GA G+TVHPRPDQRHIR  D+  +
Sbjct: 1   MTTQLSVNVNKIAVIRNSRGGHDPDVLQAARTCIAAGAHGITVHPRPDQRHIRADDVLAL 60

Query: 61  RRLIDEQFPKAELNIEGYP-------NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDF 113
             L  E     E NIEG P           L LC   +PEQ+TLVPD   QLTSDHG+DF
Sbjct: 61  SALTREH--GVEFNIEGNPFAPSRDGYPGLLELCRTTRPEQVTLVPDSDGQLTSDHGFDF 118

Query: 114 LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NN 171
            Q+   L++ +     LGSR+SLF D  GN    QA  L GAD +ELYTGPY   Y    
Sbjct: 119 AQDTTQLSELIGAFKALGSRVSLFVDA-GNPRLAQAGAL-GADRVELYTGPYAQAYASGQ 176

Query: 172 PQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATAL 231
           PQ E   L+  A  A+ A    L INAGHDL+  N+ + +  +P + E+S+GHA  + AL
Sbjct: 177 PQPE---LDLFANAARRATTAGLGINAGHDLSQANLGDFLTNVPGVLEVSIGHALISEAL 233

Query: 232 ECGVKEAVFCF 242
             G+   V  +
Sbjct: 234 YAGLDATVRAY 244


>gi|332299679|ref|YP_004441600.1| Pyridoxine 5'-phosphate synthase [Porphyromonas asaccharolytica DSM
           20707]
 gi|332176742|gb|AEE12432.1| Pyridoxine 5'-phosphate synthase [Porphyromonas asaccharolytica DSM
           20707]
          Length = 242

 Score =  184 bits (468), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 95/237 (40%), Positives = 139/237 (58%), Gaps = 7/237 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PN+V   +   + GA G+TVHPRPD+RHI Y D+ ++R 
Sbjct: 2   TRLSVNINKIATLRNARGGDTPNVVLAARRCQEFGAEGITVHPRPDERHITYQDVRDLRE 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEGYP+++FL+L    +PEQ+TLVPD P  LTSD GW     +  L  
Sbjct: 62  VVTTEF-----NIEGYPSDSFLDLVCSVRPEQVTLVPDKPDALTSDSGWAVDDRRDFLKP 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            + RL   G R+SLF  G    H ++AA   GAD +ELYT PY +        ++ +   
Sbjct: 117 IIERLKQAGIRVSLFV-GTDPRH-IEAAAEIGADRVELYTEPYASQMAQSGDPKMIVAPF 174

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              AQ+A ++ L +NAGHDL   N+   +  +  + E+S+GHA  + AL  G++E +
Sbjct: 175 VEAAQVAHRVGLGVNAGHDLNRDNLAYFVQHVTPLDEVSIGHALISDALYLGLEETI 231


>gi|29349326|ref|NP_812829.1| pyridoxine 5'-phosphate synthase [Bacteroides thetaiotaomicron
           VPI-5482]
 gi|253570327|ref|ZP_04847736.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 1_1_6]
 gi|298384859|ref|ZP_06994418.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 1_1_14]
 gi|81586666|sp|Q8A0V3|PDXJ_BACTN RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|29341234|gb|AAO79023.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides
           thetaiotaomicron VPI-5482]
 gi|251840708|gb|EES68790.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 1_1_6]
 gi|298262003|gb|EFI04868.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 1_1_14]
          Length = 237

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/239 (40%), Positives = 144/239 (60%), Gaps = 13/239 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR  D+ ++R 
Sbjct: 2   TKLSVNINKVATLRNARGGDTPNVVKVALDCEAFGADGITVHPRPDERHIRRADVYDLRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     + E NIEGYP+  F++L  + KP Q+TLVPDDP Q+TS+ GWD   N   L++
Sbjct: 62  LL-----RTEFNIEGYPSPEFIDLVLKVKPHQVTLVPDDPSQITSNSGWDTKANLEFLSE 116

Query: 123 TVARLHNLGSRISLF--ADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            + + ++ G R S+F  AD    E++ +A    GAD +ELYT PY   Y  P+     + 
Sbjct: 117 VLDQFNSAGIRTSVFVAADPEMVEYAAKA----GADRVELYTEPYATAY--PKNPEAAVA 170

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                A+ A+K+ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +
Sbjct: 171 PFVEAAKTARKLGIGLNAGHDLSLVNLNYFYKNIPWVDEVSIGHALISDALYLGLERTI 229


>gi|255011375|ref|ZP_05283501.1| pyridoxine 5'-phosphate synthase [Bacteroides fragilis 3_1_12]
 gi|313149190|ref|ZP_07811383.1| pyridoxine 5'-phosphate synthase [Bacteroides fragilis 3_1_12]
 gi|313137957|gb|EFR55317.1| pyridoxine 5'-phosphate synthase [Bacteroides fragilis 3_1_12]
          Length = 237

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 97/239 (40%), Positives = 144/239 (60%), Gaps = 13/239 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR +D+ ++R 
Sbjct: 2   TKLSVNINKVATLRNARGGNVPNVVKVALDCESFGADGITVHPRPDERHIRRSDVYDLRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     + E NIEGYP+  F++L  + KP Q+TLVPDDP Q+TS+ GWD   N   LT+
Sbjct: 62  LL-----RTEFNIEGYPSPEFIDLVLKVKPHQVTLVPDDPSQITSNSGWDTKANFDFLTE 116

Query: 123 TVARLHNLGSRISLF--ADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            +   +  G R S+F  AD    E++ +A    GAD +ELYT PY   Y  P+     + 
Sbjct: 117 VLDEFNGAGIRTSVFVAADAEMIEYAAKA----GADRVELYTEPYATAY--PKDPAAAVA 170

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                A++A+++ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +
Sbjct: 171 PFVEAAKVARRLGIGLNAGHDLSLLNLNYFYKNIPWLDEVSIGHALISDALYLGLERTI 229


>gi|329907263|ref|ZP_08274584.1| Pyridoxine 5'-phosphate synthase [Oxalobacteraceae bacterium
           IMCC9480]
 gi|327547069|gb|EGF31952.1| Pyridoxine 5'-phosphate synthase [Oxalobacteraceae bacterium
           IMCC9480]
          Length = 242

 Score =  184 bits (467), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 98/233 (42%), Positives = 144/233 (61%), Gaps = 6/233 (2%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A+LRN R   +P++    +  LQ GA G+T+HPRPDQRH RY D+ E+  
Sbjct: 2   TQLSVNINKIALLRNSRGRNYPDVCAFAERFLQLGADGITLHPRPDQRHARYADVAELHA 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           +        ELN+EGYP   F+ +  R +P Q TLVPD P QLTSDHGWD +++  +L  
Sbjct: 62  VTSAH--GKELNVEGYPTAEFIEVVRRARPAQCTLVPDSPDQLTSDHGWDLVRDAGMLRP 119

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A L++ G R+SLF D N     L  A+  GA  +ELYT PY   + + +  ++ L + 
Sbjct: 120 VIAALNDDGIRVSLFVDVNNP--LLPLARELGAQRVELYTEPYAETFGSARSAQV-LEQF 176

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
            + A LA +  L +NAGHDL+++N+ + ++ IP I E+S+GHA     LE G+
Sbjct: 177 RVAAALAGEAGLGVNAGHDLSLENLADFLS-IPDILEVSIGHALIVECLELGM 228


>gi|89889542|ref|ZP_01201053.1| pyridoxal phosphate biosynthetic protein [Flavobacteria bacterium
           BBFL7]
 gi|89517815|gb|EAS20471.1| pyridoxal phosphate biosynthetic protein [Flavobacteria bacterium
           BBFL7]
          Length = 238

 Score =  183 bits (465), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 144/241 (59%), Gaps = 9/241 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N +A LRN R    P+L+       Q GA G+T+HPRPD+RHIRY D  ++++
Sbjct: 2   TALSVNVNKIATLRNARGGNVPDLIKCSLDIEQFGAQGITIHPRPDERHIRYQDARDLKK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           +I     + ELNIEG PNE F+ L +  +P Q+TLVPD    +TSD GWD ++N+A LTK
Sbjct: 62  VI-----QTELNIEGNPNEKFIALVDEVQPAQVTLVPDAVDAITSDAGWDTVKNEAYLTK 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V    + G R S+F D   +   ++ A  TG D IELYT  Y   Y  P  +   +   
Sbjct: 117 IVKHFKDQGIRTSIFVD--PSIEMVEGASKTGVDRIELYTEAYAHQY--PTDKEAAIAPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
            + AQ A  + L INAGHDL+++N+    + +P + E+S+GHA  + +L  G++  V  +
Sbjct: 173 IVAAQKALDLGLGINAGHDLSLENMRYFKDNVPGLLEVSIGHALISESLYMGLENVVNMY 232

Query: 243 R 243
           +
Sbjct: 233 K 233


>gi|198277581|ref|ZP_03210112.1| hypothetical protein BACPLE_03803 [Bacteroides plebeius DSM 17135]
 gi|198270079|gb|EDY94349.1| hypothetical protein BACPLE_03803 [Bacteroides plebeius DSM 17135]
          Length = 237

 Score =  183 bits (464), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 101/237 (42%), Positives = 142/237 (59%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    P++  +     Q GA G+TVHPRPD+RHIRY D+  +R 
Sbjct: 2   TKLSVNINKVATLRNARGGNNPDVEKVALDCEQFGAEGITVHPRPDERHIRYADVYALRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     K E NIEGYP++ F++L  R KP Q+TLVPD P Q+TS+ GWD   +QA LT+
Sbjct: 62  VL-----KTEFNIEGYPSKEFIDLVLRVKPTQVTLVPDAPDQITSNCGWDTKTHQAFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +      G R S+F  G   E    AAK TGAD +ELYT PY + Y  P+     +   
Sbjct: 117 LMDTFGEAGIRTSIFV-GTDLELIEYAAK-TGADRVELYTEPYASLY--PKNPEAAVAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A+   K+ + +NAGHDL++ N+    + IP++ E+S+GHA    AL  G+K+ +
Sbjct: 173 IEAAERVHKLGMGLNAGHDLSLVNLKYFHDNIPWLDEVSIGHALICDALYLGLKKTI 229


>gi|218265376|ref|ZP_03478775.1| hypothetical protein PRABACTJOHN_04486 [Parabacteroides johnsonii
           DSM 18315]
 gi|218221507|gb|EEC94157.1| hypothetical protein PRABACTJOHN_04486 [Parabacteroides johnsonii
           DSM 18315]
          Length = 243

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 103/243 (42%), Positives = 144/243 (59%), Gaps = 9/243 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA +RN R    PN++ +       GA G+TVHPRPD+RHIRY+D+  ++ 
Sbjct: 2   TNLSVNINKVATIRNARGGNVPNVLKVALDCEAFGAQGITVHPRPDERHIRYSDVYALKP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            I     K E NIEGYP E F++L  + KP Q+TLVPD P  +TS+ GWD   +   L++
Sbjct: 62  EI-----KTEFNIEGYPCEKFIDLVLKVKPTQVTLVPDAPDAITSNAGWDVRTHFDQLSE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V    + G R S+F  G   E+   AAK TG D IELYT PY   Y  PQ     +   
Sbjct: 117 LVETFTSHGIRTSIFI-GTDLENIEWAAK-TGTDRIELYTEPYATLY--PQNREEAIAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQLA+ + L +NAGHDL+++N+      IP + E+S+GHA  + AL  G+KE +  +
Sbjct: 173 IAAAQLAKNLGLGVNAGHDLSLENLAYFHQNIPGLDEVSIGHALISDALYYGLKETIRLY 232

Query: 243 RRA 245
           + A
Sbjct: 233 KEA 235


>gi|86140711|ref|ZP_01059270.1| pyridoxal phosphate biosynthetic protein [Leeuwenhoekiella
           blandensis MED217]
 gi|85832653|gb|EAQ51102.1| pyridoxal phosphate biosynthetic protein [Leeuwenhoekiella
           blandensis MED217]
          Length = 251

 Score =  182 bits (463), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 97/246 (39%), Positives = 147/246 (59%), Gaps = 13/246 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+L+   K     GA G+T+HPRPD+RHIRY D  +++ 
Sbjct: 16  TKLSVNVNKIATLRNARGGNVPDLIKTVKDIESFGAQGITIHPRPDERHIRYQDARDLKG 75

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     K ELNIEG P E F+NL    +P+Q+TLVPD    +TS+ GWD ++N+  L +
Sbjct: 76  VV-----KTELNIEGNPVEKFINLVLEVQPDQVTLVPDSVDAITSNAGWDTIKNRLFLKE 130

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN--NPQQERIFLN 180
            +A   + G R S+F D       ++ AK TG D IELYT  +   +   +P   + +++
Sbjct: 131 VIAEFKSHGIRTSIFVDPVA--EMIEGAKETGTDRIELYTEAFAEGFKEGHPNAVKPYVD 188

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
                A LAQ +DL +NAGHDL+++NI    ++IP + E+S+GHA  A AL  G+++ + 
Sbjct: 189 ----AALLAQDLDLGLNAGHDLSLENIKFFADSIPGLLEVSIGHALIAEALYDGLEKTIQ 244

Query: 241 CFRRAC 246
            +  A 
Sbjct: 245 SYLEAL 250


>gi|333029292|ref|ZP_08457353.1| Pyridoxine 5'-phosphate synthase [Bacteroides coprosuis DSM 18011]
 gi|332739889|gb|EGJ70371.1| Pyridoxine 5'-phosphate synthase [Bacteroides coprosuis DSM 18011]
          Length = 238

 Score =  182 bits (463), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 146/246 (59%), Gaps = 9/246 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    PN+V + K   + GA G+T+HPRPD+RHI   D+ ++R 
Sbjct: 2   TKLSVNINKVATLRNSRGGNVPNVVQVAKDCERFGADGITIHPRPDERHITRKDVFDLRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           +I  +F     NIEGYP+  F++L    KP Q+TLVPD P QLTS+ GW+  ++QA L +
Sbjct: 62  IITTEF-----NIEGYPSRDFIDLVLSVKPHQVTLVPDSPDQLTSNAGWNTKEHQAFLRE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +   +  G R S+F +   ++  ++ A   GAD +ELYT PY   Y  P          
Sbjct: 117 VLDEFNTAGIRTSVFIE--TDKEMIEYAAKAGADRVELYTEPYALNY--PTDPATAAAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+L + + + +NAGHDL ++N+  L N IP++ E+S+GHA  + AL  G+++ +  +
Sbjct: 173 IEAAKLVKSLGMGLNAGHDLNLENLNYLYNNIPWLDEVSIGHALISDALYLGLEKTIQEY 232

Query: 243 RRACGQ 248
           ++   +
Sbjct: 233 KKCLSE 238


>gi|119476921|ref|ZP_01617202.1| pyridoxal phosphate biosynthetic protein [marine gamma
           proteobacterium HTCC2143]
 gi|119449728|gb|EAW30965.1| pyridoxal phosphate biosynthetic protein [marine gamma
           proteobacterium HTCC2143]
          Length = 258

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 102/261 (39%), Positives = 151/261 (57%), Gaps = 24/261 (9%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVNLN +A++RN R+   P++    +I + +GA G+TVHPRPDQRHIR  D  ++ +
Sbjct: 5   TDLSVNLNKIALIRNSRDTTSPSVTEHAQICIDAGADGITVHPRPDQRHIRVDDCFDLAK 64

Query: 63  LIDEQFPKAELNIEGYPNET--------------FLNLCERYKPEQITLVPDDPHQLTSD 108
           ++       E NIEG P                 FL+L +  KP Q TLVPD+ +QLTSD
Sbjct: 65  ML-----SVEFNIEGNPLAAAMKSDRNGVSDYPGFLDLVKEIKPAQCTLVPDNNNQLTSD 119

Query: 109 HGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC 168
           HG+D  ++   L+  +  LH+LG R+SLF   +  + +L  AK  GAD IELYTGPY   
Sbjct: 120 HGFDLFESGDSLSPIIDELHSLGIRVSLFMGTDLEQINL--AKQLGADRIELYTGPYAQA 177

Query: 169 Y-NNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFA 227
           + NN   E IF  +     + A ++ + +NAGHDL + N+P     IP + E+S+GHA  
Sbjct: 178 FMNNTNLESIF-RQFYQAGETAAELGIGLNAGHDLNLHNLPKFA-TIPQLLEVSIGHAMT 235

Query: 228 ATALECGVKEAVFCFRRACGQ 248
             A++ G+  AV  +++  G+
Sbjct: 236 VDAIKMGLDNAVHAYQQCLGK 256


>gi|124265846|ref|YP_001019850.1| pyridoxine 5'-phosphate synthase [Methylibium petroleiphilum PM1]
 gi|124258621|gb|ABM93615.1| pyridoxal phosphate biosynthetic protein [Methylibium
           petroleiphilum PM1]
          Length = 265

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 99/247 (40%), Positives = 141/247 (57%), Gaps = 7/247 (2%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +T++SVNLN VA+LRN R L  P++    +IA+ +GA G+TVHPRPDQRHIR  D+ ++ 
Sbjct: 15  TTALSVNLNKVALLRNTRPLTIPSVTRAARIAIDAGAHGITVHPRPDQRHIRTHDVHDLA 74

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            ++ ++ P  E NIEG P    ++L    +P Q T VPD   Q TSDHGW   ++   L 
Sbjct: 75  EMLKQEHPHIEYNIEGNPFHNLMDLVRVVRPHQATFVPDSVEQSTSDHGWSLPEDNEALR 134

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY----NNPQQERI 177
             +   H LG R+SLF D      ++  A+  GAD +ELYT  Y   +      PQ   +
Sbjct: 135 PLIDECHALGVRVSLFMDPLPE--AMAQARAIGADRVELYTEAYARSHAEGAGTPQHAAL 192

Query: 178 FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKE 237
                A +A+ A  + L +NAGHDL   N+   + A+P + E+S+GHA  A ALE G+ E
Sbjct: 193 LACYTA-SAEAALGVGLGLNAGHDLNRDNLTAFLRAVPGVLEVSIGHALIADALELGLAE 251

Query: 238 AVFCFRR 244
            V  + R
Sbjct: 252 TVRDYLR 258


>gi|332666481|ref|YP_004449269.1| Pyridoxine 5'-phosphate synthase [Haliscomenobacter hydrossis DSM
           1100]
 gi|332335295|gb|AEE52396.1| Pyridoxine 5'-phosphate synthase [Haliscomenobacter hydrossis DSM
           1100]
          Length = 239

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 97/244 (39%), Positives = 143/244 (58%), Gaps = 11/244 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  +SVN+N +A++RN R    P+L  I +     GA G+TVHPRPD+RH+R+ DLP ++
Sbjct: 3   SVRLSVNINKIALIRNSRGANLPDLTQIARDCEAFGAQGITVHPRPDERHVRFDDLPLLQ 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     + E NIEG P+  FL    + KP Q TLVPD P  LTSD GWD  ++   L 
Sbjct: 63  ATV-----RTEFNIEGNPDPRFLREVMQVKPHQATLVPDGPQALTSDQGWDTAKHHDFLV 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY-NNPQQERIFLN 180
             VA+L ++G+R+S+F D    E  ++ AK  GAD IE YTG Y   + +NP +    + 
Sbjct: 118 DVVAQLQSVGTRVSIFVD--AEERFVEGAKRVGADRIEFYTGHYAKVFPSNPIEA---VK 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           K    A+LA ++ L INAGHDL ++N+    + +  + E+S+GHA    AL  G++  + 
Sbjct: 173 KHVHCAKLAVELGLGINAGHDLNLKNLSFYKDQVQGLMEVSIGHALVCDALYYGLQNTIQ 232

Query: 241 CFRR 244
            + R
Sbjct: 233 MYLR 236


>gi|237724122|ref|ZP_04554603.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. D4]
 gi|265755208|ref|ZP_06089978.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_33FAA]
 gi|229437582|gb|EEO47659.1| pyridoxine 5'-phosphate synthase [Bacteroides dorei 5_1_36/D4]
 gi|263234350|gb|EEZ19940.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_33FAA]
          Length = 238

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 98/241 (40%), Positives = 143/241 (59%), Gaps = 9/241 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    P++V +       GA G+TVHPRPD+RHIR +D+ E+R 
Sbjct: 2   TKLSVNINKVATLRNARGGNNPDVVKVALDCEAFGAEGITVHPRPDERHIRRSDVYELRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+  +F     NIEGYP   F++L  + KP Q+TLVPD P Q+TS+ GWD   N + LT+
Sbjct: 62  LLTTEF-----NIEGYPAPEFVDLVLKVKPHQVTLVPDAPDQITSNAGWDTKANLSFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +      G R S+F  G   E    AAK  GAD +ELYT PY   Y  PQ   + +   
Sbjct: 117 LMDTFGQAGIRTSIFV-GTDKEMIEYAAK-AGADRVELYTEPYATMY--PQNPEVAIAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A++ + + + +NAGHDL++ N+  +   IP++ E+S+GHA  + AL  G+K+ +  +
Sbjct: 173 IEAAKVTRSLGMGLNAGHDLSLVNLKYMHTHIPWLDEVSIGHALISDALYMGLKQTIEEY 232

Query: 243 R 243
           +
Sbjct: 233 K 233


>gi|192359059|ref|YP_001982266.1| pyridoxine 5'-phosphate synthase [Cellvibrio japonicus Ueda107]
 gi|190685224|gb|ACE82902.1| Pyridoxal phosphate biosynthesis protein PdxJ [Cellvibrio japonicus
           Ueda107]
          Length = 257

 Score =  182 bits (461), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 106/253 (41%), Positives = 144/253 (56%), Gaps = 12/253 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +T++SVNLN +A++RN R   +P++V  G+I L +GA GLTVHPRPDQRHIR  D+ EI 
Sbjct: 7   ATALSVNLNKIALIRNSRPGNYPDVVKHGEICLAAGADGLTVHPRPDQRHIRPQDVYEIS 66

Query: 62  RLIDEQFPKAELNIEGYPNET-------FLNLCERYKPEQITLVPDDPHQLTSDHGWDFL 114
            L+       E NIEG P          FL L E  +P Q TLVPD   QLTSDHG+D  
Sbjct: 67  ALVGAH-QGIEFNIEGNPFAEKVGNFPGFLQLVENTRPHQCTLVPDSNDQLTSDHGFDLK 125

Query: 115 QNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ 174
           ++   L   V  L +LG R+SLF D +  + SL  AK  G + IELYTGPY   +  P  
Sbjct: 126 KSSVQLEPIVRHLQSLGIRVSLFMDPDPEQISL--AKDLGVERIELYTGPYAEAFKQPGS 183

Query: 175 E-RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALEC 233
                  +    A  AQ + + +NAGHDL + N+ +    +P + E+S+GHA    AL  
Sbjct: 184 TFDTLFKRYYDAAAHAQAIGVGLNAGHDLNLDNLGHF-RKVPALLEVSIGHALTVDALAM 242

Query: 234 GVKEAVFCFRRAC 246
           G+  AV  +++ C
Sbjct: 243 GMHNAVAAYKKLC 255


>gi|329957267|ref|ZP_08297787.1| pyridoxine 5'-phosphate synthase [Bacteroides clarus YIT 12056]
 gi|328522980|gb|EGF50083.1| pyridoxine 5'-phosphate synthase [Bacteroides clarus YIT 12056]
          Length = 237

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 94/237 (39%), Positives = 139/237 (58%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR  D+ ++R 
Sbjct: 2   TRLSVNINKVATLRNARGGDVPNVVKVALDCENFGADGITVHPRPDERHIRKRDVFDLRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD   N   LT+
Sbjct: 62  LL-----RTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDSPTQLTSNSGWDTKTNLEFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +   +  G R S+F   +     ++ A   GAD +ELYT PY   +  P+ +   +   
Sbjct: 117 VLEAFNTAGIRTSVFVSTDA--EMIEYAAKAGADRVELYTEPYATAF--PKGKEAAVAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A++A+ + L +NAGHDL+++N+      IP++ E+S+GHA  + AL  G++  +
Sbjct: 173 VEAAKIARSLGLGLNAGHDLSLENLNYFYKNIPWLDEVSIGHALISDALYLGLERTI 229


>gi|34540436|ref|NP_904915.1| pyridoxine 5'-phosphate synthase [Porphyromonas gingivalis W83]
 gi|6225840|sp|Q51843|PDXJ_PORGI RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|1296977|emb|CAA65867.1| pyridoxal phosphate synthetase [Porphyromonas gingivalis]
 gi|34396749|gb|AAQ65814.1| pyridoxal phosphate biosynthetic protein PdxJ [Porphyromonas
           gingivalis W83]
          Length = 238

 Score =  182 bits (461), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 98/242 (40%), Positives = 143/242 (59%), Gaps = 11/242 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+++ +     + GA G+TVHPRPD+RHIR +D+ ++++
Sbjct: 2   TRLSVNVNKIATLRNARGGNVPDVLRVALDCERFGAQGITVHPRPDERHIRRSDVYDLKK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +  +F     NIEG P+E F+ L E  +PEQ+T+VPD P  LTS+ GWD  +N   L +
Sbjct: 62  ALTTEF-----NIEGNPDERFIRLIEEIRPEQVTMVPDAPDVLTSNAGWDVARNYDHLCR 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V R H  G R S+F D + +  S  A   TG D IELYT PY A Y+      +   + 
Sbjct: 117 LVERFHAWGIRTSIFIDTDLDNISWAAK--TGTDRIELYTEPYAAAYHKDMAAAV---QP 171

Query: 183 AITAQL-AQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
            + A + A  + L INAGHDL + N+      +PY+ E+S+GHA  A AL  G++E +  
Sbjct: 172 YVKASVHAHSLGLGINAGHDLNLDNLRYFAERLPYLDEVSIGHALIADALYLGLEETIRQ 231

Query: 242 FR 243
           +R
Sbjct: 232 YR 233


>gi|53715251|ref|YP_101243.1| pyridoxine 5'-phosphate synthase [Bacteroides fragilis YCH46]
 gi|60683185|ref|YP_213329.1| pyridoxine 5'-phosphate synthase [Bacteroides fragilis NCTC 9343]
 gi|253566383|ref|ZP_04843837.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_2_5]
 gi|265767081|ref|ZP_06094910.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_16]
 gi|81313762|sp|Q5L912|PDXJ_BACFN RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|91207220|sp|Q3V814|PDXJ_BACFR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|52218116|dbj|BAD50709.1| pyridoxal phosphate biosynthetic protein PdxJ [Bacteroides fragilis
           YCH46]
 gi|60494619|emb|CAH09420.1| putative pyridoxine biosynthesis protein [Bacteroides fragilis NCTC
           9343]
 gi|251945487|gb|EES85925.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_2_5]
 gi|263253458|gb|EEZ24934.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_16]
 gi|301164705|emb|CBW24264.1| putative pyridoxine biosynthesis protein [Bacteroides fragilis
           638R]
          Length = 237

 Score =  181 bits (460), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 94/237 (39%), Positives = 140/237 (59%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR +D+ ++R 
Sbjct: 2   TKLSVNINKVATLRNARGGNVPNVVKVALDCESFGADGITVHPRPDERHIRRSDVYDLRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     + E NIEGYP+  F++L  + KP Q+TLVPDDP Q+TS+ GWD   N   LT+
Sbjct: 62  LL-----RTEFNIEGYPSPEFIDLVLKVKPHQVTLVPDDPSQITSNSGWDTKVNFDFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +   +  G R S+F   +     ++ A   GAD +ELYT PY   Y  P+     +   
Sbjct: 117 VLDEFNGAGIRTSVFVAPDA--EMIEYAAKAGADRVELYTEPYATAY--PKDPAAAVAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A+ A+++ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +
Sbjct: 173 VEAAKAARRLGIGLNAGHDLSLLNLNYFYKNIPWLDEVSIGHALISDALYLGLERTI 229


>gi|237719135|ref|ZP_04549616.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp.
           2_2_4]
 gi|293368684|ref|ZP_06615290.1| pyridoxine 5'-phosphate synthase [Bacteroides ovatus SD CMC 3f]
 gi|298480232|ref|ZP_06998430.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. D22]
 gi|229451514|gb|EEO57305.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp.
           2_2_4]
 gi|292636225|gb|EFF54711.1| pyridoxine 5'-phosphate synthase [Bacteroides ovatus SD CMC 3f]
 gi|295086524|emb|CBK68047.1| pyridoxine 5'-phosphate synthase [Bacteroides xylanisolvens XB1A]
 gi|298273513|gb|EFI15076.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. D22]
          Length = 238

 Score =  181 bits (460), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 96/239 (40%), Positives = 144/239 (60%), Gaps = 13/239 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P++V +       GA G+TVHPRPD+RHIR +D+ ++R 
Sbjct: 2   TKLSVNINKIATLRNARGGNVPDVVKVALDCESFGADGITVHPRPDERHIRRSDVYDLRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     + E NIEGYP   F++L  + KP Q+TLVPDDP Q+TS+ GWD   N   LT+
Sbjct: 62  LL-----RTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDDPSQITSNSGWDTKANLEFLTE 116

Query: 123 TVARLHNLGSRISLF--ADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            + + ++ G R S+F  AD    E++ +A    GAD +ELYT PY   Y  P+     + 
Sbjct: 117 VLDQFNSAGIRTSVFVAADPEMVEYAAKA----GADRVELYTEPYATNY--PKNPEAAIA 170

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                A+ A+K+ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +
Sbjct: 171 PFIEAAKTARKLGIGLNAGHDLSLVNLNYFYKNIPWVDEVSIGHALISDALYLGLERTI 229


>gi|255038473|ref|YP_003089094.1| pyridoxine 5'-phosphate synthase [Dyadobacter fermentans DSM 18053]
 gi|254951229|gb|ACT95929.1| pyridoxal phosphate biosynthetic protein PdxJ [Dyadobacter
           fermentans DSM 18053]
          Length = 239

 Score =  181 bits (459), Expect = 8e-44,   Method: Compositional matrix adjust.
 Identities = 96/243 (39%), Positives = 150/243 (61%), Gaps = 10/243 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PN++ +     + GA G+TVHPRPD+RHIRY D+ ++R 
Sbjct: 2   TRLSVNINKIATLRNSRGGDNPNVLKVALDCERFGAQGITVHPRPDERHIRYQDVYDLRE 61

Query: 63  LIDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           L+  +F     NIEG P+E  F+ L    KP+Q+TLVPD    +TS+ GWD + ++++LT
Sbjct: 62  LVTTEF-----NIEGNPSEKKFVELVLANKPDQVTLVPDALGAITSNAGWDTITHRSVLT 116

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V    + G R+S+F D   +E  ++ AK+ GAD +ELYT P+ A Y   +Q+ +    
Sbjct: 117 DLVGTFKSAGIRVSVFVD--PDEDMVEGAKICGADRVELYTEPFAAGYFENRQKAVL--P 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               A+ A+++ L +NAGHDL++ N+  L  +IP++ E+S+GHA    AL  G++  +  
Sbjct: 173 FVKAAEKAREVGLGLNAGHDLSLDNLHFLKQSIPWMDEVSIGHALICDALYIGLENTIQM 232

Query: 242 FRR 244
           + R
Sbjct: 233 YLR 235


>gi|295132500|ref|YP_003583176.1| pyridoxal phosphate biosynthetic protein PdxJ [Zunongwangia
           profunda SM-A87]
 gi|294980515|gb|ADF50980.1| pyridoxal phosphate biosynthetic protein PdxJ [Zunongwangia
           profunda SM-A87]
          Length = 249

 Score =  181 bits (459), Expect = 9e-44,   Method: Compositional matrix adjust.
 Identities = 93/237 (39%), Positives = 140/237 (59%), Gaps = 8/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PN+V       + GA G+TVHPRPD+RHIRY D  +++ 
Sbjct: 13  TKLSVNINKIATLRNARGGNIPNVVQCALDIEKFGAEGITVHPRPDERHIRYQDTRDLKP 72

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     K E NIEG P   F+NL    KP Q+TLVPD    +TS+ GW+ ++N+  L +
Sbjct: 73  VL-----KTEFNIEGNPVTKFINLVLEVKPAQVTLVPDAEDAITSNAGWNTVKNKEYLIE 127

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            ++     G R S+F D   +E  ++ A  TG D IELYT  +   + +  ++   +   
Sbjct: 128 VISEFKKHGIRTSIFVD--ADEKMIEGAAATGTDRIELYTESFAEKFADGDKKEA-VKPY 184

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           A  A+LA ++ L +NAGHDL++ NI    N +P++ E+S+GHA  A AL  G++E +
Sbjct: 185 AKCAELAHQLGLGVNAGHDLSLDNIEFFKNEVPFVDEVSIGHALIAEALYLGLEETI 241


>gi|153809131|ref|ZP_01961799.1| hypothetical protein BACCAC_03441 [Bacteroides caccae ATCC 43185]
 gi|149128464|gb|EDM19683.1| hypothetical protein BACCAC_03441 [Bacteroides caccae ATCC 43185]
          Length = 237

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 95/239 (39%), Positives = 145/239 (60%), Gaps = 13/239 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P++V +       GA G+TVHPRPD+RHIR +D+ ++R 
Sbjct: 2   TKLSVNINKIATLRNARGGNVPDVVKVALDCESFGADGITVHPRPDERHIRRSDVYDLRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     + E NIEGYP+  F++L  + KP Q+TLVPDDP Q+TS+ GWD   N   LT+
Sbjct: 62  LL-----RTEFNIEGYPSPEFIDLVLKVKPHQVTLVPDDPSQITSNSGWDTKANLEFLTE 116

Query: 123 TVARLHNLGSRISLF--ADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            + + ++ G R S+F  AD    E++ +A    GAD +ELYT PY   +  P+     + 
Sbjct: 117 VLDQFNSAGIRTSVFVAADPEMVEYAAKA----GADRVELYTEPYATDF--PKNPEAAIA 170

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                A+ A+K+ + +NAGHDL++ N+      IP++ E+S+GHA  + AL  G++  +
Sbjct: 171 PFIEAAKTARKLGIGLNAGHDLSLVNLNYFYKNIPWVDEVSIGHALISDALYLGLERTI 229


>gi|262381242|ref|ZP_06074380.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_33B]
 gi|298376392|ref|ZP_06986347.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_19]
 gi|262296419|gb|EEY84349.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_33B]
 gi|298266270|gb|EFI07928.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_19]
          Length = 238

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 97/244 (39%), Positives = 146/244 (59%), Gaps = 10/244 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA +RN R    PN++ + +     GA G+TVHPRPD+RHIRY+D+  ++ 
Sbjct: 2   TNLSVNINKVATIRNARGGNMPNVLKVAQDCELFGAQGITVHPRPDERHIRYSDVYGLKP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           LI     + E NIEGYP + F++L  + KP Q+TLVPD P  +TS+ GW+   N   L++
Sbjct: 62  LI-----RTEFNIEGYPCDKFIDLVLKVKPTQVTLVPDAPDAITSNSGWNVKDNFDYLSE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V    + G R S+F     +  +++ A  TG D IELYT PY   Y  P+     +   
Sbjct: 117 LVDTFTSQGIRTSIFV--GTDLANIELAAKTGTDRIELYTEPYATFY--PEDRDKAIAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQLA+ + L +NAGHDL+++N+      IP++ E+S+GHA    AL  G++E +  +
Sbjct: 173 VEAAQLAKNLGLGVNAGHDLSLENLAFFNKNIPWLEEVSIGHALICDALYHGLQETIALY 232

Query: 243 RRAC 246
            +AC
Sbjct: 233 -KAC 235


>gi|167765303|ref|ZP_02437416.1| hypothetical protein BACSTE_03691 [Bacteroides stercoris ATCC
           43183]
 gi|167696931|gb|EDS13510.1| hypothetical protein BACSTE_03691 [Bacteroides stercoris ATCC
           43183]
          Length = 237

 Score =  181 bits (458), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 94/237 (39%), Positives = 138/237 (58%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR +D+ ++R 
Sbjct: 2   TRLSVNINKVATLRNARGGNVPNVVKVALDCESFGADGITVHPRPDERHIRKSDVYDLRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD   N   LT+
Sbjct: 62  LL-----RTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDSPTQLTSNSGWDTKANLEFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +   +  G R S+F   +     ++ A   GAD +ELYT PY   +  P+     +   
Sbjct: 117 VLEAFNTAGIRTSVFVSTDA--EMIEYAAKAGADRVELYTEPYATAF--PKNPEAAVAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A+ A+ + L +NAGHDL+++N+      IP++ E+S+GHA  + AL  G++  +
Sbjct: 173 VEAARTARSLGLGLNAGHDLSLENLNYFYKNIPWLDEVSIGHALISDALYLGLERTI 229


>gi|258648958|ref|ZP_05736427.1| pyridoxine 5'-phosphate synthase [Prevotella tannerae ATCC 51259]
 gi|260850561|gb|EEX70430.1| pyridoxine 5'-phosphate synthase [Prevotella tannerae ATCC 51259]
          Length = 237

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 99/237 (41%), Positives = 141/237 (59%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+++ +    ++ GA G+TVHPRPD+RHIR +D+  +R 
Sbjct: 2   TKLSVNINKIATLRNARGGNNPDVLAVALDCVRFGAQGITVHPRPDERHIRRSDVHLLRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +D +F     NIEGYP++ F++L     P Q+TLVPD P QLTS+HGWD   N + LT 
Sbjct: 62  ALDVEF-----NIEGYPSDDFIDLVCEVGPAQVTLVPDKPGQLTSNHGWDTRANLSQLTD 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V R    G R S+F     NE + + AK  GAD +ELYT PY A Y   ++  I     
Sbjct: 117 IVGRFKEKGIRTSIFISAE-NEMA-EYAKRAGADRVELYTEPYAANYATDREAAI--RPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             TA   +++ L +NAGHDL++QN+      IP+  E+S+GHA  + AL  G+   +
Sbjct: 173 VETADYVRQIGLGLNAGHDLSLQNLSFFHQQIPWADEVSIGHALISDALYLGLHNTI 229


>gi|329963086|ref|ZP_08300866.1| pyridoxine 5'-phosphate synthase [Bacteroides fluxus YIT 12057]
 gi|328529127|gb|EGF56057.1| pyridoxine 5'-phosphate synthase [Bacteroides fluxus YIT 12057]
          Length = 262

 Score =  180 bits (457), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 139/239 (58%), Gaps = 9/239 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           + T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR +D+ ++
Sbjct: 25  IMTRLSVNINKVATLRNARGGDAPNVVKVALDCENFGADGITVHPRPDERHIRRSDVYDL 84

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD   N   L
Sbjct: 85  RPLL-----RTEFNIEGYPAPDFIDLVLKVKPHQVTLVPDSPTQLTSNAGWDTKTNLDFL 139

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           ++ +   +N G R S+F   +     ++ A   GAD +ELYT PY   Y  P+ +   + 
Sbjct: 140 SEVLDEFNNAGIRTSVFVSTDA--EMIEYAAKAGADRVELYTEPYATAY--PKGKEAAIA 195

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                A++ + + L +NAGHDL++ N+      IP++ E+S+GHA    AL  G++  +
Sbjct: 196 PFVEAAKVVRSLGLGLNAGHDLSLVNLNYFYQNIPWLDEVSIGHALICDALYLGLERTI 254


>gi|212691798|ref|ZP_03299926.1| hypothetical protein BACDOR_01293 [Bacteroides dorei DSM 17855]
 gi|237708610|ref|ZP_04539091.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp.
           9_1_42FAA]
 gi|212665699|gb|EEB26271.1| hypothetical protein BACDOR_01293 [Bacteroides dorei DSM 17855]
 gi|229457310|gb|EEO63031.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp.
           9_1_42FAA]
          Length = 238

 Score =  180 bits (457), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 98/241 (40%), Positives = 142/241 (58%), Gaps = 9/241 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    P++V +       GA G+TVHPRPD+RHIR +D+ E+R 
Sbjct: 2   TKLSVNINKVATLRNARGGNNPDVVKVALDCEAFGAEGITVHPRPDERHIRRSDVYELRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+  +F     NIEGYP   F++L  + KP Q+TLVPD P Q+TS+ GWD   N + LT+
Sbjct: 62  LLTTEF-----NIEGYPAPEFVDLVLKVKPHQVTLVPDAPDQITSNAGWDTKANLSFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +      G R S+F  G   E    AAK  GAD +ELYT PY   Y  PQ     +   
Sbjct: 117 LMDTFGQAGIRTSIFV-GTDKEMIEYAAK-AGADRVELYTEPYATMY--PQNPEAAIAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A++ + + + +NAGHDL++ N+  +   IP++ E+S+GHA  + AL  G+K+ +  +
Sbjct: 173 IEAAKVTRSLGMGLNAGHDLSLVNLKYMHTHIPWLDEVSIGHALISDALYMGLKQTIEEY 232

Query: 243 R 243
           +
Sbjct: 233 K 233


>gi|160890800|ref|ZP_02071803.1| hypothetical protein BACUNI_03245 [Bacteroides uniformis ATCC 8492]
 gi|270295799|ref|ZP_06201999.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. D20]
 gi|317479762|ref|ZP_07938884.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 4_1_36]
 gi|156859799|gb|EDO53230.1| hypothetical protein BACUNI_03245 [Bacteroides uniformis ATCC 8492]
 gi|270273203|gb|EFA19065.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. D20]
 gi|316904132|gb|EFV25964.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 4_1_36]
          Length = 237

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 139/245 (56%), Gaps = 13/245 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    PN+V +       GA G+TVHPRPD+RHIR  D+ ++R 
Sbjct: 2   TRLSVNINKVATLRNARGGDVPNVVKVALDCEDFGADGITVHPRPDERHIRRKDVYDLRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD   +   L +
Sbjct: 62  LL-----RTEFNIEGYPAPEFMDLVLKVKPHQVTLVPDSPTQLTSNAGWDTKTHFDFLNE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +   +N G R S+F   +     ++ A   GAD +ELYT PY   Y  P+     +   
Sbjct: 117 VLDEFNNAGIRTSVFVSTDA--EMIEYAAKAGADRVELYTEPYATAY--PKGREAAVAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG----VKEA 238
              A++A+ + L +NAGHDL++ N+      IP++ E+S+GHA  + AL  G    VKE 
Sbjct: 173 VEAAKVARSLGLGLNAGHDLSLVNLNYFYQNIPWLDEVSIGHALISDALYLGLERTVKEY 232

Query: 239 VFCFR 243
             C R
Sbjct: 233 KNCLR 237


>gi|256840633|ref|ZP_05546141.1| pyridoxine 5'-phosphate synthase [Parabacteroides sp. D13]
 gi|256737905|gb|EEU51231.1| pyridoxine 5'-phosphate synthase [Parabacteroides sp. D13]
          Length = 238

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/244 (39%), Positives = 145/244 (59%), Gaps = 10/244 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA +RN R    PN++ + +     GA G+TVHPRPD+RHIRY+D+  ++ 
Sbjct: 2   TNLSVNINKVATIRNARGGNMPNVLKVAQDCELFGAQGITVHPRPDERHIRYSDVYGLKP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           LI     + E NIEGYP + F++L  + KP Q+TLVPD P  +TS+ GW+   N   L++
Sbjct: 62  LI-----RTEFNIEGYPCDKFIDLVLKVKPTQVTLVPDAPDAITSNSGWNVKDNFDYLSE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V    + G R S+F     +  +++ A  TG D IELYT PY   Y  P+     +   
Sbjct: 117 LVDTFTSQGIRTSIFV--GTDLANIELAAKTGTDRIELYTEPYATFY--PEDRDKAIAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQLA+ + L +NAGHDL ++N+      IP++ E+S+GHA    AL  G++E +  +
Sbjct: 173 VEAAQLAKNLGLGVNAGHDLNLENLAFFNKNIPWLEEVSIGHALICDALYHGLQETIALY 232

Query: 243 RRAC 246
            +AC
Sbjct: 233 -KAC 235


>gi|188994535|ref|YP_001928787.1| pyridoxine 5'-phosphate synthase [Porphyromonas gingivalis ATCC
           33277]
 gi|238691468|sp|B2RIJ5|PDXJ_PORG3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|188594215|dbj|BAG33190.1| putative pyridoxal phosphate biosynthetic protein [Porphyromonas
           gingivalis ATCC 33277]
          Length = 238

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/241 (39%), Positives = 140/241 (58%), Gaps = 9/241 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+++ +     + GA G+TVHPRPD+RHIR +D+ ++++
Sbjct: 2   TRLSVNVNKIATLRNARGGNVPDVLRVALDCERFGAQGITVHPRPDERHIRRSDVYDLKK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +  +F     NIEG P+E F+ L E  +PEQ+T+VPD P  LTS+ GWD  +N   L +
Sbjct: 62  ALTTEF-----NIEGNPDERFIRLIEEIRPEQVTMVPDAPDVLTSNAGWDVARNYDHLCR 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V + H  G R S+F D + +  S  A   TG D IELYT PY A Y+      +     
Sbjct: 117 LVEQFHAWGIRTSIFIDTDLDNISWAAK--TGTDRIELYTEPYAAAYHKDMAAAV--QPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              +  A  + L INAGHDL + N+      +PY+ E+S+GHA  A AL  G++E +  +
Sbjct: 173 VKASAHAHSLGLGINAGHDLNLDNLRYFAERLPYLDEVSIGHALIADALYLGLEETIRQY 232

Query: 243 R 243
           R
Sbjct: 233 R 233


>gi|150008179|ref|YP_001302922.1| pyridoxine 5'-phosphate synthase [Parabacteroides distasonis ATCC
           8503]
 gi|255015132|ref|ZP_05287258.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 2_1_7]
 gi|301309704|ref|ZP_07215643.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 20_3]
 gi|166219102|sp|A6LC86|PDXJ_PARD8 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|149936603|gb|ABR43300.1| pyridoxal phosphate biosynthetic protein PdxJ [Parabacteroides
           distasonis ATCC 8503]
 gi|300831278|gb|EFK61909.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 20_3]
          Length = 238

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 97/244 (39%), Positives = 145/244 (59%), Gaps = 10/244 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA +RN R    PN++ + +     GA G+TVHPRPD+RHIRY+D+  ++ 
Sbjct: 2   TNLSVNINKVATIRNARGGNMPNVLKVAQDCELFGAQGITVHPRPDERHIRYSDVYGLKP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           LI     + E NIEGYP + F++L  + KP Q+TLVPD P  +TS+ GW+   N   L++
Sbjct: 62  LI-----RTEFNIEGYPCDKFIDLVLKVKPTQVTLVPDAPDAITSNSGWNVKDNFDYLSE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V    + G R S+F     +  +++ A  TG D IELYT PY   Y  P+     +   
Sbjct: 117 LVDTFTSQGIRTSIFV--GTDLANIELAAKTGTDRIELYTEPYATYY--PEDRDKAIAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQLA+ + L +NAGHDL ++N+      IP++ E+S+GHA    AL  G++E +  +
Sbjct: 173 VEAAQLAKNLGLGVNAGHDLNLENLAFFNKNIPWLEEVSIGHALICDALYHGLQETIALY 232

Query: 243 RRAC 246
            +AC
Sbjct: 233 -KAC 235


>gi|189462959|ref|ZP_03011744.1| hypothetical protein BACCOP_03661 [Bacteroides coprocola DSM 17136]
 gi|189430241|gb|EDU99225.1| hypothetical protein BACCOP_03661 [Bacteroides coprocola DSM 17136]
          Length = 237

 Score =  180 bits (456), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 96/237 (40%), Positives = 141/237 (59%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    P++  +       GA G+TVHPRPD+RHIRY D+  +R 
Sbjct: 2   TKLSVNINKVATLRNARGGNNPDVEKVALDCEAFGAEGITVHPRPDERHIRYADVLALRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     + E NIEGYP++ F++L  + KP Q+TLVPD P Q+TS+ GWD   N + LT+
Sbjct: 62  IL-----RTEFNIEGYPSKEFIDLVLKVKPHQVTLVPDAPDQITSNSGWDTKNNLSFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +      G R S+F  G   E    AAK  GAD +ELYT PY + Y   ++  I     
Sbjct: 117 LMDTFGEAGIRTSIFV-GTDTEMIEYAAK-AGADRVELYTEPYASQYGKNREAAI--APF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A++ +K+ + +NAGHDL+++N+      IP++ E+S+GHA    AL  G+K+ +
Sbjct: 173 VEAAKVTRKLGMGLNAGHDLSLENLAYFHENIPWVDEVSIGHALICDALYLGLKKTI 229


>gi|327402128|ref|YP_004342966.1| pyridoxine 5'-phosphate synthase [Fluviicola taffensis DSM 16823]
 gi|327317636|gb|AEA42128.1| pyridoxine 5'-phosphate synthase [Fluviicola taffensis DSM 16823]
          Length = 238

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 94/237 (39%), Positives = 144/237 (60%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A +RN R    PN+V +     + GA+G+TVHPRPD+RHI   D+ ++ +
Sbjct: 2   TKLSVNINKIATIRNARGGNTPNVVQVAIDCERFGAAGITVHPRPDERHITGKDVMDLSK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEGYP+E F+ + E  +P Q TLVPD PH LTS+ GWD  +N A+L  
Sbjct: 62  VVTTEF-----NIEGYPDERFMQMIEAIRPAQATLVPDPPHVLTSNAGWDTKENSAVLQD 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            + RL + G R S+F D   +  +++ A  TG D IELYTGPY   ++  +++ I     
Sbjct: 117 IIRRLKSWGVRTSIFVD--TDLQNIEYALETGTDRIELYTGPYADNFSINKEQAI--EPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            I ++ A ++ L +NAGHDL   N+      IP ++E+S+GHA  + AL  G++  +
Sbjct: 173 IIASKRAIELGLGLNAGHDLNQDNLRYFKQNIPELAEVSIGHALISDALYLGLENTI 229


>gi|150003065|ref|YP_001297809.1| pyridoxine 5'-phosphate synthase [Bacteroides vulgatus ATCC 8482]
 gi|254882348|ref|ZP_05255058.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp.
           4_3_47FAA]
 gi|294775907|ref|ZP_06741406.1| pyridoxine 5'-phosphate synthase [Bacteroides vulgatus PC510]
 gi|319640600|ref|ZP_07995319.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_40A]
 gi|166219083|sp|A6KXM3|PDXJ_BACV8 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|149931489|gb|ABR38187.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides vulgatus
           ATCC 8482]
 gi|254835141|gb|EET15450.1| pyridoxal phosphate biosynthetic protein pdxJ [Bacteroides sp.
           4_3_47FAA]
 gi|294450276|gb|EFG18777.1| pyridoxine 5'-phosphate synthase [Bacteroides vulgatus PC510]
 gi|317387770|gb|EFV68630.1| pyridoxine 5'-phosphate synthase [Bacteroides sp. 3_1_40A]
          Length = 238

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 143/241 (59%), Gaps = 9/241 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    P++V +       GA G+TVHPRPD+RHIR +D+ E+R 
Sbjct: 2   TKLSVNINKVATLRNARGGNNPDVVKVALDCEAFGAEGITVHPRPDERHIRRSDVYELRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+  +F     NIEGYP+  F++L  + KP Q+TLVPD P Q+TS+ GWD   N + LT+
Sbjct: 62  LLTTEF-----NIEGYPSPEFVDLVLKVKPHQVTLVPDAPDQITSNAGWDTKTNLSFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +      G R S+F  G   E    AAK  GAD +ELYT PY   Y  P+     +   
Sbjct: 117 LMDTFGQAGIRTSIFV-GTDKEMIEYAAK-AGADRVELYTEPYATMY--PRNPEAAIAPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A++ + + + +NAGHDL++ N+  +   IP++ E+S+GHA  + AL  G+K+ +  +
Sbjct: 173 IEAAKVTRSLGMGLNAGHDLSLVNLKYMHTHIPWLDEVSIGHALISDALYMGLKQTIEEY 232

Query: 243 R 243
           +
Sbjct: 233 K 233


>gi|224025359|ref|ZP_03643725.1| hypothetical protein BACCOPRO_02098 [Bacteroides coprophilus DSM
           18228]
 gi|224018595|gb|EEF76593.1| hypothetical protein BACCOPRO_02098 [Bacteroides coprophilus DSM
           18228]
          Length = 237

 Score =  179 bits (455), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 96/241 (39%), Positives = 142/241 (58%), Gaps = 9/241 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    P++  +     + GA G+TVHPRPD+RHIRY D+  +R 
Sbjct: 2   TKLSVNINKVATLRNARGGNNPDVEKVALDCERFGAEGITVHPRPDERHIRYADVYALRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     K E NIEGYP++ F++L  + KP Q+TLVPD P Q+TS+ GWD   NQ+ L  
Sbjct: 62  LL-----KTEFNIEGYPSKEFIDLVLKVKPHQVTLVPDAPDQITSNAGWDTKTNQSFLAD 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +    N G R S+F  G   E    AAK  GAD +ELYT PY + Y    +  +     
Sbjct: 117 LMETFGNAGIRTSIFV-GTDAEMIEYAAK-AGADRVELYTEPYASLYLESPEAAV--APF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A++ + + + +NAGHDL++ N+     +IP++ E+S+GHA    AL  G+++ +  +
Sbjct: 173 VEAAKITRSLGMGLNAGHDLSLVNLKYFHESIPWLDEVSIGHALICDALYLGLEKTIKEY 232

Query: 243 R 243
           +
Sbjct: 233 K 233


>gi|21229490|ref|NP_635407.1| pyridoxine 5'-phosphate synthase [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66766364|ref|YP_241126.1| pyridoxine 5'-phosphate synthase [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188989410|ref|YP_001901420.1| pyridoxine 5'-phosphate synthase [Xanthomonas campestris pv.
           campestris str. B100]
 gi|23821925|sp|Q8PEG8|PDXJ_XANCP RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|81307642|sp|Q4V0R7|PDXJ_XANC8 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|229485649|sp|B0RLF1|PDXJ_XANCB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|21110951|gb|AAM39331.1| pyridoxal phosphate biosynthetic protein [Xanthomonas campestris
           pv. campestris str. ATCC 33913]
 gi|66571696|gb|AAY47106.1| pyridoxal phosphate biosynthetic protein [Xanthomonas campestris
           pv. campestris str. 8004]
 gi|167731170|emb|CAP49342.1| pyridoxal phosphate biosynthetic protein [Xanthomonas campestris
           pv. campestris]
          Length = 256

 Score =  179 bits (454), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 143/249 (57%), Gaps = 12/249 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MST +SVN+N +AVLRN R    P++V   +  + +GA G+TVHPRPDQRHIR  D+  +
Sbjct: 1   MSTHLSVNVNKIAVLRNSRGGQDPDVVQAARSCIAAGAHGITVHPRPDQRHIRADDVYAL 60

Query: 61  RRLIDEQFPKAELNIEGYP-------NETFLNLCERYKPEQITLVPDDPHQLTSDHGWDF 113
             L   +    E NIEG P           L LC   +P+Q+TLVPD   QLTSDHG DF
Sbjct: 61  STLT--RMHGVEFNIEGNPFAPPRAGYPGLLELCRATRPQQVTLVPDGDGQLTSDHGVDF 118

Query: 114 LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ 173
            ++ A L   +A    LG R+SLF D  GN    QAA L GAD IELYTGPY   +++ Q
Sbjct: 119 ARDGARLAPLIAAFKTLGCRVSLFVDA-GNPEIAQAAAL-GADRIELYTGPYAEAHHHGQ 176

Query: 174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALEC 233
            +   L   A  A+ A    L INAGHDL+  N+ + +  +P + E+S+GHA    AL  
Sbjct: 177 SQP-SLALFADAARRAHAAGLGINAGHDLSQHNLADFLAGVPDVLEVSIGHALVGEALYQ 235

Query: 234 GVKEAVFCF 242
           G++  V  +
Sbjct: 236 GLEPTVRAY 244


>gi|289667638|ref|ZP_06488713.1| pyridoxine 5'-phosphate synthase [Xanthomonas campestris pv.
           musacearum NCPPB4381]
          Length = 255

 Score =  179 bits (453), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 143/249 (57%), Gaps = 12/249 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+T +SVN+N +AVLRN R    P++V   +  + +GA G+TVHPRP+QRHIR  D+  +
Sbjct: 1   MTTRLSVNVNKIAVLRNSRGGTDPDVVQAARTCIAAGAHGITVHPRPNQRHIRADDVFAL 60

Query: 61  RRLIDEQFPKAELNIEGYPNE-------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDF 113
             L        E NIEG P           L LC   +PEQITLVPD   QLTSDHG+DF
Sbjct: 61  SALTRAH--AVEFNIEGNPFAPPRAGYPGLLELCRATRPEQITLVPDGDGQLTSDHGFDF 118

Query: 114 LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ 173
            Q+   L   +A    +GSR+SLF D  GN    +AA L GAD IELYTGPY   + + Q
Sbjct: 119 AQDTRQLASLIAAFKAVGSRVSLFVDA-GNPDIARAAAL-GADRIELYTGPYAYAHASGQ 176

Query: 174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALEC 233
            +   L   A  AQ A    L INAGHDL+  N+ + +  +P + E+S+GHA  + AL  
Sbjct: 177 ADTA-LALFADAAQRASAAGLGINAGHDLSQANLGDFLATVPGVLEVSIGHALISEALYQ 235

Query: 234 GVKEAVFCF 242
           G+  +V  +
Sbjct: 236 GLDASVRAY 244


>gi|289662272|ref|ZP_06483853.1| pyridoxine 5'-phosphate synthase [Xanthomonas campestris pv.
           vasculorum NCPPB702]
          Length = 255

 Score =  179 bits (453), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 143/249 (57%), Gaps = 12/249 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+T +SVN+N +AVLRN R    P++V   +  + +GA G+TVHPRP+QRHIR  D+  +
Sbjct: 1   MTTRLSVNVNKIAVLRNSRGGTDPDVVQAARTCIAAGAHGITVHPRPNQRHIRADDVFAL 60

Query: 61  RRLIDEQFPKAELNIEGYPNE-------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDF 113
             L        E NIEG P           L LC   +PEQITLVPD   QLTSDHG+DF
Sbjct: 61  SALTRAH--AVEFNIEGNPFAPPRAGYPGLLELCRATRPEQITLVPDGDGQLTSDHGFDF 118

Query: 114 LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ 173
            Q+   L   +A    +GSR+SLF D  GN    +AA L GAD IELYTGPY   + + Q
Sbjct: 119 AQDTRQLAALIAAFKAVGSRVSLFVDA-GNPDIARAAAL-GADRIELYTGPYAYAHASGQ 176

Query: 174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALEC 233
            +   L   A  AQ A    L INAGHDL+  N+ + +  +P + E+S+GHA  + AL  
Sbjct: 177 ADTA-LALFADAAQRASAAGLGINAGHDLSQANLGDFLATVPGVLEVSIGHALISEALYQ 235

Query: 234 GVKEAVFCF 242
           G+  +V  +
Sbjct: 236 GLDASVRAY 244


>gi|326798656|ref|YP_004316475.1| pyridoxine 5'-phosphate synthase [Sphingobacterium sp. 21]
 gi|326549420|gb|ADZ77805.1| Pyridoxine 5'-phosphate synthase [Sphingobacterium sp. 21]
          Length = 238

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 101/243 (41%), Positives = 146/243 (60%), Gaps = 12/243 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    PN++ +     + GA G+TVHPRPD+RHIRY D+ +++ 
Sbjct: 2   TKLSVNINKVATLRNSRGGNNPNVLQVALDCEKFGAQGITVHPRPDERHIRYQDVYDLKA 61

Query: 63  LIDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            I  +F     NIEG   E  F++L    KP Q+TLVPD+  Q+TS+HGWD + NQ+ L 
Sbjct: 62  AITTEF-----NIEGNCREKKFVDLVLANKPTQVTLVPDEQGQITSNHGWDTIANQSYLK 116

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGA-CYNNPQQERIFLN 180
           +  A   + G R+S+F D   +   ++AA  TG D IELYT  Y    Y NP +    + 
Sbjct: 117 EMSALFKDAGIRVSIFVD--PDPKMVEAAASTGTDRIELYTEAYATNYYKNPAEA---VQ 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
             A  A+LA ++ L +NAGHDL + N+    + IP++ E+S+GHA  A AL  G++E + 
Sbjct: 172 PYAEAAKLAHELGLGLNAGHDLDLHNLQYFRSQIPHLLEVSIGHALIADALYLGLEETIK 231

Query: 241 CFR 243
            +R
Sbjct: 232 RYR 234


>gi|298207453|ref|YP_003715632.1| putative pyridoxine biosynthesis protein [Croceibacter atlanticus
           HTCC2559]
 gi|83850089|gb|EAP87957.1| putative pyridoxine biosynthesis protein [Croceibacter atlanticus
           HTCC2559]
          Length = 237

 Score =  178 bits (452), Expect = 6e-43,   Method: Compositional matrix adjust.
 Identities = 92/244 (37%), Positives = 143/244 (58%), Gaps = 9/244 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R   +PN+V + K   + G  G+TVHPRPD+RHIRY D+ ++  
Sbjct: 2   TKLSVNINKIATLRNSRGGNYPNVVQVAKDVERFGGQGITVHPRPDERHIRYQDVRDLAP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEG PN  F++L  + KP Q+TLVPD    +TS+ GWD ++++  LT+
Sbjct: 62  IVTTEF-----NIEGNPNPKFIDLVLQNKPTQVTLVPDAVDAITSNAGWDTVKHKDFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            ++   N G R S+F D       ++ A   GAD IELYT  +   +    +E +     
Sbjct: 117 IISEFKNNGIRTSVFVDPVA--AMIEGASKIGADRIELYTEAFADKFTISPEEAV--RPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
             +A LA  ++L INAGHDL+++NI      +PY+ E+S+GHA    +L  G++  +  +
Sbjct: 173 TESAMLAHSLNLGINAGHDLSLKNIAYFKEKVPYLLEVSIGHALIGESLYLGLETVISNY 232

Query: 243 RRAC 246
            +A 
Sbjct: 233 LKAL 236


>gi|154493589|ref|ZP_02032909.1| hypothetical protein PARMER_02929 [Parabacteroides merdae ATCC
           43184]
 gi|154086799|gb|EDN85844.1| hypothetical protein PARMER_02929 [Parabacteroides merdae ATCC
           43184]
          Length = 238

 Score =  177 bits (450), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 146/244 (59%), Gaps = 13/244 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA +RN R    PN++ +       GA G+TVHPRPD+RHIRY+D+  ++ 
Sbjct: 2   TNLSVNINKVATIRNARGGNVPNVLKVALDCETFGAQGITVHPRPDERHIRYSDVYALKP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            I     K E NIEGYP E F++L  + KP Q+TLVPD P  +TS+ GWD   +   L++
Sbjct: 62  EI-----KTEFNIEGYPCEKFIDLVLKVKPTQVTLVPDAPDAITSNAGWDVKAHFDQLSE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI--FLN 180
            V    + G R S+F  G   E+   AAK TG D IELYT PY   Y   ++E I  F++
Sbjct: 117 LVETFTSHGIRTSIFV-GTDLENIELAAK-TGTDRIELYTEPYATLYPVNREEAIAPFIS 174

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
                A LA+ + L INAGHDL+++N+      IP + E+S+GHA  + AL  G+KE + 
Sbjct: 175 ----AAGLAKNLGLGINAGHDLSLENLAYFHQNIPGLDEVSIGHALISDALYYGLKETIR 230

Query: 241 CFRR 244
            ++ 
Sbjct: 231 LYKE 234


>gi|330996644|ref|ZP_08320522.1| pyridoxine 5'-phosphate synthase [Paraprevotella xylaniphila YIT
           11841]
 gi|329572716|gb|EGG54349.1| pyridoxine 5'-phosphate synthase [Paraprevotella xylaniphila YIT
           11841]
          Length = 237

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 92/237 (38%), Positives = 140/237 (59%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    P++V +     + GA G+TVHPRPD+RHIRY D+ +++ 
Sbjct: 2   TKLSVNINKVATLRNARGGNNPDVVQVALDCEKFGAQGITVHPRPDERHIRYQDVYDLKA 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     + E NIEG P + F +L  + +P Q+TLVPD P Q+TS+ GWD  +N + LT+
Sbjct: 62  VL-----RTEFNIEGNPVDKFNDLVLKVRPTQVTLVPDAPDQITSNTGWDTKKNLSFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +      G R S+F   N     ++ A   GAD +ELYT PY + Y    ++ +     
Sbjct: 117 IIGEFKEKGIRTSVFV--NAEAEMVEYAAKAGADRVELYTEPYASAYAGSPEDAV--RPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A+ A+ + L +NAGHDL+++N+  +   I +I E+S+GHA    AL  G++E V
Sbjct: 173 VEAARTARGLGLGLNAGHDLSLENLKYMHEQIGWIDEVSIGHALICDALYLGLEETV 229


>gi|319792228|ref|YP_004153868.1| pyridoxal phosphate biosynthetic protein pdxj [Variovorax paradoxus
           EPS]
 gi|315594691|gb|ADU35757.1| pyridoxal phosphate biosynthetic protein PdxJ [Variovorax paradoxus
           EPS]
          Length = 262

 Score =  177 bits (448), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 101/251 (40%), Positives = 140/251 (55%), Gaps = 7/251 (2%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +TS+SVNLN VA++RN R+L  P+++      L +GA G+TVHPRPD RHIR  D+ ++ 
Sbjct: 11  TTSLSVNLNKVALVRNTRHLGIPSVLTAANACLAAGAQGITVHPRPDARHIRAHDVSDLS 70

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+ + +P  E NIEG P    ++     +P Q T VPD   Q TSDHGW F  +   L 
Sbjct: 71  ALLAKDWPGIEFNIEGNPFHNLMDFVRELRPHQATFVPDSESQSTSDHGWSFPDDAERLR 130

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             +A    LG R+SLF D       + A K  GAD +ELYT  Y A      +E + L +
Sbjct: 131 PLIAEAKALGVRVSLFMD--PIPEMMAAVKAVGADRVELYTEGYAASRGTADEEAV-LAR 187

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG----VKE 237
              +A+ AQ   L +NAGHDL+  N+   + A+  + E+S+GHAF A ALE G     +E
Sbjct: 188 YVESARAAQAAGLGVNAGHDLSRDNLTAFLRAVRGVHEVSIGHAFVADALELGYTATTRE 247

Query: 238 AVFCFRRACGQ 248
            + C   A  Q
Sbjct: 248 YLRCITEAQQQ 258


>gi|291515263|emb|CBK64473.1| pyridoxine 5'-phosphate synthase [Alistipes shahii WAL 8301]
          Length = 238

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 102/243 (41%), Positives = 141/243 (58%), Gaps = 11/243 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +AV+RN R    P++V       + GA G+TVHPRPD RHIRY D+ +++R
Sbjct: 2   TKLSVNINKIAVVRNSRGGNLPDVVRAALDIERFGAEGITVHPRPDARHIRYDDVRDLKR 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +       ELNIEG P   F++L     P Q+TLVPD    +TS+ GWD L N+A LT 
Sbjct: 62  AL-----TTELNIEGNPIPGFIDLVLEVVPAQVTLVPDAHDAITSNAGWDTLANRAFLTD 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY-NNPQQERIFLNK 181
             AR H  G R+S+F D       +  AK  GAD +ELYT  Y   Y ++PQ  R     
Sbjct: 117 VTARFHAKGIRVSVFVDPVA--EMVAGAKACGADRVELYTEAYAREYPDDPQ--RAVAPY 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           LA  A+ A++  L +NAGHDL+++N+      IP+  E+S+GHA    AL  G++  V  
Sbjct: 173 LA-AAEEARRQGLGLNAGHDLSLENLRWFAERIPWTDEVSIGHALICDALYYGLENTVQL 231

Query: 242 FRR 244
           +RR
Sbjct: 232 YRR 234


>gi|332881839|ref|ZP_08449482.1| pyridoxine 5'-phosphate synthase [Capnocytophaga sp. oral taxon 329
           str. F0087]
 gi|332680183|gb|EGJ53137.1| pyridoxine 5'-phosphate synthase [Capnocytophaga sp. oral taxon 329
           str. F0087]
          Length = 237

 Score =  176 bits (447), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 140/237 (59%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    P++V +     + GA G+TVHPRPD+RHIRY D+ +++ 
Sbjct: 2   TKLSVNINKVATLRNARGGNNPDVVQVALDCEKFGAQGITVHPRPDERHIRYQDVYDLKA 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     + E NIEG P + F +L  + +P Q+TLVPD P Q+TS+ GWD  +N + LT+
Sbjct: 62  VL-----RTEFNIEGNPVDKFNDLVLKVRPTQVTLVPDAPDQITSNAGWDTKKNLSFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +      G R S+F   N     ++ A   GAD +ELYT PY + Y    +  + +   
Sbjct: 117 IIGEFKEKGIRTSVFV--NAEAEMVEYAAKAGADRVELYTEPYASAYAGSPE--VAVRPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A+ A+ + L +NAGHDL+++N+  +   I +I E+S+GHA    AL  G++E +
Sbjct: 173 VEAARTARSLGLGLNAGHDLSLENLKYMHEQIGWIDEVSIGHALICDALYLGLEETI 229


>gi|21240786|ref|NP_640368.1| pyridoxine 5'-phosphate synthase [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|23821928|sp|Q8PRF1|PDXJ_XANAC RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|21106051|gb|AAM34904.1| pyridoxal phosphate biosynthetic protein [Xanthomonas axonopodis
           pv. citri str. 306]
          Length = 255

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 145/249 (58%), Gaps = 12/249 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+T +SVN+N +AVLRN R    P++V   +  + +GA G+TVHPRPDQRHIR  D+  +
Sbjct: 1   MTTQLSVNVNKIAVLRNSRGGADPDVVQAARACIAAGAHGITVHPRPDQRHIRADDVLAL 60

Query: 61  RRLIDEQFPKAELNIEGYPNE-------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDF 113
             L  E     E NIEG P           L LC   +PEQ+TLVPD   QLTSDHG+DF
Sbjct: 61  SALTREH--GVEFNIEGNPFAPPRGDYPGLLQLCRATRPEQVTLVPDGDGQLTSDHGFDF 118

Query: 114 LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ 173
            Q+   L + +     LGSR+SLF D  GN    +AA L GAD IELYTGPY   + + Q
Sbjct: 119 AQDTVQLAELITAFKRLGSRVSLFVDA-GNPDIARAATL-GADRIELYTGPYAHAHASGQ 176

Query: 174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALEC 233
            +   L   A  AQ A    L INAGHDL+  N+ + + A+P + E+S+GHA  + AL  
Sbjct: 177 ADTA-LALFANAAQRASAAGLGINAGHDLSQANLGDFLAAVPGVLEVSIGHALISEALYQ 235

Query: 234 GVKEAVFCF 242
           G+  +V  +
Sbjct: 236 GLDASVRAY 244


>gi|284039837|ref|YP_003389767.1| pyridoxal phosphate biosynthetic protein PdxJ [Spirosoma linguale
           DSM 74]
 gi|283819130|gb|ADB40968.1| pyridoxal phosphate biosynthetic protein PdxJ [Spirosoma linguale
           DSM 74]
          Length = 245

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/242 (38%), Positives = 141/242 (58%), Gaps = 9/242 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A +RN R    P+LV +     + GA G+TVHPRPD+RHIRY D+ ++  
Sbjct: 2   TRLSVNINKIATIRNARGGNNPDLVKVALDCERFGAQGITVHPRPDERHIRYQDVLDLHE 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEG P+E F+ L +R KP Q+TLVPD    +TS+ GWD +++   L K
Sbjct: 62  VVTTEF-----NIEGNPDERFIELVKRVKPAQVTLVPDAVDAITSNAGWDTIRHADHLRK 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V      G R+S+F D   +E  ++ AK  G D IELYT PY A Y   ++  +     
Sbjct: 117 LVDTFKADGIRVSIFVD--ADERMVEGAKAVGTDRIELYTEPYAAHYAENREAAV--APF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQ A ++ L +NAGHDL+++N+      +P + E+S+GHA    AL  G++  +  +
Sbjct: 173 VRAAQRANQLGLGLNAGHDLSLENLRFFDEQVPGLEEVSIGHALVCDALYFGLENTIQMY 232

Query: 243 RR 244
            R
Sbjct: 233 LR 234


>gi|319899978|ref|YP_004159706.1| pyridoxine 5'-phosphate synthase [Bacteroides helcogenes P 36-108]
 gi|319415009|gb|ADV42120.1| pyridoxine 5'-phosphate synthase [Bacteroides helcogenes P 36-108]
          Length = 237

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 139/239 (58%), Gaps = 13/239 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    P++V +       GA G+TVHPRPD+RHIR  D+ ++R 
Sbjct: 2   TRLSVNINKVATLRNARGGDMPDVVKVALDCENYGADGITVHPRPDERHIRQNDVYDLRP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+     + E NIEGYP   F++L  + KP Q+TLVPD P QLTS+ GWD   +   L++
Sbjct: 62  LL-----RTEFNIEGYPAPEFIDLVLKVKPHQVTLVPDSPTQLTSNAGWDTKTHFDFLSE 116

Query: 123 TVARLHNLGSRISLFA--DGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            +   ++ G R S+F   D +  EH+ +A    GAD +ELYT PY   Y  P+     + 
Sbjct: 117 VLDEFNDAGIRTSVFVSTDADMIEHAAKA----GADRVELYTEPYATVY--PKDREAAVA 170

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                A++ + + L +NAGHDL++ N+      IP++ E+S+GHA    AL  G++  +
Sbjct: 171 PFVEAAKVTRSLGLGLNAGHDLSLVNLNYFYQNIPWLDEVSIGHALICDALYLGLERTI 229


>gi|91216693|ref|ZP_01253658.1| pyridoxal phosphate biosynthetic protein [Psychroflexus torquis
           ATCC 700755]
 gi|91185162|gb|EAS71540.1| pyridoxal phosphate biosynthetic protein [Psychroflexus torquis
           ATCC 700755]
          Length = 237

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 141/242 (58%), Gaps = 13/242 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +SVN+N +A LRN R    PN+V   K     GA G+TVHPRPD+RHIRY D+ E+ ++I
Sbjct: 4   LSVNINKIATLRNARGGDTPNVVESAKNLESFGAQGITVHPRPDERHIRYADVNELTKVI 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K E NIEG PN+ F+ L    KP Q+TLVPD    LTS+ GWD ++++  L + +
Sbjct: 64  -----KTEFNIEGNPNQKFIALVLDAKPAQVTLVPDGEDVLTSNAGWDTIKHKDFLKEVI 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI--FLNKL 182
           +     G R S+F D   +   +Q A   GAD +EL+T  Y   Y   +++ I  +L   
Sbjct: 119 SEFKAHGIRTSVFVD--PSLQMIQGAAEVGADRVELFTEAYAQGYIKDKEKAIAPYLK-- 174

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+ A+ + L INAGHDL+++NI      IP++ E+S+GHA  + AL  G++  V  +
Sbjct: 175 --CAEEAKSLGLGINAGHDLSLENIEYFAQTIPFLDEVSIGHALISEALYDGLEVVVKSY 232

Query: 243 RR 244
            +
Sbjct: 233 LK 234


>gi|86130760|ref|ZP_01049359.1| pyridoxine 5'-phosphate synthase [Dokdonia donghaensis MED134]
 gi|85818171|gb|EAQ39331.1| pyridoxine 5'-phosphate synthase [Dokdonia donghaensis MED134]
          Length = 240

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 98/240 (40%), Positives = 136/240 (56%), Gaps = 9/240 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    P+L+ +     + GA G+T+HPRPD+RHIRY D    R 
Sbjct: 5   TKLSVNINKVATLRNARGGNVPDLLKVASDLEKMGAQGITIHPRPDERHIRYQDA---RD 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+D      E NIEG P + F++L    KP Q+TLVPD    +TS+ GWD ++++  L +
Sbjct: 62  LVD--VVTTEFNIEGNPIQKFIDLVLETKPTQVTLVPDAVDAITSNAGWDTIKHKDFLKE 119

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A   N G R S+F D       ++ AK TGAD IELYT  Y   Y   + E I     
Sbjct: 120 VIAEFQNAGIRTSIFVD--PVLEMIEGAKETGADRIELYTEAYADGYTENKDEAI--KPY 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A LA  + + INAGHDL++ N+    N+IP + E+S+GHA  A +L  G +  V  +
Sbjct: 176 IAAAFLASDLGIGINAGHDLSLDNVAYFHNSIPDLLEVSIGHALMAESLYLGFETVVASY 235


>gi|228473543|ref|ZP_04058296.1| pyridoxine 5'-phosphate synthase [Capnocytophaga gingivalis ATCC
           33624]
 gi|228275150|gb|EEK13953.1| pyridoxine 5'-phosphate synthase [Capnocytophaga gingivalis ATCC
           33624]
          Length = 237

 Score =  176 bits (446), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 138/240 (57%), Gaps = 9/240 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PNL+ +       GA G+T+HPRPD+RHIRY D  +++ 
Sbjct: 2   TKLSVNINKIATLRNSRGGNVPNLLQVATDLQDFGAEGITIHPRPDERHIRYQDALDLKE 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  ++     NIEG P   F++L  + KP Q+TLVPD    +TS+ GWD L + A LT+
Sbjct: 62  IVHTEY-----NIEGNPIPKFVDLVLKVKPTQVTLVPDAEDAITSNAGWDTLTHGAYLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VA     G R SLF D    E  ++AA  TG D +ELYT  Y   Y    +E I     
Sbjct: 117 IVAEFKRHGIRTSLFVD--PVERMVEAAAKTGTDRVELYTEAYAREYARGNKEGI--RPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A++AQK+ L +NAGHDL++ N+      IP + E+S+GHA  + AL  G++  V  +
Sbjct: 173 VQAAEVAQKVGLGLNAGHDLSLDNLQYFKEQIPGLLEVSIGHALISEALYLGLQNVVSMY 232


>gi|312888559|ref|ZP_07748128.1| pyridoxine 5'-phosphate synthase [Mucilaginibacter paludis DSM
           18603]
 gi|311298873|gb|EFQ75973.1| pyridoxine 5'-phosphate synthase [Mucilaginibacter paludis DSM
           18603]
          Length = 239

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 96/243 (39%), Positives = 143/243 (58%), Gaps = 10/243 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+L+ +     + GA G+TVHPRPD+RHIRY D+ ++++
Sbjct: 2   TRLSVNINKIATLRNSRGGNNPDLIKVALDCERFGAEGITVHPRPDERHIRYQDVDDLKK 61

Query: 63  LIDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            I     K E NIEG P E +F+ L    +P Q+TLVPD   Q+TS+HGWD + NQ+ L 
Sbjct: 62  TI-----KTEFNIEGNPVEDSFMKLVLNNRPAQVTLVPDALGQITSNHGWDTIANQSYLK 116

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + ++     G R+S+F D       ++A   TG + IELYT  Y + Y+  +++ I    
Sbjct: 117 EVISEFQLAGIRVSIFVDPVA--EMIEATATTGTNRIELYTEAYASGYHADREKAI--AP 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
               AQ+AQK+ L +NAGHDL + N+      IP + E+S+GHA    AL  G++  +  
Sbjct: 173 YVEAAQIAQKLGLGLNAGHDLDLVNLQYFAQNIPGLLEVSIGHALVCDALYYGLENTIQM 232

Query: 242 FRR 244
           + R
Sbjct: 233 YLR 235


>gi|78045569|ref|YP_361744.1| pyridoxine 5'-phosphate synthase [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|91207576|sp|Q3BZR9|PDXJ_XANC5 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|78033999|emb|CAJ21644.1| pyridoxal phosphate biosynthetic protein [Xanthomonas campestris
           pv. vesicatoria str. 85-10]
          Length = 255

 Score =  176 bits (445), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 110/249 (44%), Positives = 145/249 (58%), Gaps = 12/249 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+T +SVN+N +AVLRN R    P++V   +  + +GA G+TVHPRPDQRHIR  D+  +
Sbjct: 1   MTTQLSVNVNKIAVLRNSRGGADPDVVQAARACIAAGAHGITVHPRPDQRHIRADDVLAL 60

Query: 61  RRLIDEQFPKAELNIEGYPNE-------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDF 113
             L   Q    E NIEG P           L LC   +P+QITLVPD   QLTSDHG+DF
Sbjct: 61  SALTRAQ--AVEFNIEGNPFAPPRAGYPGLLELCRATRPQQITLVPDGDGQLTSDHGFDF 118

Query: 114 LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ 173
            Q+   L + +     LGSR+SLF D  GN    +AA L GAD IELYTGPY   + + Q
Sbjct: 119 AQDTTQLAELITAFKQLGSRVSLFVDA-GNPDIARAAAL-GADRIELYTGPYAHAHASGQ 176

Query: 174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALEC 233
            +   L   A  AQ A    L INAGHDL+  N+ + + A+P + E+S+GHA  + AL  
Sbjct: 177 ADAT-LALFADAAQRASAAGLGINAGHDLSQANLGDFLAAVPGVLEVSIGHALISEALYQ 235

Query: 234 GVKEAVFCF 242
           G+  +V  +
Sbjct: 236 GLDASVRAY 244


>gi|262340807|ref|YP_003283662.1| pyridoxal phosphate biosynthetic protein [Blattabacterium sp.
           (Blattella germanica) str. Bge]
 gi|262272144|gb|ACY40052.1| pyridoxal phosphate biosynthetic protein [Blattabacterium sp.
           (Blattella germanica) str. Bge]
          Length = 249

 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 100/250 (40%), Positives = 146/250 (58%), Gaps = 9/250 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVNLN +A LRN R    P+L+ +     + G  G+T+HPRPD+RHI Y D+ +I  
Sbjct: 2   TKLSVNLNKIATLRNARGGDIPSLLQVAIDVQKFGCQGITIHPRPDERHITYQDVYDIHS 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           +I     K ELNIEG P + F+ L    KP+Q+TLVPD    +TS+ GW+ + +   LT+
Sbjct: 62  VI-----KTELNIEGRPTDKFMELVLNVKPDQVTLVPDQDDAITSNSGWNTISHCNFLTQ 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            + +L N G R S+F D N  +    AAK TGAD IELYTG +   Y   ++E   +N  
Sbjct: 117 KIKKLKNHGIRTSIFLDPNP-KFVAYAAK-TGADRIELYTGNFSIGY--ARKEWNSINPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
             TA+ A    + +NAGHDL + NI  LI  IP ++E+S+GHA  + AL  G++  +  +
Sbjct: 173 IKTAKEAITHHMLVNAGHDLNLDNISFLIKKIPNLAEVSIGHALISEALYMGLENTIQSY 232

Query: 243 RRACGQHLDN 252
            +   ++  N
Sbjct: 233 LKRIHEYQRN 242


>gi|325954919|ref|YP_004238579.1| pyridoxine 5'-phosphate synthase [Weeksella virosa DSM 16922]
 gi|323437537|gb|ADX68001.1| Pyridoxine 5'-phosphate synthase [Weeksella virosa DSM 16922]
          Length = 246

 Score =  175 bits (443), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 99/242 (40%), Positives = 140/242 (57%), Gaps = 9/242 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A +RN R    PN+V       Q G  G+TVHPRPD+RHIRY D+ +++ 
Sbjct: 2   TKLSVNINKIATIRNARGGNMPNVVEAAIKIQQFGGQGITVHPRPDERHIRYQDVLDLQP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           +I  +F     NIEG P + F++L  + KPEQ+TLVPD    +TS+ GWD +++   L++
Sbjct: 62  IITTEF-----NIEGKPIDRFMDLVLQVKPEQVTLVPDAEDAITSNAGWDTIKHFDYLSE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +  L   G R S+F D   N   + +A  TG D IELYT  +   Y     + I  +  
Sbjct: 117 VIDVLKKAGIRTSIFLD--PNPKLIDSAAKTGTDRIELYTEEFATEYAKGNLDCI--HPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
             TA LA K  L +NAGHDL++ NI   I  IP I E+S+GHA  + AL  G++  V C+
Sbjct: 173 RETALLAIKNGLAVNAGHDLSLDNIQYFIEQIPQIEEVSIGHALISEALYMGLENTVQCY 232

Query: 243 RR 244
            R
Sbjct: 233 LR 234


>gi|120434586|ref|YP_860278.1| pyridoxine 5'-phosphate synthase [Gramella forsetii KT0803]
 gi|166219092|sp|A0LXW0|PDXJ_GRAFK RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|117576736|emb|CAL65205.1| pyridoxal phosphate biosynthesis protein [Gramella forsetii KT0803]
          Length = 237

 Score =  174 bits (441), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 140/237 (59%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PN++   K     GA G+TVHPRPD+RHIRY D  E++ 
Sbjct: 2   TKLSVNINKIATLRNARGGDVPNVLEAAKNIESFGAEGITVHPRPDERHIRYADARELKP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           +++ +F     NIEG P + F++L    KP Q+TLVPD  + +TSD GWD ++++  L +
Sbjct: 62  VLNTEF-----NIEGKPIQQFIDLVLEVKPAQVTLVPDAENAITSDSGWDTVKHRDYLKE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A     G R S+F D    +  ++ A  TG+D IELYT  +   +       +     
Sbjct: 117 VIAEFKANGIRTSIFVD--PVKKMIEGAAETGSDRIELYTESFAVDFEKGNSNAV--KPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           A  A++A ++ L INAGHDL+++NI      +PY+ E+S+GHA  + AL  G+++ +
Sbjct: 173 AECAKIAHELGLGINAGHDLSLKNINYFKENVPYLDEVSIGHALISEALYLGLEKTI 229


>gi|110639772|ref|YP_679982.1| pyridoxine 5'-phosphate synthase [Cytophaga hutchinsonii ATCC
           33406]
 gi|122966509|sp|Q11PM4|PDXJ_CYTH3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|110282453|gb|ABG60639.1| pyridoxine 5'-phosphate synthase [Cytophaga hutchinsonii ATCC
           33406]
          Length = 238

 Score =  174 bits (440), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 143/242 (59%), Gaps = 9/242 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A +RN R    P+L+ +     + GA G+T+HPRPD+RHIRY D  ++++
Sbjct: 2   TRLSVNINKIATIRNARGGNNPDLLKVALDCERFGAEGITIHPRPDERHIRYQDAYDLKK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEG P   F+ L E  KP+Q+TLVPD  + +TS+ GWD + +Q+ LT+
Sbjct: 62  IVTTEF-----NIEGNPEGEFIALVENIKPDQVTLVPDAVNAITSNAGWDTITHQSFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            ++     G R+S+F D       ++ A   GAD +ELYT PY   +++ ++  I   + 
Sbjct: 117 IISNFKKAGIRVSVFVD--PVTAMVEGAAKAGADRVELYTEPYATSFHSNKEAAI--KEY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A  A+ + L INAGHDL + N+  L   IP++ E+S+GHA    AL  G++  +  +
Sbjct: 173 IEAAAAAKSLGLGINAGHDLDLFNLNYLKKNIPFLDEVSIGHALICDALYYGLENTIQLY 232

Query: 243 RR 244
            R
Sbjct: 233 LR 234


>gi|332519952|ref|ZP_08396416.1| pyridoxal phosphate biosynthetic protein PdxJ [Lacinutrix algicola
           5H-3-7-4]
 gi|332044511|gb|EGI80705.1| pyridoxal phosphate biosynthetic protein PdxJ [Lacinutrix algicola
           5H-3-7-4]
          Length = 237

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/239 (38%), Positives = 140/239 (58%), Gaps = 13/239 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PNL+   K   + GA G+T+HPRPD+RHIRY D  +++ 
Sbjct: 2   TKLSVNINKIATLRNARGGDTPNLLQFAKDVQRFGAQGVTIHPRPDERHIRYQDARDLKS 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           +++ ++     NIEG PN  F++L    KP Q+TLVPD    +TSD GWD ++++  LT+
Sbjct: 62  IVNTEY-----NIEGNPNSKFIDLVLEVKPTQVTLVPDAVDAITSDAGWDTIKHKIFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFLN 180
            ++   + G R S+F D    +  ++ AK TG D +ELYT  +   +   N    + + +
Sbjct: 117 VISEFKSNGIRTSIFVDPVLAQ--IEGAKATGTDRVELYTEAFAHQFGLGNTNAVKPYTD 174

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                A LA  +DL +NAGHDL++ NI      IP + E+S+GHA  + +L  GV+  V
Sbjct: 175 ----CAVLANTLDLGVNAGHDLSLDNIKFFKENIPNLLEVSIGHALVSESLYLGVENVV 229


>gi|332878834|ref|ZP_08446549.1| pyridoxine 5'-phosphate synthase [Capnocytophaga sp. oral taxon 329
           str. F0087]
 gi|332683185|gb|EGJ56067.1| pyridoxine 5'-phosphate synthase [Capnocytophaga sp. oral taxon 329
           str. F0087]
          Length = 238

 Score =  173 bits (438), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 99/245 (40%), Positives = 142/245 (57%), Gaps = 19/245 (7%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+L+ + K A Q GA G+T+HPRPD+RHIRY D  ++ +
Sbjct: 2   TKLSVNINKIATLRNARGGNMPDLLQVAKDAQQFGAEGITIHPRPDERHIRYQDAFDLLK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  ++     NIEG P   F++L  + KP Q+TLVPD    +TS+ GWD ++++  LT+
Sbjct: 62  VVTTEY-----NIEGNPIPKFVDLVLQVKPTQVTLVPDAEDAITSNAGWDTVKHKDFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VA     G R SLF D    E  + AA  TGAD +ELYT  Y        +E    NK 
Sbjct: 117 VVAEFKRNGIRTSLFVD--PVEAMVTAAAATGADRVELYTEGYA-------REYALGNKG 167

Query: 183 AI-----TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKE 237
           AI      AQ A+K+ L +NAGHDL++ N+      IP + E+S+GHA    AL  G++ 
Sbjct: 168 AIAPYVRAAQEAEKVGLGLNAGHDLSLDNVQYFRRQIPNLLEVSIGHALICEALYLGLEN 227

Query: 238 AVFCF 242
            +  +
Sbjct: 228 VIQLY 232


>gi|256819878|ref|YP_003141157.1| pyridoxine 5'-phosphate synthase [Capnocytophaga ochracea DSM 7271]
 gi|256581461|gb|ACU92596.1| pyridoxal phosphate biosynthetic protein PdxJ [Capnocytophaga
           ochracea DSM 7271]
          Length = 238

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 141/241 (58%), Gaps = 11/241 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+L+ + K   Q GA G+T+HPRPD+RHIRY D  ++ +
Sbjct: 2   TKLSVNINKIATLRNARGGNIPDLLQVAKDVQQFGAEGITIHPRPDERHIRYQDAFDLLK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++       E NIEG P   F++L  + KP Q+TLVPD    +TS+ GWD +++++ LT+
Sbjct: 62  VV-----TTEYNIEGNPIPKFIDLVLQVKPTQVTLVPDAEDAITSNAGWDTVKHKSFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V      G R SLF D    E  + A+  TGAD +ELYT  Y   Y    + +I     
Sbjct: 117 VVTEFKRNGIRTSLFVD--PVEAMVTASATTGADRVELYTERYAREYARGDKTQI---AP 171

Query: 183 AITAQL-AQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
            I A L AQK+ L +NAGHDL++ N+    + IP +SE+S+GHA    AL  G++  +  
Sbjct: 172 YIKAALEAQKVGLGLNAGHDLSLDNVKYFKDNIPNLSEVSIGHALICEALYLGLENVIQL 231

Query: 242 F 242
           +
Sbjct: 232 Y 232


>gi|239814412|ref|YP_002943322.1| pyridoxine 5'-phosphate synthase [Variovorax paradoxus S110]
 gi|239800989|gb|ACS18056.1| Pyridoxine 5'-phosphate synthase [Variovorax paradoxus S110]
          Length = 254

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 103/248 (41%), Positives = 143/248 (57%), Gaps = 7/248 (2%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +TS+SVNLN VA++RN R+L  P+++   K  L +GA G+TVHPRPD+RHIR  D+ ++ 
Sbjct: 9   TTSLSVNLNKVALVRNTRHLGIPSVLTAAKACLAAGAQGITVHPRPDERHIRPHDVSDLA 68

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+   +P  E NIEG P    ++     KP Q T VPD   Q TSDHGW F ++   L 
Sbjct: 69  ALLARDWPAIEFNIEGNPFHNLMDFVRTLKPHQATFVPDSETQSTSDHGWSFPEDAERLR 128

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             +A    LG R+SLF D       + AAK  GAD +ELYT  Y +    P ++ + L +
Sbjct: 129 PLIAEAKALGVRVSLFMD--PIPEMMAAAKAVGADRVELYTEGYASSRGTPDEQAV-LAR 185

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG----VKE 237
               A+ AQ   L +NAGHDL+  N+   + A+  + E+S+GHAF A ALE G     KE
Sbjct: 186 YVEAARAAQAAGLGLNAGHDLSRDNLTPFLRAVRGVQEVSIGHAFIADALELGYAATTKE 245

Query: 238 AVFCFRRA 245
            + C + A
Sbjct: 246 YLRCIQEA 253


>gi|325926206|ref|ZP_08187564.1| pyridoxine 5'-phosphate synthase [Xanthomonas perforans 91-118]
 gi|325543388|gb|EGD14813.1| pyridoxine 5'-phosphate synthase [Xanthomonas perforans 91-118]
          Length = 255

 Score =  172 bits (437), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 109/249 (43%), Positives = 144/249 (57%), Gaps = 12/249 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+T +SVN+N +AVLRN R    P++V   +  + +GA G+TVHPRPDQRHIR  D+  +
Sbjct: 1   MTTQLSVNVNKIAVLRNSRGGTDPDVVQAARACIAAGAHGITVHPRPDQRHIRADDVLAL 60

Query: 61  RRLIDEQFPKAELNIEGYPNE-------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDF 113
             L   Q    E NIEG P           L LC   +P+QITLVPD   QLTSDHG+ F
Sbjct: 61  SALTRAQ--AVEFNIEGNPFAPPRAGYPGLLELCRATRPQQITLVPDGDGQLTSDHGFHF 118

Query: 114 LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ 173
            Q+   L + +     LGSR+SLF D  GN    +AA L GAD IELYTGPY   + + Q
Sbjct: 119 AQDTTQLAELITAFKQLGSRVSLFVDA-GNPDIARAAAL-GADRIELYTGPYAHAHASGQ 176

Query: 174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALEC 233
            +   L   A  AQ A    L INAGHDL+  N+ + + A+P + E+S+GHA  + AL  
Sbjct: 177 ADAT-LALFADAAQRASAAGLGINAGHDLSQANLGDFLAAVPGVLEVSIGHALISEALYQ 235

Query: 234 GVKEAVFCF 242
           G+  +V  +
Sbjct: 236 GLDASVRAY 244


>gi|313159545|gb|EFR58908.1| pyridoxine 5'-phosphate synthase [Alistipes sp. HGB5]
          Length = 237

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 96/242 (39%), Positives = 139/242 (57%), Gaps = 9/242 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +AV+RN R    P++V       + GA G+TVHPRPD RHIRY D+  ++R
Sbjct: 2   TKLSVNINKIAVVRNSRGGNLPDVVRAALDIERFGAEGITVHPRPDARHIRYDDVRNLKR 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEG P  +F++L     P Q+TLVPD    +TS+ GWD L N+  LT+
Sbjct: 62  VLATEF-----NIEGNPIPSFVDLVLEVVPTQVTLVPDAHDAITSNAGWDTLANRGFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
             AR H  G R+S+F D   +   +  AK  GAD +ELYT  Y   Y  P      L   
Sbjct: 117 VTARFHEKGIRVSVFVD--PDPAMVAGAKACGADRVELYTEAYAREY--PAGAEAALAPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+ A++  L +NAGHDL ++N+   ++ IP+  E+S+GHA    AL  G++  V  +
Sbjct: 173 LAAAEEARRQGLGLNAGHDLNLENLRFFVSRIPWTDEVSIGHALICDALYYGLENTVQLY 232

Query: 243 RR 244
           +R
Sbjct: 233 KR 234


>gi|86134475|ref|ZP_01053057.1| pyridoxal phosphate biosynthesis protein PdxJ [Polaribacter sp.
           MED152]
 gi|85821338|gb|EAQ42485.1| pyridoxal phosphate biosynthesis protein PdxJ [Polaribacter sp.
           MED152]
          Length = 237

 Score =  172 bits (435), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 91/240 (37%), Positives = 139/240 (57%), Gaps = 9/240 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PNL+ +       GA G+T+HPRPD+RHIRY D  +++ 
Sbjct: 2   TKLSVNINKIATLRNSRGGNVPNLLKVATDIEGFGAQGITIHPRPDERHIRYQDARDLKG 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEG P ++F++L    KP Q+TLVPD    +TS+ GWD + +Q+ L +
Sbjct: 62  VVTTEF-----NIEGNPIQSFMDLVLETKPTQVTLVPDAVDAITSNAGWDTITHQSFLKE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A     G R S+F D +     ++AA  TG D IELYT  + + ++   ++ +     
Sbjct: 117 VIAEFQQNGIRTSIFIDTDAK--LIEAAAKTGTDRIELYTEEFASQFDKGNKDAV--KPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A LA  + L INAGHDL++ NI      IP ++E+S+GHA  A +L  G++  V  +
Sbjct: 173 TEAAILAHDLGLGINAGHDLSLDNIQFFKQNIPNLAEVSIGHALIAESLYLGLENVVNMY 232


>gi|325105091|ref|YP_004274745.1| pyridoxine 5'-phosphate synthase [Pedobacter saltans DSM 12145]
 gi|324973939|gb|ADY52923.1| pyridoxine 5'-phosphate synthase [Pedobacter saltans DSM 12145]
          Length = 238

 Score =  172 bits (435), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 140/238 (58%), Gaps = 10/238 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+++ +     + GA G+TVHPRPD+RHIRY+D+ +I++
Sbjct: 2   TKLSVNINKIATLRNSRGGNNPDVLKVALDCERFGAEGITVHPRPDERHIRYSDVYDIKK 61

Query: 63  LIDEQFPKAELNIEGY-PNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            I     + E NIEG    E F+ L    KP+Q+TLVPD   Q+TS+HGWD ++NQ+ L 
Sbjct: 62  NI-----RTEFNIEGNCQEEKFVKLVLDNKPDQVTLVPDALGQITSNHGWDTVKNQSYLQ 116

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             +      G R+S+F D       ++AAK TG D IELYT  Y   +   ++E I  + 
Sbjct: 117 DIIGVFKEQGIRVSIFVD--PVLEMVEAAKTTGTDRIELYTEAYAVGFKTDREEAI--SP 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              +A+LA K+ L INAGHDL + N+      I  + E+S+GHA    AL  G++  +
Sbjct: 173 YVESARLANKLGLGINAGHDLDLDNLKYFSQNIEGLLEVSIGHALICDALYLGLENTI 230


>gi|28197984|ref|NP_778298.1| pyridoxal phosphate biosynthetic protein PdxJ [Xylella fastidiosa
           Temecula1]
 gi|182680610|ref|YP_001828770.1| pyridoxine 5'-phosphate synthase [Xylella fastidiosa M23]
 gi|32129841|sp|Q87F88|PDXJ_XYLFT RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|238691048|sp|B2I669|PDXJ_XYLF2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|28056044|gb|AAO27947.1| pyridoxal phosphate biosynthetic protein [Xylella fastidiosa
           Temecula1]
 gi|182630720|gb|ACB91496.1| Pyridoxal phosphate biosynthetic protein PdxJ [Xylella fastidiosa
           M23]
 gi|307579067|gb|ADN63036.1| pyridoxine 5'-phosphate synthase [Xylella fastidiosa subsp.
           fastidiosa GB514]
          Length = 260

 Score =  172 bits (435), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 136/240 (56%), Gaps = 12/240 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +AVLRN R    P+++      + +GA G+TVHPRPD RHIR+ D+  +  
Sbjct: 5   TRLSVNVNKIAVLRNSRGHGAPDVIRAASACIDAGAHGITVHPRPDARHIRHDDVIRLSA 64

Query: 63  LIDEQFPKAELNIEGYPNET-------FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQ 115
           L   +    E NIEG P           L LC   +P Q+TLVPD   Q+TSDHG+DF +
Sbjct: 65  LTRAR--GVEFNIEGNPFAEPRAGYCGLLALCRETRPHQVTLVPDGDQQITSDHGFDFAR 122

Query: 116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE 175
               L   +  +   G R+SLF D N     L  A + G D IELYTGPY   ++    +
Sbjct: 123 EGPGLRPLIDEIKQWGCRVSLFVDVNVT--GLADAAIWGVDRIELYTGPYAEMHHAGCSD 180

Query: 176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
            + L + A TA+LAQ + L +NAGHDL+  N+   + A+P + E+S+GHA  + AL  G+
Sbjct: 181 AV-LREFATTARLAQDVGLGVNAGHDLSQTNLGVFLGAVPDVLEVSIGHALISEALYEGL 239


>gi|71901875|ref|ZP_00683936.1| Pyridoxal phosphate biosynthetic protein PdxJ [Xylella fastidiosa
           Ann-1]
 gi|71728363|gb|EAO30533.1| Pyridoxal phosphate biosynthetic protein PdxJ [Xylella fastidiosa
           Ann-1]
          Length = 260

 Score =  171 bits (434), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 97/240 (40%), Positives = 136/240 (56%), Gaps = 12/240 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +AVLRN R    P+++      + +GA G+TVHPRPD RHIR+ D+  +  
Sbjct: 5   TRLSVNVNKIAVLRNSRGHGAPDVIRAASACIDAGAHGITVHPRPDARHIRHDDVIGLSA 64

Query: 63  LIDEQFPKAELNIEGYPNET-------FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQ 115
           L   +    E NIEG P           L LC   +P Q+TLVPD   Q+TSDHG+DF +
Sbjct: 65  LTRAR--GVEFNIEGNPFAEPRAGYCGLLALCRETRPHQVTLVPDGDQQITSDHGFDFAR 122

Query: 116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE 175
               L   +  +   G R+SLF D N     L  A + G D IELYTGPY   ++    +
Sbjct: 123 EGPGLRPLIDEIKQWGCRVSLFVDVNVT--GLADAAIWGVDRIELYTGPYAEMHHAGCSD 180

Query: 176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
            + L + A TA+LAQ + L +NAGHDL+  N+   + A+P + E+S+GHA  + AL  G+
Sbjct: 181 AV-LREFATTARLAQDVGLGVNAGHDLSQTNLGVFLGAVPDVLEVSIGHALISEALYEGL 239


>gi|254524348|ref|ZP_05136403.1| pyridoxal phosphate biosynthesis protein PdxJ [Stenotrophomonas sp.
           SKA14]
 gi|219721939|gb|EED40464.1| pyridoxal phosphate biosynthesis protein PdxJ [Stenotrophomonas sp.
           SKA14]
          Length = 247

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 104/244 (42%), Positives = 141/244 (57%), Gaps = 12/244 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +AVLRN R    P++V   +  L +GA G+TVHPRPD+RHI   D+  +  
Sbjct: 2   TQLSVNVNKIAVLRNSRGGAEPDVVRAAQACLDAGAHGITVHPRPDRRHITAEDVLALST 61

Query: 63  LIDEQFPKAELNIEGY----PNETF---LNLCERYKPEQITLVPDDPHQLTSDHGWDFLQ 115
           L   +    E NIEG     P E +   L LC + +P Q TLVPD   Q+TSDHG+DF +
Sbjct: 62  LTRAR--GVEFNIEGNPFAPPREGYPGLLPLCAQTRPAQATLVPDGDGQITSDHGFDFER 119

Query: 116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE 175
           +   L   VA L  +G R+SLF D  GN    QAA++ GAD IELYTGPY   +     E
Sbjct: 120 DTERLRPLVAELKAMGCRVSLFVDA-GNPLLEQAAEV-GADRIELYTGPYAEAHAAGDAE 177

Query: 176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
            + L   A  A+ AQ + L +NAGHDL+  N+ + +  +P + E+S+GHA    AL  G+
Sbjct: 178 AM-LALFATAARRAQAVGLGVNAGHDLSQDNLRDFLAHVPDVLEVSIGHALIGEALYDGL 236

Query: 236 KEAV 239
              V
Sbjct: 237 DATV 240


>gi|15836665|ref|NP_297353.1| pyridoxine 5'-phosphate synthase [Xylella fastidiosa 9a5c]
 gi|12644546|sp|Q9PH84|PDXJ_XYLFA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|9104828|gb|AAF82873.1|AE003859_14 pyridoxal phosphate biosynthetic protein [Xylella fastidiosa 9a5c]
          Length = 260

 Score =  171 bits (434), Expect = 7e-41,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 137/244 (56%), Gaps = 12/244 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +AVLRN R    P+++      + +GA G+TVHPRPD RHIR+ D+  +  
Sbjct: 5   TRLSVNVNKIAVLRNSRGDGAPDVIRAASACIDAGAHGITVHPRPDARHIRHDDVIGLSA 64

Query: 63  LIDEQFPKAELNIEGYPNET-------FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQ 115
           L   +    E NIEG P           L LC   +P Q+TLVPD   Q+TSDHG+DF +
Sbjct: 65  LTRAR--GVEFNIEGNPFAEPRAGYCGLLALCRETRPHQVTLVPDGDQQITSDHGFDFAR 122

Query: 116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE 175
               L   +  +   G R+SLF D N     L  A + G D IELYTGPY   ++    +
Sbjct: 123 EGPGLRPLIDEIKQWGCRVSLFVDVNVT--GLADAAIWGVDRIELYTGPYAEMHHAGCSD 180

Query: 176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
            + L + A TA+LAQ + L +NAGHDL+  N+   + A+P + E+S+GHA  + AL  G+
Sbjct: 181 AV-LREFATTARLAQDVGLGVNAGHDLSQTNLGVFLGAVPDVLEVSIGHALISEALYEGL 239

Query: 236 KEAV 239
              V
Sbjct: 240 VPTV 243


>gi|261749673|ref|YP_003257359.1| pyridoxal phosphate biosynthetic protein [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
 gi|261497766|gb|ACX84216.1| pyridoxal phosphate biosynthetic protein [Blattabacterium sp.
           (Periplaneta americana) str. BPLAN]
          Length = 243

 Score =  171 bits (434), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 100/242 (41%), Positives = 142/242 (58%), Gaps = 9/242 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             +SVNLN +A LRN R    PNL+ + K   + GA+G+T+HPRPD+RHI Y D+ +++ 
Sbjct: 2   VKLSVNLNKIATLRNARGGNIPNLLQVAKDVQKYGANGITIHPRPDERHITYKDVYDLKS 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     K ELNIEG P   F+NL     P Q+TLVPD  + +TS+ GW+ +  Q LLT+
Sbjct: 62  IV-----KTELNIEGRPINKFMNLVLDILPNQVTLVPDPNNVITSNSGWNTICYQDLLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
           TV +L N G R S+F D   +   +  A  TGAD IELYT  +   Y N +   I  +  
Sbjct: 117 TVKKLKNHGIRTSIFLD--PDPKLVPYAASTGADRIELYTENFAVGYANKKWNCI--DPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
            ITA+ A    L INAGH L ++NI  LI  IP I E+S+G A  + +L  G++  +  +
Sbjct: 173 IITAKEAINHHLLINAGHGLNLENISFLIENIPSIVEVSIGQALISDSLYMGLENTIQTY 232

Query: 243 RR 244
            +
Sbjct: 233 LK 234


>gi|71275501|ref|ZP_00651787.1| Pyridoxal phosphate biosynthetic protein PdxJ [Xylella fastidiosa
           Dixon]
 gi|71900749|ref|ZP_00682870.1| Pyridoxal phosphate biosynthetic protein PdxJ [Xylella fastidiosa
           Ann-1]
 gi|170729291|ref|YP_001774724.1| pyridoxine 5'-phosphate synthase [Xylella fastidiosa M12]
 gi|238687917|sp|B0U2A9|PDXJ_XYLFM RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|71163801|gb|EAO13517.1| Pyridoxal phosphate biosynthetic protein PdxJ [Xylella fastidiosa
           Dixon]
 gi|71729479|gb|EAO31589.1| Pyridoxal phosphate biosynthetic protein PdxJ [Xylella fastidiosa
           Ann-1]
 gi|167964084|gb|ACA11094.1| pyridoxal phosphate biosynthetic protein [Xylella fastidiosa M12]
          Length = 260

 Score =  171 bits (434), Expect = 8e-41,   Method: Compositional matrix adjust.
 Identities = 98/244 (40%), Positives = 137/244 (56%), Gaps = 12/244 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +AVLRN R    P+++      + +GA G+TVHPRPD RHIR+ D+  +  
Sbjct: 5   TRLSVNVNKIAVLRNSRGHGAPDVIRAASACIDAGAHGITVHPRPDARHIRHDDVIGLST 64

Query: 63  LIDEQFPKAELNIEGYPNET-------FLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQ 115
           L   +    E NIEG P           L LC   +P Q+TLVPD   Q+TSDHG+DF +
Sbjct: 65  LTRAR--GVEFNIEGNPFAEPRAGYCGLLALCRETRPHQVTLVPDGDQQITSDHGFDFAR 122

Query: 116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE 175
               L   +  +   G R+SLF D N     L  A + G D IELYTGPY   ++    +
Sbjct: 123 EGPGLRPLIDEIKQWGCRVSLFVDVNVT--GLADAAIWGVDRIELYTGPYAEMHHAGCSD 180

Query: 176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
            + L + A TA+LAQ + L +NAGHDL+  N+   + A+P + E+S+GHA  + AL  G+
Sbjct: 181 AV-LREFATTARLAQDVGLGVNAGHDLSQTNLGVFLGAVPDVLEVSIGHALISEALYEGL 239

Query: 236 KEAV 239
              V
Sbjct: 240 IPTV 243


>gi|149369713|ref|ZP_01889565.1| pyridoxal phosphate biosynthetic protein PdxJ [unidentified
           eubacterium SCB49]
 gi|149357140|gb|EDM45695.1| pyridoxal phosphate biosynthetic protein PdxJ [unidentified
           eubacterium SCB49]
          Length = 237

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 142/238 (59%), Gaps = 11/238 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+L+   K     GA G+T+HPRPD+RHIRY D  +++ 
Sbjct: 2   TKLSVNINKLATLRNARGGNVPDLLKATKDIELFGAQGITIHPRPDERHIRYQDARDLKN 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           +++ ++     NIEG P  +F++L    KP Q+TLVPD    LTS+ GWD +++++ L +
Sbjct: 62  VVNTEY-----NIEGNPITSFIDLVLEVKPTQVTLVPDSVDVLTSNAGWDTVKHKSFLIE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSL-QAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
            +      G R S+F D    E SL + A L G D IELYT  +   Y+  + +   + K
Sbjct: 117 VIDEFKRNGIRTSVFVDP---ELSLIEGAALVGTDRIELYTEDFAVGYS--KGDHAVVKK 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  + LA ++ L +NAGHDL++ NI    N +PY++E+S+GHA  + AL  G++  V
Sbjct: 172 YADCSLLAHQLGLGVNAGHDLSLDNIEFFKNNVPYLAEVSIGHALISEALYQGLERVV 229


>gi|294627426|ref|ZP_06706010.1| pyridoxal phosphate biosynthetic protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|294665512|ref|ZP_06730795.1| pyridoxal phosphate biosynthetic protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292598247|gb|EFF42400.1| pyridoxal phosphate biosynthetic protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|292604715|gb|EFF48083.1| pyridoxal phosphate biosynthetic protein [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 255

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 108/249 (43%), Positives = 142/249 (57%), Gaps = 12/249 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  +SVN+N +AVLRN R    P++    +  + +GA G+TVHPRPDQRHIR  D+  +
Sbjct: 1   MTAQLSVNVNKIAVLRNSRGGADPDVAQAARACIAAGAHGITVHPRPDQRHIRADDVLAL 60

Query: 61  RRLIDEQFPKAELNIEGYPNE-------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDF 113
             L        E NIEG P           L LC   +P+QITLVPD   QLTSDHG+DF
Sbjct: 61  SALTRTH--AVEFNIEGNPFAPPRAGYPGLLELCRATRPQQITLVPDGDGQLTSDHGFDF 118

Query: 114 LQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ 173
            Q+ A L + +     LGSR+SLF D  GN    +AA L GAD IELYTGPY   +   Q
Sbjct: 119 AQDTAQLAELITAFKRLGSRVSLFVDA-GNPDIARAATL-GADRIELYTGPYAHAHAGGQ 176

Query: 174 QERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALEC 233
            +   L   A  AQ A    L INAGHDL+  N+ + + A+P + E+S+GHA  + AL  
Sbjct: 177 ADTA-LALFADAAQRASAAGLGINAGHDLSQANLGDFLAAVPGVLEVSIGHALISEALYQ 235

Query: 234 GVKEAVFCF 242
           G+  +V  +
Sbjct: 236 GLDASVRAY 244


>gi|315225278|ref|ZP_07867095.1| pyridoxine 5'-phosphate synthase [Capnocytophaga ochracea F0287]
 gi|314944961|gb|EFS96993.1| pyridoxine 5'-phosphate synthase [Capnocytophaga ochracea F0287]
          Length = 238

 Score =  171 bits (432), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 97/241 (40%), Positives = 142/241 (58%), Gaps = 11/241 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+L+ + K   Q GA G+T+HPRP++RHIRY D  ++ +
Sbjct: 2   TKLSVNINKIATLRNARGGNIPDLLQVAKDVQQFGAEGITIHPRPNERHIRYQDAFDLLK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  ++     NIEG P   F++L  + KP Q+TLVPD    +TS+ GWD +++++ LT+
Sbjct: 62  VVTTEY-----NIEGNPIPKFIDLVLQVKPTQVTLVPDAEDAITSNAGWDTVKHKSFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VA     G R SLF D    E  + AA  TGAD +ELYT  Y   Y    + +I     
Sbjct: 117 VVAEFKRNGIRTSLFVD--PVEAMVTAAATTGADRVELYTERYAREYARGDKTQI---AP 171

Query: 183 AITAQL-AQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
            I A L AQK+ L +NAGHDL++ N+    + IP + E+S+GHA    AL  G++  V  
Sbjct: 172 YIKAALEAQKVGLGLNAGHDLSLDNMKYFKDNIPNLLEVSIGHALICEALYLGLENVVQL 231

Query: 242 F 242
           +
Sbjct: 232 Y 232


>gi|24214214|ref|NP_711695.1| pyridoxal phosphate biosynthetic protein PdxJ [Leptospira
           interrogans serovar Lai str. 56601]
 gi|24195119|gb|AAN48713.1| pyridoxal phosphate biosynthetic protein PdxJ [Leptospira
           interrogans serovar Lai str. 56601]
          Length = 250

 Score =  170 bits (430), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 150/254 (59%), Gaps = 13/254 (5%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVN+N +A LRN R    P+L +   + L++GA G+TVHPR D+RHIR  D+  +
Sbjct: 1   MKVKLSVNINKIATLRNSRGGNIPDLSYFANLVLKAGAHGITVHPREDERHIRKEDVFVL 60

Query: 61  RRLIDEQFPK----AELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQN 116
           +  ID    K     E N+EG P+  FL+L  + KP+Q TLVP  P ++TSDHG+DF ++
Sbjct: 61  KEFIDSYNRKNNTNIEYNLEGEPSPRFLDLVLKTKPDQATLVPVTPGEITSDHGFDFEKD 120

Query: 117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ-- 174
             +L++    L     R+SLF +      +L+ A L+GAD +E YTGP+   +++  Q  
Sbjct: 121 MEILSEYSKILKKDKIRVSLFVETGLK--NLKLASLSGADRVEFYTGPFAEAFDHSPQIG 178

Query: 175 ERIFLNKL--AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALE 232
           ++ F  +   A T  L QKM   INAGHDL  +N+  + + +P + E+S+GH   + ALE
Sbjct: 179 KKRFETEYVPAATEILNQKMG--INAGHDLDHENL-KIFSKLPGLQEVSIGHRLISRALE 235

Query: 233 CGVKEAVFCFRRAC 246
            G+ ++V  + +A 
Sbjct: 236 TGIDQSVKDYLQAL 249


>gi|326336684|ref|ZP_08202852.1| pyridoxal phosphate biosynthetic protein PdxJ [Capnocytophaga sp.
           oral taxon 338 str. F0234]
 gi|325691154|gb|EGD33125.1| pyridoxal phosphate biosynthetic protein PdxJ [Capnocytophaga sp.
           oral taxon 338 str. F0234]
          Length = 237

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 97/245 (39%), Positives = 138/245 (56%), Gaps = 19/245 (7%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PNL+ +     + G  G+T+HPRPD+RHIRY D  ++++
Sbjct: 2   TKLSVNINKIATLRNSRGGNVPNLLQVATDLQEFGVEGITIHPRPDERHIRYQDALDLKQ 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  ++     NIEG P   F++L  + KP Q+TLVPD    +TS+ GWD L +QA LT+
Sbjct: 62  IVHTEY-----NIEGNPIPKFMDLVLQIKPTQVTLVPDAEDAITSNAGWDTLIHQAYLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            VA     G R SLF D       ++AA  TG D +ELYT  Y   Y        F NK 
Sbjct: 117 IVAEFKRNGIRTSLFVD--PIPKMIEAAAKTGTDRVELYTEAYAKGY-------AFGNKE 167

Query: 183 AIT-----AQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKE 237
           AIT      ++A  + L +NAGHDL + N+      IP + E+S+GHA  + AL  G++ 
Sbjct: 168 AITPYILAGKVADSIGLGLNAGHDLNLDNLHYFKENIPSLLEVSIGHALISEALYLGLQN 227

Query: 238 AVFCF 242
            V  +
Sbjct: 228 VVSMY 232


>gi|190572106|ref|YP_001969951.1| pyridoxine 5'-phosphate synthase [Stenotrophomonas maltophilia
           K279a]
 gi|190010028|emb|CAQ43633.1| putative pyridoxal phosphate biosynthetic protein [Stenotrophomonas
           maltophilia K279a]
          Length = 247

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 103/244 (42%), Positives = 140/244 (57%), Gaps = 12/244 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +AVLRN R    P++V   +  L +GA G+TVHPRPD+RHI   D+  +  
Sbjct: 2   TQLSVNVNKIAVLRNSRGGAEPDVVRAAQACLDAGAHGITVHPRPDRRHITAEDVLALST 61

Query: 63  LIDEQFPKAELNIEGY----PNETF---LNLCERYKPEQITLVPDDPHQLTSDHGWDFLQ 115
           L   +    E NIEG     P E +   L LC + +P Q TLVPD   Q+TSDHG+DF +
Sbjct: 62  LTRAR--GVEFNIEGNPFAPPREGYPGLLPLCAQTRPAQATLVPDGDGQITSDHGFDFER 119

Query: 116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE 175
           +   L   VA L  +G R+SLF D  GN    QAA++ GAD +ELYTGPY   +      
Sbjct: 120 DAERLRPLVAELKAMGCRVSLFVDA-GNPLLEQAAEV-GADRVELYTGPYAEAHAAGDAA 177

Query: 176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
            + L   A  A+ AQ M L +NAGHDL+  N+ + +  +P + E+S+GHA    AL  G+
Sbjct: 178 AM-LELFATAARRAQAMGLGVNAGHDLSQDNLRDFLAHVPDVLEVSIGHALIGEALYDGL 236

Query: 236 KEAV 239
              V
Sbjct: 237 DATV 240


>gi|194363792|ref|YP_002026402.1| pyridoxine 5'-phosphate synthase [Stenotrophomonas maltophilia
           R551-3]
 gi|194346596|gb|ACF49719.1| Pyridoxal phosphate biosynthetic protein PdxJ [Stenotrophomonas
           maltophilia R551-3]
          Length = 247

 Score =  169 bits (429), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 102/244 (41%), Positives = 139/244 (56%), Gaps = 12/244 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +AVLRN R    P++V   +  L +GA G+TVHPRPD+RHI   D+  +  
Sbjct: 2   TQLSVNVNKIAVLRNSRGGAEPDVVRAAQACLDAGAHGITVHPRPDRRHITAEDVLALST 61

Query: 63  LIDEQFPKAELNIEGY----PNETF---LNLCERYKPEQITLVPDDPHQLTSDHGWDFLQ 115
           L   +    E NIEG     P E +   L LC + +P Q TLVPD   Q+TSDHG+DF +
Sbjct: 62  LTRAR--GVEFNIEGNPFAPPREGYPGLLPLCAQTRPAQATLVPDSDGQITSDHGFDFER 119

Query: 116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE 175
           +   L   +A L  +G R+SLF D  GN    QAA++ GAD IELYTGPY   +      
Sbjct: 120 DAERLRPLIAELKAMGCRVSLFVDA-GNPLLEQAAEV-GADRIELYTGPYAEAH-AAGDA 176

Query: 176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
              L   A  A+ AQ + L +NAGHDL+  N+ + +  +P + E+S+GHA    AL  G+
Sbjct: 177 GAMLTLFATAARRAQAVGLGVNAGHDLSQDNLRDFLANVPDVLEVSIGHALIGEALYDGL 236

Query: 236 KEAV 239
              V
Sbjct: 237 DATV 240


>gi|88801348|ref|ZP_01116876.1| pyridoxal phosphate biosynthetic protein [Polaribacter irgensii
           23-P]
 gi|88782006|gb|EAR13183.1| pyridoxal phosphate biosynthetic protein [Polaribacter irgensii
           23-P]
          Length = 237

 Score =  169 bits (428), Expect = 3e-40,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 137/238 (57%), Gaps = 11/238 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PNL+   +   + G  G+T+HPRPD+RHI+Y D  ++  
Sbjct: 2   TKLSVNINKIATLRNSRGGNVPNLLKFAEDIERFGGQGITIHPRPDERHIKYQDARDLVS 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     K E NIEG P ++F++L    KP Q+TLVPD    LTS+ GWD +++Q+ L +
Sbjct: 62  VV-----KTEFNIEGNPIQSFIDLVLETKPTQVTLVPDAIDALTSNAGWDTIKHQSFLQE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSL-QAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
            V      G R S+F    G +  L +AA  TG+D IELYT  + A +N   +E I    
Sbjct: 117 VVQEFQQNGIRTSIFI---GTDLKLVEAAAKTGSDRIELYTEDFAAQFNIGNKEAI--KP 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               A LA  + L INAGHDL++ NI      IP ++E+S+GH+    +L  G++  V
Sbjct: 172 YTTAAVLAHTLGLGINAGHDLSLDNIQFFKENIPNLAEVSIGHSLIVESLYLGIENVV 229


>gi|45658097|ref|YP_002183.1| pyridoxine 5'-phosphate synthase [Leptospira interrogans serovar
           Copenhageni str. Fiocruz L1-130]
 gi|45601338|gb|AAS70820.1| pyridoxal phosphate biosynthetic protein [Leptospira interrogans
           serovar Copenhageni str. Fiocruz L1-130]
          Length = 250

 Score =  169 bits (428), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 97/254 (38%), Positives = 150/254 (59%), Gaps = 13/254 (5%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVN+N +A LRN R    P+L++   + L++GA G+TVHPR D+RHIR  D+  +
Sbjct: 1   MKVKLSVNINKIATLRNSRGGNIPDLLYFANLVLKAGAHGITVHPREDERHIRKEDVFIL 60

Query: 61  RRLIDEQFPK----AELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQN 116
           +  ID    K     E N+EG P+  FL+L  + KP+Q TLVP  P ++TSDHG+DF ++
Sbjct: 61  KEFIDSYNRKNNTNIEYNLEGEPSPRFLDLVLKTKPDQATLVPVTPGEITSDHGFDFEKD 120

Query: 117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ-- 174
             +L++    L     R+SLF +      +L+ A L+GAD +E YTGP+   +++  Q  
Sbjct: 121 MEILSEYSKILKKDKIRVSLFVETGLK--NLKLASLSGADRVEFYTGPFAEAFDHSPQIG 178

Query: 175 ERIFLNKL--AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALE 232
           ++ F  +   A T  L QKM   INAGHDL   N+  + + +P + E+S+GH   + ALE
Sbjct: 179 KKRFETEYVPAATEILNQKMG--INAGHDLDHNNL-KIFSQLPGLQEVSIGHRLISRALE 235

Query: 233 CGVKEAVFCFRRAC 246
            G+ ++V  + +A 
Sbjct: 236 TGIDQSVKDYLQAL 249


>gi|332291473|ref|YP_004430082.1| pyridoxal phosphate biosynthetic protein PdxJ [Krokinobacter
           diaphorus 4H-3-7-5]
 gi|332169559|gb|AEE18814.1| pyridoxal phosphate biosynthetic protein PdxJ [Krokinobacter
           diaphorus 4H-3-7-5]
          Length = 237

 Score =  169 bits (427), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 97/243 (39%), Positives = 138/243 (56%), Gaps = 11/243 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA LRN R    P+L+ +     + GA G+T+HPRPD+RHIRY D    R 
Sbjct: 2   TKLSVNINKVATLRNARGGNVPDLLKVASDLEKMGAQGITIHPRPDERHIRYQDA---RD 58

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+D      E NIEG P + F++L    KP Q+TLVPD    +TS+ GWD +++++ L +
Sbjct: 59  LVD--VVTTEFNIEGNPIQKFIDLVLETKPTQVTLVPDAVDAITSNAGWDTIKHKSFLQE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +      G R S+F D       ++ AK TGAD IELYT  Y   Y   ++E I   K 
Sbjct: 117 VIQEFKEAGIRTSIFVD--PVLEMVEGAKETGADRIELYTESYADGYVLNKEEAI---KP 171

Query: 183 AITAQL-AQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
            I A   A  + + INAGHDL++ NI    N+IP + E+S+GHA  A +L  G +  +  
Sbjct: 172 FIAAAFHASDIGIGINAGHDLSLDNIEYFHNSIPDLLEVSIGHALMAESLYLGFETVITS 231

Query: 242 FRR 244
           + +
Sbjct: 232 YLK 234


>gi|116328567|ref|YP_798287.1| pyridoxal phosphate biosynthetic protein PdxJ [Leptospira
           borgpetersenii serovar Hardjo-bovis L550]
 gi|116331296|ref|YP_801014.1| pyridoxal phosphate biosynthetic protein PdxJ [Leptospira
           borgpetersenii serovar Hardjo-bovis JB197]
 gi|116121311|gb|ABJ79354.1| Pyridoxal phosphate biosynthesis protein [Leptospira borgpetersenii
           serovar Hardjo-bovis L550]
 gi|116124985|gb|ABJ76256.1| Pyridoxal phosphate biosynthesis protein [Leptospira borgpetersenii
           serovar Hardjo-bovis JB197]
          Length = 250

 Score =  168 bits (426), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 98/254 (38%), Positives = 148/254 (58%), Gaps = 13/254 (5%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   +SVN+N +A LRN R    P+L++   + L++GA G+TVHPR D+RHIR  D+  +
Sbjct: 1   MKIKLSVNINKIATLRNSRGGNIPDLLYFADLVLRAGAEGITVHPREDERHIRKDDVFSL 60

Query: 61  RRLID----EQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQN 116
           +  ID    +   K E N+EG P+  FL+L    +P+Q TLVP  P ++TSDHG+DF ++
Sbjct: 61  KEFIDSYNYKNNTKIEYNMEGEPSPRFLDLLLNIRPDQATLVPVTPGEITSDHGFDFKKD 120

Query: 117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN-NPQQE 175
              L +    L     R SLF +   +  +L+ A LTGAD +E YTGP+   ++ +PQ  
Sbjct: 121 LTTLQEYSKILKKEKIRTSLFVE--TDPENLKLASLTGADRVEFYTGPFAEKFDRSPQIG 178

Query: 176 RIFLNKLAI---TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALE 232
           +     L I    A L+QKM   INAGHDL   N+  + + +P + E+S+GH   + ALE
Sbjct: 179 QECFESLYIPAAKAVLSQKM--GINAGHDLDHDNL-KIFSRLPGLQEVSIGHRLISRALE 235

Query: 233 CGVKEAVFCFRRAC 246
            G+ ++V  + +A 
Sbjct: 236 TGIDQSVKDYLQAL 249


>gi|312132170|ref|YP_003999510.1| pyridoxine 5'-phosphate synthase [Leadbetterella byssophila DSM
           17132]
 gi|311908716|gb|ADQ19157.1| pyridoxine 5'-phosphate synthase [Leadbetterella byssophila DSM
           17132]
          Length = 238

 Score =  167 bits (424), Expect = 9e-40,   Method: Compositional matrix adjust.
 Identities = 94/243 (38%), Positives = 141/243 (58%), Gaps = 10/243 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PN++ +     + GA G+TVHPRPD+RHIRY D+ +++ 
Sbjct: 2   TKLSVNINKIATLRNSRGGDVPNVLQVALDCEKFGAQGITVHPRPDERHIRYQDVFDLKE 61

Query: 63  LIDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            I  +F     NIEG P E  F  +  +  P Q+TLVPD  + +TS+ GWD +++QA L 
Sbjct: 62  KICTEF-----NIEGNPTEGRFEEVVLKTVPAQVTLVPDALNAITSNAGWDTVRHQAQLK 116

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           + V +  N G R+S+F D   +   ++AA  TG D IELYT  Y   Y  P      +  
Sbjct: 117 ELVKKYKNAGIRVSIFVD--ADPIMVEAAAETGTDRIELYTESYAKGY--PSDREKAIAP 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
             + A+ A ++ L +NAGHDL+++N+      IP + E+S+GHA  A AL  G++  +  
Sbjct: 173 FVVAAEKALEVGLGLNAGHDLSLENLAYFKQNIPGLLEVSIGHALIADALYYGLENTIQM 232

Query: 242 FRR 244
           + R
Sbjct: 233 YLR 235


>gi|121605949|ref|YP_983278.1| pyridoxine 5'-phosphate synthase [Polaromonas naphthalenivorans
           CJ2]
 gi|120594918|gb|ABM38357.1| pyridoxine 5'-phosphate synthase [Polaromonas naphthalenivorans
           CJ2]
          Length = 276

 Score =  167 bits (423), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 106/252 (42%), Positives = 152/252 (60%), Gaps = 13/252 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA+LRN R+L  P+++   ++ LQ+GA G+TVHPRPD+RHIR  D+ EI  
Sbjct: 22  TALSVNVNKVALLRNTRHLDIPSVLRAAELCLQAGAQGITVHPRPDERHIRSDDVYEIAA 81

Query: 63  LIDEQFPKAELNIEGYPNETFL----NLCERYKP-EQITLVPDDPHQLTSDHGWDFLQNQ 117
           L+ + +P  E NIEG P +  +    +L  R  P  Q T VPD   Q TSDHGW F Q+ 
Sbjct: 82  LMKD-WPHCEFNIEGNPLQNLMHFVRDLSARGLPLHQCTFVPDSEGQFTSDHGWSFPQDA 140

Query: 118 ALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI 177
             L   +   H  G R+SLF D      ++ AAK  GAD +ELYT  Y   ++ P++ ++
Sbjct: 141 ERLKPHIEYAHARGVRVSLFMDPLPE--AMAAAKAVGADRVELYTESYAQAWSGPEKNKV 198

Query: 178 FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG--- 234
            L++ A TA+ A  ++L +NAGHDL   N+   + A+P + E+S+GHA  A ALE G   
Sbjct: 199 -LSQFAQTARAAAAINLGVNAGHDLNRDNLSEFLRAVPGVLEVSIGHALIADALELGYDA 257

Query: 235 -VKEAVFCFRRA 245
            VK+ + C   A
Sbjct: 258 TVKDYLRCINEA 269


>gi|300771582|ref|ZP_07081457.1| pyridoxine 5'-phosphate synthase [Sphingobacterium spiritivorum
           ATCC 33861]
 gi|300761571|gb|EFK58392.1| pyridoxine 5'-phosphate synthase [Sphingobacterium spiritivorum
           ATCC 33861]
          Length = 238

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 140/238 (58%), Gaps = 10/238 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+++       + GA G+TVHPRPD+RHIRYTD+ +++ 
Sbjct: 2   TRLSVNINKIATLRNSRGGNNPSVLAAALACERFGAQGITVHPRPDERHIRYTDVYDLKE 61

Query: 63  LIDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            I  +F     NIEG   E  F++L    KP Q+TLVPD+  Q+TS+HGWD +++QA L 
Sbjct: 62  NITTEF-----NIEGNCREQKFVDLVLANKPAQVTLVPDEEGQITSNHGWDTIKHQAYLK 116

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +      + G R+S+F D   +   ++AA  TG D IELYT  Y   + + ++  I    
Sbjct: 117 EMCTLFKDHGIRVSIFVD--PDPEMVEAAAETGTDRIELYTEAYATAFLDEREAAI--QP 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               AQ A ++ L INAGHDL + N+      IP + E+S+GHA  A AL  G++E +
Sbjct: 173 YFKAAQKANEVGLGINAGHDLDLNNLTYFNQHIPGLLEVSIGHALIADALYLGLEETI 230


>gi|163786492|ref|ZP_02180940.1| pyridoxal phosphate biosynthetic protein [Flavobacteriales
           bacterium ALC-1]
 gi|159878352|gb|EDP72408.1| pyridoxal phosphate biosynthetic protein [Flavobacteriales
           bacterium ALC-1]
          Length = 237

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 91/240 (37%), Positives = 134/240 (55%), Gaps = 9/240 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PN+V   +   + GA G+T+HPRPD+RHIRY D  +++ 
Sbjct: 2   TKLSVNINKIATLRNSRGGDVPNVVQFARDVQRYGAEGVTIHPRPDERHIRYQDAYDLKS 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +       E NIEG P   F+ +    KP Q+TLVPD    +TS+ GWD L+++  L +
Sbjct: 62  EV-----YTEYNIEGNPIPKFIEMVLEIKPTQVTLVPDAVDAITSNAGWDTLKHKDFLVE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +    + G R S+F D   + H ++ AK TG D IELYT  +   Y    +E I     
Sbjct: 117 VIKEFKDNGIRTSIFVD--PDLHQIEGAKATGTDRIELYTEAFAHQYGLGNKEAI--KPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A LA  + L +NAGHDL+++NI    + I  + E+S+GHA  A +L  GV+  +  +
Sbjct: 173 MECAGLANAIQLGVNAGHDLSLENIEFFKDNITGLLEVSIGHALIAESLYLGVENVIAMY 232


>gi|227535781|ref|ZP_03965830.1| pyridoxine 5'-phosphate synthase [Sphingobacterium spiritivorum
           ATCC 33300]
 gi|227244269|gb|EEI94284.1| pyridoxine 5'-phosphate synthase [Sphingobacterium spiritivorum
           ATCC 33300]
          Length = 238

 Score =  166 bits (420), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 140/238 (58%), Gaps = 10/238 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+++       + GA G+TVHPRPD+RHIRYTD+ +++ 
Sbjct: 2   TRLSVNINKIATLRNSRGGNNPSVLAAALACERFGAQGITVHPRPDERHIRYTDVYDLKE 61

Query: 63  LIDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            I  +F     NIEG   E  F++L    KP Q+TLVPD+  Q+TS+HGWD +++QA L 
Sbjct: 62  NITTEF-----NIEGNCREQKFVDLVLANKPAQVTLVPDEEGQITSNHGWDTIKHQAYLK 116

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +      + G R+S+F D   +   ++AA  TG D IELYT  Y   + + ++  I    
Sbjct: 117 EMCKLFKDHGIRVSIFVD--PDPEMVEAAAETGTDRIELYTEAYATAFLDEREAAI--QP 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               AQ A ++ L INAGHDL + N+      IP + E+S+GHA  A AL  G++E +
Sbjct: 173 YFKAAQKANEVGLGINAGHDLDLNNLTYFNQHIPGLLEVSIGHALIADALYLGLEETI 230


>gi|255533558|ref|YP_003093930.1| pyridoxine 5'-phosphate synthase [Pedobacter heparinus DSM 2366]
 gi|255346542|gb|ACU05868.1| pyridoxal phosphate biosynthetic protein PdxJ [Pedobacter heparinus
           DSM 2366]
          Length = 240

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 98/241 (40%), Positives = 141/241 (58%), Gaps = 10/241 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +SVN+N +A LRN R    P+LV +     + GA G+TVHPRPD+RHIRY D+ +++ +I
Sbjct: 4   LSVNINKIATLRNSRGGNNPDLVKVALDCERFGAEGITVHPRPDERHIRYQDVFDLKAVI 63

Query: 65  DEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
             +F     NIEG   E  F+ L    KP Q+TLVPD   QLTS+HGWD +++ A L + 
Sbjct: 64  ATEF-----NIEGNCREQKFIELVLANKPAQVTLVPDAEGQLTSNHGWDTIKHAAYLKEM 118

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V      G R+S+F D       ++AA LTG D IELYT  Y   Y +  +E+  L  +A
Sbjct: 119 VGLFKAEGIRVSIFVD--PVVEMVEAAVLTGTDRIELYTEAYAHNYYD-NREKAVLPYVA 175

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A  A ++ L INAGHDL + N+     +IP + E+S+GHA  + AL  G++  +  + 
Sbjct: 176 -AAHKAHELGLGINAGHDLDLHNLKYFAESIPGLLEVSIGHALISDALYLGLENTIQMYL 234

Query: 244 R 244
           +
Sbjct: 235 K 235


>gi|325286844|ref|YP_004262634.1| Pyridoxine 5'-phosphate synthase [Cellulophaga lytica DSM 7489]
 gi|324322298|gb|ADY29763.1| Pyridoxine 5'-phosphate synthase [Cellulophaga lytica DSM 7489]
          Length = 237

 Score =  166 bits (419), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 88/240 (36%), Positives = 134/240 (55%), Gaps = 9/240 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PNL  +       GA G+T+HPRPD+RHIRY D  ++++
Sbjct: 2   TKLSVNVNKIATLRNSRGGNVPNLCKVATDIESFGAEGITIHPRPDERHIRYQDARDLKK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEG P + F++L    +P Q+TLVPD    +TS+ GWD ++++  L  
Sbjct: 62  IVTTEF-----NIEGNPIKKFVDLVLETQPTQVTLVPDAVDAITSNAGWDTIKHKDFLKD 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A       R S+F   N +   ++ A  TG D IELYT  Y   Y    +  +     
Sbjct: 117 VIATFKAHNIRTSIFV--NADLKMVEGAAETGTDRIELYTESYADAYAEGNKNGV--QPF 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A LA K++L INAGHDL++ NI      +P++ E+S+GHA  + +L  G++  V  +
Sbjct: 173 TDAAILAHKLNLGINAGHDLSLDNIAFFKEKVPHLLEVSIGHALISESLYLGLENVVNMY 232


>gi|163753158|ref|ZP_02160282.1| pyridoxal phosphate biosynthetic protein [Kordia algicida OT-1]
 gi|161326890|gb|EDP98215.1| pyridoxal phosphate biosynthetic protein [Kordia algicida OT-1]
          Length = 239

 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 93/247 (37%), Positives = 137/247 (55%), Gaps = 19/247 (7%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+T +SVN+N +A LRN R    PNL+   K     GA G+T+HPRPD+RHIRY D  ++
Sbjct: 1   MTTKLSVNINKIATLRNSRGGDVPNLIKFAKDVQNYGAQGITIHPRPDERHIRYQDARDL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           + ++       E NIEG P + F++L    +P Q+TLVPD    +TS+ GW+ ++++  L
Sbjct: 61  KPIV-----HTEYNIEGNPIQKFMDLVLEVQPTQVTLVPDAVDAITSNAGWNTIKHKDFL 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T+ +A   N G R S+F D       +  AK  G D IELYT  +   Y+         N
Sbjct: 116 TEVIAEFKNNGIRTSIFVD--PVLEMIDGAKAVGTDRIELYTEEFAHQYS-------LGN 166

Query: 181 KLAIT-----AQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
           K AI      A  + ++ + +NAGHDL++ NI      IP + E+S+GHA  A +L  GV
Sbjct: 167 KKAIQPYIDCAVRSNELGIGVNAGHDLSLDNIQFFAKEIPALLEVSIGHALIAESLYLGV 226

Query: 236 KEAVFCF 242
           +  V  +
Sbjct: 227 ENVVNMY 233


>gi|213962046|ref|ZP_03390311.1| pyridoxine 5'-phosphate synthase [Capnocytophaga sputigena Capno]
 gi|213955399|gb|EEB66716.1| pyridoxine 5'-phosphate synthase [Capnocytophaga sputigena Capno]
          Length = 238

 Score =  165 bits (418), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 93/245 (37%), Positives = 138/245 (56%), Gaps = 19/245 (7%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+++ + K   + GA G+T+HPRPD+RHIRY D  ++ +
Sbjct: 2   TKLSVNINKIATLRNARGGNMPDVLQVAKDVQRFGAEGVTIHPRPDERHIRYQDAFDLLK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  ++     NIEG P   F++L  + KP Q+TLVPD    +TS+ GWD ++++  LT+
Sbjct: 62  VVTTEY-----NIEGNPIPKFIDLVLQVKPTQVTLVPDAEDAITSNAGWDTIKHKDFLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V      G R SLF D    E  + AA  TG D +ELYT  Y + Y          NK 
Sbjct: 117 VVTEFKRNGIRTSLFVD--PVEAMVTAAAATGTDRVELYTEGYASQY-------ALGNKT 167

Query: 183 AI-----TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKE 237
           A+      A  AQK+ L +NAGHDL++ N+      IP + E+S+GHA    AL  G++ 
Sbjct: 168 AVEPYVKAALEAQKVGLGLNAGHDLSLDNLKYFKEQIPNLLEVSIGHALICEALYLGLEN 227

Query: 238 AVFCF 242
            +  +
Sbjct: 228 VIQLY 232


>gi|260220754|emb|CBA28635.1| Pyridoxine 5'-phosphate synthase [Curvibacter putative symbiont of
           Hydra magnipapillata]
          Length = 249

 Score =  165 bits (418), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 96/247 (38%), Positives = 135/247 (54%), Gaps = 9/247 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M T +SVNLN VA++RN R+L  P++     + L++GA+G+TVHPRPD RHIR  D+ ++
Sbjct: 1   MKTHLSVNLNKVALVRNTRHLGIPSVTRAATLCLEAGAAGITVHPRPDARHIRAQDVLDL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFL----NLCERYKP-EQITLVPDDPHQLTSDHGWDFLQ 115
             L+ + +P  E N+EG P    +    +L +R  P  Q+T VPD   Q TSDHGW F  
Sbjct: 61  AALL-KAWPDREFNVEGNPFHNLMDCVRDLRQRGLPVHQVTFVPDSEGQFTSDHGWSFPA 119

Query: 116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE 175
           +   L   +A  H L  R+SLF D +    ++ AAK  GAD IELYT P+ A +    Q+
Sbjct: 120 DAERLKPLIAEAHALNLRVSLFMDADPT--AMAAAKEVGADRIELYTEPFAAAWGTADQQ 177

Query: 176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
                  A          L +NAGHDL   N+      +P + E+S+GHA  A ALE G 
Sbjct: 178 AQLDLFAAAAQAALDAG-LGVNAGHDLNRDNLTAFAQQVPGLQEVSIGHALIADALELGY 236

Query: 236 KEAVFCF 242
              +  +
Sbjct: 237 TATIHGY 243


>gi|119505062|ref|ZP_01627138.1| pyridoxal phosphate biosynthetic protein [marine gamma
           proteobacterium HTCC2080]
 gi|119459044|gb|EAW40143.1| pyridoxal phosphate biosynthetic protein [marine gamma
           proteobacterium HTCC2080]
          Length = 253

 Score =  165 bits (417), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 96/261 (36%), Positives = 145/261 (55%), Gaps = 24/261 (9%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++S+NLN +A++RN R    PN+V   ++ + +GA G+TVHPRPDQRHIR  D  +++ 
Sbjct: 2   TALSINLNKIALVRNSRVTTVPNIVSHAEMCISAGADGITVHPRPDQRHIRAQDCFDLQS 61

Query: 63  LIDEQFPKAELNIEGYPNET--------------FLNLCERYKPEQITLVPDDPHQLTSD 108
            +D      ELNIEG P                 F+ L +   P Q+TLVPD   QLTSD
Sbjct: 62  ALD-----VELNIEGNPFTEPRASDQPHVGDYPGFIALVQAISPAQVTLVPDSDQQLTSD 116

Query: 109 HGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC 168
           HG+D  ++   L   +    +LG R+SLF D + +  +  A+   GAD IELYT  Y   
Sbjct: 117 HGFDVARDGKRLEPLIKIFKDLGCRVSLFMDPDPSAMATVAS--LGADRIELYTESYARA 174

Query: 169 YNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAA 228
           +     E + L     TA+ A    L +NAGHDL + N+P+    +P++ E+S+GH+F  
Sbjct: 175 HEVGDFE-VSLAAFQETAEAAFAARLGVNAGHDLNLSNLPDF--KVPHLEEVSIGHSFTV 231

Query: 229 TALECGVKEAVFCFRRACGQH 249
            AL  G+   +  +++A G++
Sbjct: 232 DALRWGIANTIPRYQQALGKN 252


>gi|254786478|ref|YP_003073907.1| pyridoxine 5'-phosphate synthase [Teredinibacter turnerae T7901]
 gi|237683544|gb|ACR10808.1| pyridoxine 5-phosphate synthase [Teredinibacter turnerae T7901]
          Length = 255

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 101/252 (40%), Positives = 142/252 (56%), Gaps = 12/252 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+SVNLN +A+LRN R+  +P++V  GK ++ +G  GLTVHPRPDQRHIR  D+ E+  L
Sbjct: 5   SLSVNLNKIALLRNSRDGDFPSVVEFGKRSIAAGVQGLTVHPRPDQRHIRPHDVRELADL 64

Query: 64  IDEQFPK-AELNIEGYP----NETFLNLCE---RYKPEQITLVPDDPHQLTSDHGWDFLQ 115
           + +   +  E NIEG P     + +  L E     +P Q TLVPD   Q TSDHG+D  +
Sbjct: 65  VRQHAAQHLEFNIEGNPFAPARDDYPGLVELAIETQPHQCTLVPDSDAQKTSDHGFDLNE 124

Query: 116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE 175
           +   L   + RL N G R+SLF D +  +  L AAKL GAD IELYTGP+   +      
Sbjct: 125 SGDKLQPLITRLKNAGIRVSLFMDPDLAQIEL-AAKL-GADRIELYTGPFAHAFTESGDA 182

Query: 176 -RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG 234
            +      +  A  A ++ + +NAGHDL + N+  L N +P + E+S+GHA    AL  G
Sbjct: 183 GQAVFEAHSKAAIRATELGMGVNAGHDLNLDNM-QLYNQLPGLLEVSIGHALTVDALLMG 241

Query: 235 VKEAVFCFRRAC 246
               +  +   C
Sbjct: 242 FDNTIAAYLAVC 253


>gi|146299455|ref|YP_001194046.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacterium
           johnsoniae UW101]
 gi|189036748|sp|A5FJ95|PDXJ_FLAJO RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|146153873|gb|ABQ04727.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacterium
           johnsoniae UW101]
          Length = 237

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 91/242 (37%), Positives = 134/242 (55%), Gaps = 9/242 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+L+ +     + G  G+T+HPRPD+RHIRY D  +++ 
Sbjct: 2   TKLSVNINKIATLRNARGGNVPDLLKVAADIQRFGGQGITIHPRPDERHIRYQDARDLKA 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++       E NIEG P   F++L    KP+Q+TLVPD    +TS  GWD ++NQ  L +
Sbjct: 62  IV-----TTEYNIEGNPQHNFIDLVLECKPDQVTLVPDAIGAITSSAGWDTIKNQEYLKE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +      G R S+F D       ++ AK TG D IELYT  +   Y+   +  I  +  
Sbjct: 117 VIQEFQRNGIRTSIFVD--PVLEMIEGAKKTGTDRIELYTEAFAHQYDLGNKNGI--DPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+LA ++ L INAGHDL++ NI      IP + E+S+GHA  + AL  G+   V  +
Sbjct: 173 VKAAELANELGLGINAGHDLSLDNIQFFKQNIPGLLEVSIGHALISEALYLGLDNVVNMY 232

Query: 243 RR 244
            +
Sbjct: 233 LK 234


>gi|126663132|ref|ZP_01734130.1| pyridoxal phosphate biosynthetic protein [Flavobacteria bacterium
           BAL38]
 gi|126624790|gb|EAZ95480.1| pyridoxal phosphate biosynthetic protein [Flavobacteria bacterium
           BAL38]
          Length = 237

 Score =  164 bits (415), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 90/240 (37%), Positives = 137/240 (57%), Gaps = 9/240 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+L+ + K   Q GA G+T+HPRPD+RHIRY D  +++ 
Sbjct: 2   TKLSVNINKIATLRNSRGGNVPDLLKVAKDIQQFGAQGITIHPRPDERHIRYQDARDLKP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++       E NIEG P   F++L    KP Q+TLVPD    LTS+ GWD +++Q+ L +
Sbjct: 62  VV-----YTEYNIEGNPQHNFIDLVLECKPTQVTLVPDAIGALTSNAGWDTIKHQSYLLE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +        R S+F D   +E  ++ AK TG + IELYT  +   +    +  I  +  
Sbjct: 117 VIQEFQRNNIRTSIFVD--ADERMIEGAKATGTERIELYTESFAHEFGLGNKAGI--DSY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
             +A  A ++ L INAGHDL++ NI    + IP + E+S+GHA  + +L  G++  V  +
Sbjct: 173 VKSALKANELGLGINAGHDLSLDNIKFFKDNIPGLLEVSIGHALISESLYLGLENVVNMY 232


>gi|285016834|ref|YP_003374545.1| pyridoxal phosphate biosynthetic protein PdxJ [Xanthomonas
           albilineans GPE PC73]
 gi|283472052|emb|CBA14559.1| probable pyridoxal phosphate biosynthetic protein pdxj (pnp
           synthase) [Xanthomonas albilineans]
          Length = 255

 Score =  164 bits (414), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 100/248 (40%), Positives = 138/248 (55%), Gaps = 12/248 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +AVLRN R    P+++   +  L +GA G+TVHPRPD+RHI   D   +  
Sbjct: 2   TKLSVNVNKIAVLRNSRGGELPSVLDAARACLDAGAHGITVHPRPDRRHIHAEDALALAE 61

Query: 63  LIDEQFPKAELNIEGYPNE-------TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQ 115
           L   Q    E NIEG P           + LC + +P Q TLVPD   QLTSDHG+DF +
Sbjct: 62  LT--QAHGVEFNIEGNPFAPLRPGYPGLIALCAQARPTQATLVPDGDSQLTSDHGFDFGR 119

Query: 116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ-Q 174
           +   L   +A L  LG R+SLF D +  + ++ AA+L GAD IELYTGPY A +      
Sbjct: 120 DSDRLRPLIAELKALGCRVSLFVDADNPDLAI-AAEL-GADRIELYTGPYAAAFERGDGA 177

Query: 175 ERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG 234
                 + A  A+ AQ + L +NAGHDL+  N+   +  +P + E+S+GHA    AL  G
Sbjct: 178 AATMAARFAAAARRAQTLGLGVNAGHDLSQANLDMFLAQVPQVLEVSIGHALIGEALYAG 237

Query: 235 VKEAVFCF 242
           +   V  +
Sbjct: 238 LDATVKAY 245


>gi|305665183|ref|YP_003861470.1| pyridoxal phosphate biosynthetic protein [Maribacter sp. HTCC2170]
 gi|88709935|gb|EAR02167.1| pyridoxal phosphate biosynthetic protein [Maribacter sp. HTCC2170]
          Length = 237

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 89/240 (37%), Positives = 134/240 (55%), Gaps = 9/240 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PNL  + +     GA G+TVHPRPD+RHI+Y D  ++++
Sbjct: 2   TKLSVNINKIATLRNSRGGNIPNLTKVAQDIESFGAQGITVHPRPDERHIKYQDARDLKK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++       E NIEG P + F++L    +P Q+TLVPD    +TS+ GW+ ++++  L +
Sbjct: 62  IV-----ATEYNIEGNPIQKFIDLVLEVRPTQVTLVPDAEDAITSNAGWNTVKHKDFLKE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +      G R S+F D   +   ++ A  TG D IELYT  +   +   + E I   K 
Sbjct: 117 VINTFKQNGIRTSIFVD--PDVKMIEGAAKTGTDRIELYTESFAENFGQEKSESIKPFKE 174

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A++A K+ L INAGHDL + NI      IP + E+S+GHA    +L  G+   V  +
Sbjct: 175 A--AKIAAKLGLGINAGHDLNLDNIKYFKEHIPNLLEVSIGHALICESLYFGLDNVVKMY 232


>gi|91789482|ref|YP_550434.1| pyridoxine 5'-phosphate synthase [Polaromonas sp. JS666]
 gi|91698707|gb|ABE45536.1| pyridoxine 5'-phosphate synthase [Polaromonas sp. JS666]
          Length = 271

 Score =  163 bits (412), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 95/247 (38%), Positives = 139/247 (56%), Gaps = 9/247 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T++SVN+N VA+LRN R++  P+++   ++ L++GA G+TVHPRPD+RHIR  D+ E+  
Sbjct: 19  TALSVNINKVALLRNTRHIDIPSVLRAAELCLEAGAQGITVHPRPDERHIRPDDVYELAA 78

Query: 63  LIDEQFPKAELNIEGYPNETFL----NLCERYKP-EQITLVPDDPHQLTSDHGWDFLQNQ 117
           L+ + +P  E NIEG P +  +    +L  R  P  Q T VPD   Q TSDHGW F  + 
Sbjct: 79  LM-KDWPDREFNIEGNPFQNLMGFVRDLTARGLPLHQCTFVPDSEDQFTSDHGWSFPADA 137

Query: 118 ALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI 177
             L   + + H    R+SLF D      ++ A K  GAD +E YT  Y    +  ++   
Sbjct: 138 DRLQPLIEQAHARSVRVSLFMDPVAE--AMAAVKAVGADRVEFYTESYARASSGTERSEA 195

Query: 178 FLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKE 237
            L + A  A+ A  + L INAGHDL   N+   + ++P + E+S+GHA  A ALE G   
Sbjct: 196 -LGRFASAARAAAALGLGINAGHDLNRDNLTAFLRSVPGVQEVSIGHALIADALELGYTA 254

Query: 238 AVFCFRR 244
            V  + R
Sbjct: 255 TVKDYLR 261


>gi|167752330|ref|ZP_02424457.1| hypothetical protein ALIPUT_00574 [Alistipes putredinis DSM 17216]
 gi|167660571|gb|EDS04701.1| hypothetical protein ALIPUT_00574 [Alistipes putredinis DSM 17216]
          Length = 238

 Score =  162 bits (411), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 88/242 (36%), Positives = 137/242 (56%), Gaps = 9/242 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +AV+RN R    P++V       + GA G+TVHPRPD RHIRY+D+ ++++
Sbjct: 2   TKLSVNINKIAVVRNSRGGNLPDVVRAALDCERFGAQGITVHPRPDARHIRYSDVRDLKK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEG P  +F  L    +P Q+TLVPD  + +TS+ GW+ ++ +  L +
Sbjct: 62  VLTTEF-----NIEGNPIPSFRELVLEVRPAQVTLVPDAENAITSNAGWNTVKYRDFLRE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
             A     G R+S+F D       +  AK  GAD +ELYT  Y   +   ++  I     
Sbjct: 117 VTAEFQAGGIRVSIFVDPVA--EMVAGAKECGADRVELYTEAYARDFAAGRERAI--EPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+ A++  L +NAGHDL ++N+   +  IP+  E+S+GHA    AL  G++  V  +
Sbjct: 173 VRAAEEARRCGLGLNAGHDLNLENLRYFVERIPWTDEVSIGHALICDALYYGLENTVRLY 232

Query: 243 RR 244
           RR
Sbjct: 233 RR 234


>gi|225010442|ref|ZP_03700913.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacteria
           bacterium MS024-3C]
 gi|225005271|gb|EEG43222.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacteria
           bacterium MS024-3C]
          Length = 238

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 90/243 (37%), Positives = 135/243 (55%), Gaps = 8/243 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P+L+       + GA G+T+HPRPD+RHIRY D  E++ 
Sbjct: 2   TKLSVNINKLATLRNARGGNVPDLLVSASDIERFGAEGITIHPRPDERHIRYKDARELKN 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  ++     NIEG PNE F+ L    KP Q+TLVPD    +TS+ GWD + +   L  
Sbjct: 62  VVTTEY-----NIEGNPNEKFIALVLDVKPTQVTLVPDAVDAITSNAGWDAITHADFLKN 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
           T+AR    G R S+F D    +  ++AA  TG D +ELYT  Y   ++   +E       
Sbjct: 117 TIARFKAAGIRTSIFIDPVITQ--IEAAAATGTDRVELYTEAYAKGFDQGNKEAAIAPYK 174

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A   + A+ + L +NAGHDL++ NI      I  + E+S+GHA    +L  G++  +  +
Sbjct: 175 AAATK-ARSLGLGVNAGHDLSLDNIGFFKAEIKELDEVSIGHALICESLYLGLENVIPMY 233

Query: 243 RRA 245
            +A
Sbjct: 234 LKA 236


>gi|149279012|ref|ZP_01885146.1| pyridoxal phosphate biosynthetic protein PdxJ [Pedobacter sp.
           BAL39]
 gi|149230291|gb|EDM35676.1| pyridoxal phosphate biosynthetic protein PdxJ [Pedobacter sp.
           BAL39]
          Length = 252

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 94/241 (39%), Positives = 140/241 (58%), Gaps = 10/241 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +SVN+N +A LRN R    P+LV +   A + GA G+TVHPRPD+RHI Y D+ +++ +I
Sbjct: 16  LSVNINKIATLRNSRGGNNPDLVKVALDAERFGAEGITVHPRPDERHILYQDVFDLKAVI 75

Query: 65  DEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
             +F     NIEG   E  F++L    KP Q+TLVPD   Q+TS+HGWD +++Q  L + 
Sbjct: 76  ATEF-----NIEGNCREQKFVDLVLANKPAQVTLVPDVEGQITSNHGWDTIKHQEYLKEM 130

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
                + G R+S+F D +     ++AA L+G D IELYT  Y   Y   Q +   +    
Sbjct: 131 TGIFQSAGIRVSIFVDPDVK--IVEAAALSGTDRIELYTEAYAHQYQ--QNKEAAIAPYI 186

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A+ A ++ L INAGHDL + N+    + IP + E+S+GHA  + AL  G++  +  + 
Sbjct: 187 AAAEKANELGLGINAGHDLDLNNLAYFASNIPGLLEVSIGHALVSDALYLGLENTIQLYL 246

Query: 244 R 244
           R
Sbjct: 247 R 247


>gi|162454115|ref|YP_001616482.1| pyridoxine 5'-phosphate synthase [Sorangium cellulosum 'So ce 56']
 gi|161164697|emb|CAN96002.1| Pyridoxine-5-phosphate synthase [Sorangium cellulosum 'So ce 56']
          Length = 245

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 94/236 (39%), Positives = 132/236 (55%), Gaps = 7/236 (2%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            +SVN+N +A+LRN R    PN++   +  +  GA G+T+HPR D+RHI     P+  R 
Sbjct: 2   KLSVNVNKIALLRNSRGHDAPNVLSFARKIVDYGAHGITIHPRADRRHI----TPDDARA 57

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +       E N EG   E FL+L    +P Q TLVP  P +LTS  GWD  + + +L   
Sbjct: 58  VTRHITTVETNFEGDLREEFLDLTLELRPTQCTLVPVTPGELTSHRGWDVAKWRFVLQPV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL   G R SLF + +     L A    GAD IE+YTGPY   ++   + R  L+K+ 
Sbjct: 118 VKRLKEEGIRTSLFVEADPAVVPLVAE--MGADRIEIYTGPYAQAFDR-GEHRAELDKIV 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            T + A    + INAGHDLT++N+  L+   P I E+S+GH   A ALE G+K++V
Sbjct: 175 ATVRAAVAAGVGINAGHDLTVENLAPLVREAPQIQEVSIGHHLVAHALEVGMKQSV 230


>gi|260063798|ref|YP_003196878.1| pyridoxine 5'-phosphate synthase [Robiginitalea biformata HTCC2501]
 gi|88783243|gb|EAR14416.1| pyridoxal phosphate biosynthetic protein [Robiginitalea biformata
           HTCC2501]
          Length = 237

 Score =  162 bits (410), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 86/239 (35%), Positives = 134/239 (56%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +SVN+N +A LRN R    P+L+   +     GA G+T+HPRPD+RHIRY D  +++ ++
Sbjct: 4   LSVNVNKIATLRNARGGNVPDLLQAVRDIEVFGAQGITIHPRPDERHIRYRDARDLKSVV 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                  ELNIEG P   F++L     P+Q+TLVPD P  +TS+ GWD ++++  L + +
Sbjct: 64  -----GTELNIEGNPIPAFVDLVLEVAPDQVTLVPDAPDAITSNAGWDTVRHRDFLQEVI 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +  + G R S+F D   +    +AA  TG D IELYT  Y   Y    +  +       
Sbjct: 119 GKFRDAGIRTSIFVD--PDPQMARAAAETGTDRIELYTESYATHYGTDPEAAV--KPFRE 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
           TA+ A  + L +NAGHDL + NI      +P++ E+S+GHA    +L  G++  +  ++
Sbjct: 175 TAEAAASVGLGVNAGHDLNLDNIAFFARQVPHLLEVSIGHALICESLYLGLENVIGMYK 233


>gi|319953657|ref|YP_004164924.1| pyridoxine 5'-phosphate synthase [Cellulophaga algicola DSM 14237]
 gi|319422317|gb|ADV49426.1| pyridoxine 5'-phosphate synthase [Cellulophaga algicola DSM 14237]
          Length = 242

 Score =  162 bits (410), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 92/243 (37%), Positives = 130/243 (53%), Gaps = 10/243 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    PNL+ + K     GA G+T+HPRPD+RHIRY D  E++ 
Sbjct: 2   TKLSVNINKIATLRNARGGNVPNLLVVAKDIEDFGAQGITIHPRPDERHIRYADARELKD 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +       E NIEG PN+ F+ L    KP Q+TLVPD    +TS+ GW+ +++   L  
Sbjct: 62  TV-----MTEYNIEGNPNKNFIALVLDVKPTQVTLVPDAEDAITSNAGWNTIKHHDFLKD 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY---NNPQQERIFL 179
            +      G R S+F D   +   ++ A   GAD IELYT  +   Y    N + +   +
Sbjct: 117 VIKTFKENGIRTSIFVD--PDTAMVEGAAKVGADRIELYTESFAHNYGIAKNLEDKNAAI 174

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                 A+ A K+ L INAGHDL++ NI      IP + E+S+GHA    AL  G+   V
Sbjct: 175 QPFIDAAKTATKLGLGINAGHDLSLDNIKFFKENIPNLLEVSIGHALICEALYFGLDNVV 234

Query: 240 FCF 242
             +
Sbjct: 235 NMY 237


>gi|254515172|ref|ZP_05127233.1| pyridoxal phosphate biosynthesis protein PdxJ [gamma
           proteobacterium NOR5-3]
 gi|219677415|gb|EED33780.1| pyridoxal phosphate biosynthesis protein PdxJ [gamma
           proteobacterium NOR5-3]
          Length = 254

 Score =  162 bits (409), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 96/251 (38%), Positives = 140/251 (55%), Gaps = 16/251 (6%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++SVNLN +A++RN R+   P++    ++ + +GA G+TVHPRPDQRHIR  D  ++  +
Sbjct: 3   ALSVNLNKIALIRNSRDTVIPSVTEHAQMCIDAGADGITVHPRPDQRHIRADDCRDLAAM 62

Query: 64  IDEQF---------PKAE--LNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWD 112
           ++ +F         P+A     +  YP   F+ L    +P Q TLVPD   QLTSDHG+D
Sbjct: 63  LNVEFNIEGNPFAGPRASDRKGVSDYPG--FMELVRELRPAQCTLVPDGDAQLTSDHGFD 120

Query: 113 FLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP 172
             ++   L   VA L  LG R SLF D + ++ SL AAK+ GAD IELYT  +       
Sbjct: 121 LHRDAEALQPIVAELRELGVRSSLFMDPDPSQMSL-AAKI-GADRIELYTESFAVAVATG 178

Query: 173 QQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALE 232
                   +   +A+ A +  L INAGHDL +QN+P     +P + E+S+GHA    AL 
Sbjct: 179 DGAAQSYQRFKDSAEAALEAGLGINAGHDLNLQNLP-YFRELPGLLEVSIGHALTVDALS 237

Query: 233 CGVKEAVFCFR 243
            G+  AV  ++
Sbjct: 238 MGMPAAVAAYQ 248


>gi|254481927|ref|ZP_05095170.1| pyridoxal phosphate biosynthesis protein PdxJ [marine gamma
           proteobacterium HTCC2148]
 gi|214038056|gb|EEB78720.1| pyridoxal phosphate biosynthesis protein PdxJ [marine gamma
           proteobacterium HTCC2148]
          Length = 253

 Score =  161 bits (407), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 93/259 (35%), Positives = 142/259 (54%), Gaps = 22/259 (8%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++SVNLN VA++RN R+   P++    ++ + +GA G+TVHPRPDQRHIR  D  ++  +
Sbjct: 3   ALSVNLNKVALIRNSRDTTNPSVPGHAQMCIDAGADGITVHPRPDQRHIRTQDCFDLAGM 62

Query: 64  IDEQFPKAELNIEGYPNE--------------TFLNLCERYKPEQITLVPDDPHQLTSDH 109
           +       E NIEG P                 F+ L +  +P Q TLVPD   QLTSDH
Sbjct: 63  L-----TVEFNIEGNPMTGPRKSDRSGVGDYPGFMALVKEIRPAQCTLVPDTDGQLTSDH 117

Query: 110 GWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY 169
           G+D  ++   +   + +L +LG R SLF D +  +  L A   TG D IELYT  Y   +
Sbjct: 118 GFDLKKDGDTVAPLIEQLQSLGIRTSLFMDPDPEQIRLAAQ--TGTDRIELYTETYADAF 175

Query: 170 NNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAAT 229
            + ++    L+     A++A +  L +NAGHDL ++N+P     IP + E+S+GHA    
Sbjct: 176 KSGKELEETLHLFVTAAEVAAEEGLGVNAGHDLDLKNLPRFAK-IPGLLEVSIGHALTVD 234

Query: 230 ALECGVKEAVFCFRRACGQ 248
           A+  G+   V  +++A G+
Sbjct: 235 AIRMGLAPTVAAYQQALGK 253


>gi|313206068|ref|YP_004045245.1| pyridoxine 5'-phosphate synthase [Riemerella anatipestifer DSM
           15868]
 gi|312445384|gb|ADQ81739.1| pyridoxine 5'-phosphate synthase [Riemerella anatipestifer DSM
           15868]
 gi|315022381|gb|EFT35409.1| pyridoxine 5'-phosphate synthase [Riemerella anatipestifer RA-YM]
 gi|325336491|gb|ADZ12765.1| Pyridoxal phosphate biosynthesis protein [Riemerella anatipestifer
           RA-GD]
          Length = 239

 Score =  160 bits (404), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 136/246 (55%), Gaps = 9/246 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P++  +   A + GA G+T+HPRPD+RHI   D+ +++ 
Sbjct: 2   TKLSVNINKIATLRNARGGDVPSVTQVAIDAQKFGAQGITIHPRPDERHITRKDVYDLKP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+  +F     NIEG P+  F+++    KPEQ+TLVPD    +TS+ GWD   +   L  
Sbjct: 62  LVTTEF-----NIEGNPHRPFIDMVLEVKPEQVTLVPDADDAITSNAGWDCKMHLDFLKN 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A     G R S+F D   N   ++ A  TG D IELYT  Y   Y   +++ I     
Sbjct: 117 VIAEFKAEGIRTSIFLD--PNPEMVKYAAETGTDRIELYTEAYAKGYTKNREQAIL--PY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
             TA+ A    L INAGHDL+++N+    + IP + E+S+GHA  + AL  G++  +  +
Sbjct: 173 IKTAEEAINNGLGINAGHDLSLENLKYFSDEIPNLLEVSIGHALISEALYLGLENTIQSY 232

Query: 243 RRACGQ 248
            +   +
Sbjct: 233 LKRLAK 238


>gi|183219894|ref|YP_001837890.1| pyridoxine 5'-phosphate synthase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Paris)']
 gi|189910020|ref|YP_001961575.1| pyridoxine 5'-phosphate synthase [Leptospira biflexa serovar Patoc
           strain 'Patoc 1 (Ames)']
 gi|238687800|sp|B0SJ25|PDXJ_LEPBP RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|238687832|sp|B0SBH6|PDXJ_LEPBA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|167774696|gb|ABZ92997.1| Pyridoxal phosphate biosynthesis protein [Leptospira biflexa
           serovar Patoc strain 'Patoc 1 (Ames)']
 gi|167778316|gb|ABZ96614.1| Pyridoxal phosphate biosynthetic protein PdxJ (PNP synthase)
           [Leptospira biflexa serovar Patoc strain 'Patoc 1
           (Paris)']
          Length = 260

 Score =  159 bits (402), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 96/258 (37%), Positives = 144/258 (55%), Gaps = 20/258 (7%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTD---LPE 59
           T +SVN+N +A LRN R    P+++ + ++ L SGA G+TVHPR D+RHI   D   L E
Sbjct: 2   TQLSVNVNKIATLRNSRGGSLPSVLKLSELILDSGAHGITVHPRSDERHITKQDVFELQE 61

Query: 60  IRRLIDEQ-----FPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFL 114
             R  +E+       K E NIEG P+E FL+L  + KP+Q TLVP  P ++TSDHG+ F 
Sbjct: 62  FLRTYNEKITKLGISKKEYNIEGEPSERFLDLVLKAKPDQATLVPVKPGEITSDHGFQFA 121

Query: 115 QNQAL--LTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP 172
             +    L   V  +   G R+SLF + +   +    A   GA+ IELYTGP+   ++  
Sbjct: 122 DQKTFSTLKPIVEAIRKEGIRVSLFMETDFTFYDQVVA--LGAERIELYTGPFAHAFDLS 179

Query: 173 QQ--ERIFLN--KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAA 228
           ++  + IF +  + AI    A K+ L +NAGHDL   N+  +   +PY+ E+S+GH   A
Sbjct: 180 EEKGKEIFTDYQRAAIE---ANKLGLAVNAGHDLDTNNL-RVFAKLPYLKEVSIGHRLMA 235

Query: 229 TALECGVKEAVFCFRRAC 246
            +L  G++  V  + +  
Sbjct: 236 QSLVDGLETTVKSYLKVL 253


>gi|255535997|ref|YP_003096368.1| pyridoxine 5'-phosphate synthase [Flavobacteriaceae bacterium
           3519-10]
 gi|255342193|gb|ACU08306.1| Pyridoxine 5'-phosphate synthase [Flavobacteriaceae bacterium
           3519-10]
          Length = 258

 Score =  158 bits (400), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 137/246 (55%), Gaps = 9/246 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             +SVN+N +A LRN R    P++        + GA G+T+HPRPD+RHI   D+ +++ 
Sbjct: 21  VKLSVNINKIATLRNARGGELPSVTEAAVKLQEFGAYGITIHPRPDERHITRKDVYDLKP 80

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +  +F     NIEG P++ F++L    KPEQ+TLVPD    +TS+ GWD   +   L  
Sbjct: 81  HVHTEF-----NIEGNPHQPFIDLVLDVKPEQVTLVPDAEDAITSNAGWDCEVHMDFLKN 135

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A+  N G R S+F D N     ++ AK TG D IELYT  Y   Y+  ++  I     
Sbjct: 136 VIAQFKNAGIRTSIFLDPNPG--MVKFAKETGTDRIELYTEAYARNYSEDKEAAI--RSY 191

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
             TA  A++  L +NAGHDL+++N+    + IP + E+S+GHA  + AL  G++  V  +
Sbjct: 192 VETALEAERHGLGVNAGHDLSLENLKYFADNIPNLLEVSIGHALISEALYMGLENTVQSY 251

Query: 243 RRACGQ 248
            +   +
Sbjct: 252 LKRLAK 257


>gi|300776777|ref|ZP_07086635.1| pyridoxine 5'-phosphate synthase [Chryseobacterium gleum ATCC
           35910]
 gi|300502287|gb|EFK33427.1| pyridoxine 5'-phosphate synthase [Chryseobacterium gleum ATCC
           35910]
          Length = 239

 Score =  158 bits (399), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 89/246 (36%), Positives = 137/246 (55%), Gaps = 9/246 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +A LRN R    P++        + G  G+T+HPRPD+RHI   D+ +++ 
Sbjct: 2   TKLSVNINKIATLRNARGGETPSVTEAAVKIQEFGGQGITIHPRPDERHITRKDVYDLKP 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L+  +F     NIEG P+++F+++    KPEQ+TLVPD    +TS+ GWD  ++   LT+
Sbjct: 62  LVATEF-----NIEGNPHKSFIDMVLDVKPEQVTLVPDADDAITSNAGWDTKKHLDYLTE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +A     G R S+F D       ++ A  TGAD IELYT  Y   Y   +++ I     
Sbjct: 117 IIAEFKKAGIRTSIFLD--PLPELVEYAAKTGADRIELYTEAYAKNYLTNKEQAI--KPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
             TA  A    L INAGHDL+++N+    + IP + E+S+GHA  + AL  G++  V  +
Sbjct: 173 YDTAVEATNFGLGINAGHDLSLENLKYFADNIPNLLEVSIGHALVSEALYMGLENTVQAY 232

Query: 243 RRACGQ 248
            +   +
Sbjct: 233 LKRLAK 238


>gi|229497114|ref|ZP_04390818.1| pyridoxine 5'-phosphate synthase [Porphyromonas endodontalis ATCC
           35406]
 gi|229316039|gb|EEN81968.1| pyridoxine 5'-phosphate synthase [Porphyromonas endodontalis ATCC
           35406]
          Length = 239

 Score =  158 bits (399), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 90/241 (37%), Positives = 139/241 (57%), Gaps = 8/241 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N VA +RN R    PN++ +     + GA G+TVHPRPD+RHIRY D+  +++
Sbjct: 2   TKLSVNINKVATIRNARGGNIPNVLQVALNCERFGAQGITVHPRPDERHIRYADVRALKQ 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEG P  +F++L     P Q+TLVPD P  LTSD GW+  Q+   L  
Sbjct: 62  VLSTEF-----NIEGNPIPSFVDLVLEVVPAQVTLVPDAPDALTSDAGWEVDQHFDFLRD 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
           T+ R    G R S+F  G   ++  +AA   G   +ELYT PY   +   + E + + + 
Sbjct: 117 TIRRFEAEGIRTSIFV-GTDLDNIARAAD-AGCRRVELYTEPYATAFLEGEVEPV-IERF 173

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A+ A    L++NAGHDL + N+   +  +  ++E+S+GHA  + AL  G++E +  +
Sbjct: 174 ARAAEHAAACGLEVNAGHDLNLDNLNYFVRRVQPLAEVSIGHALISDALYLGLEETIRRY 233

Query: 243 R 243
           R
Sbjct: 234 R 234


>gi|319785632|ref|YP_004145107.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudoxanthomonas
           suwonensis 11-1]
 gi|317464144|gb|ADV25876.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudoxanthomonas
           suwonensis 11-1]
          Length = 251

 Score =  157 bits (397), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 100/247 (40%), Positives = 137/247 (55%), Gaps = 12/247 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +SVN+N +AVLRN R    P+++   +  L +GA G+TVHPRPD+RH+   DL  +  
Sbjct: 2   TRLSVNVNKIAVLRNSRGGGEPDVLAAARACLAAGAHGITVHPRPDRRHVVAEDLAPLAD 61

Query: 63  LIDEQFPKAELNIEGY----PNETF---LNLCERYKPEQITLVPDDPHQLTSDHGWDFLQ 115
                    E NIEG     P E +   L LCE+ +P Q+TLVPD   QLTSDHG+    
Sbjct: 62  ATARY--GVEFNIEGNPFAPPREGYPGLLALCEQVRPAQVTLVPDSDGQLTSDHGFALEG 119

Query: 116 NQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE 175
           + A L   VA    LG R+SLF D  GN H  + A++ GA  IE+YTGPY   +   +  
Sbjct: 120 DLAGLADQVAGFAALGCRVSLFVDA-GNPHVERVAEV-GAHRIEIYTGPYAEAHATGRAG 177

Query: 176 RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
              L   A TA+ AQ   L +NAGHDL+  N+ + +  +P + E+S+GHA    AL  G+
Sbjct: 178 EA-LALCAETARRAQAAGLGVNAGHDLSQANLGDFLAGVPGVEEVSIGHALIGEALYAGL 236

Query: 236 KEAVFCF 242
              V  +
Sbjct: 237 DATVRAY 243


>gi|332529450|ref|ZP_08405409.1| pyridoxine 5'-phosphate synthase [Hylemonella gracilis ATCC 19624]
 gi|332041096|gb|EGI77463.1| pyridoxine 5'-phosphate synthase [Hylemonella gracilis ATCC 19624]
          Length = 260

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 103/258 (39%), Positives = 149/258 (57%), Gaps = 17/258 (6%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +T++SVN+N VA+LRN R+L  P++     + LQ+GA G+TVHPRPD+RHIR  D+ E+ 
Sbjct: 7   TTALSVNVNKVALLRNTRHLDIPSVTRAATLCLQAGAQGITVHPRPDERHIRAHDVHELA 66

Query: 62  RLIDEQFPKAELNIEGYPNETFLNL-----CERYKPEQITLVPDDPHQLTSDHGWDFLQN 116
           +L+ + +P  E NIEG P    ++       +  +P Q T VPD   Q TSDHGW    +
Sbjct: 67  QLL-KAWPDREYNIEGNPFHNLMDFIRDLAAQGMRPHQATFVPDSEGQFTSDHGWQLSNH 125

Query: 117 QALLTKT----VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP 172
            A   K     +A  H LG R+SLF   + +  ++ AA+  GAD +ELYT PY A +   
Sbjct: 126 DAEEAKRLRPLIAECHALGVRVSLFM--DADAQAMAAARALGADRVELYTEPYAAAHGGG 183

Query: 173 QQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALE 232
           +Q    L + A  AQ A+   + +NAGHDL   N+   + A+P + E+S+GHA  A ALE
Sbjct: 184 EQA-AQLQRFAAAAQAARDAGMAVNAGHDLNRDNLTGFLCAVPGVKEVSIGHALIADALE 242

Query: 233 CG----VKEAVFCFRRAC 246
            G    V++ + C R A 
Sbjct: 243 LGYAATVRDYLRCIRDAA 260


>gi|150026129|ref|YP_001296955.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacterium
           psychrophilum JIP02/86]
 gi|149772670|emb|CAL44153.1| Pyridoxal phosphate biosynthetic protein PdxJ [Flavobacterium
           psychrophilum JIP02/86]
          Length = 242

 Score =  157 bits (396), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 92/245 (37%), Positives = 135/245 (55%), Gaps = 20/245 (8%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            +SVN+N +A LRN R    P+L+ +     + GA G+T+HPRPD+RHIRY D  +++++
Sbjct: 7   KLSVNINKIATLRNSRGGNVPDLLKVAADIQKFGAQGITIHPRPDERHIRYQDARDLKQI 66

Query: 64  IDEQFPKAELNIEGYPNE-TFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           +       E NIEG P E +F++L    KP Q+TLVPD    LTS+ GW+ + N+  LT+
Sbjct: 67  V-----YTEYNIEGNPLERSFIDLVLETKPTQVTLVPDGNDNLTSNAGWNTIANKEFLTE 121

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
                     R+S+F D       ++ AK+TG D IELYT  +   Y          NK 
Sbjct: 122 ITQEFQRHNIRVSIFVD--PVLEMIEGAKITGTDRIELYTEAFAHQYG-------LGNKN 172

Query: 183 AI-----TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKE 237
           AI      A LA ++ + +NAGHDL++ NI      IP + E+S+GHA  A +L  G+  
Sbjct: 173 AIEPYTKAAVLAHELGIGVNAGHDLSLDNIQFFNQNIPNLMEVSIGHALIAESLYLGLDN 232

Query: 238 AVFCF 242
            V  +
Sbjct: 233 VVNMY 237


>gi|225012222|ref|ZP_03702659.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacteria
           bacterium MS024-2A]
 gi|225003777|gb|EEG41750.1| pyridoxal phosphate biosynthetic protein PdxJ [Flavobacteria
           bacterium MS024-2A]
          Length = 238

 Score =  156 bits (394), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 91/237 (38%), Positives = 127/237 (53%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
            S+SVN+N VA LRN R    PNL+ + K   + GA G+T+HPRPDQRHIR+ D   +  
Sbjct: 2   VSLSVNINKVATLRNARGGNVPNLLEVTKDLQRYGAQGITIHPRPDQRHIRFEDAFALPN 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++  +F     NIEG P   F+ +    +P Q+TLVPD    LTS+ GWD L N+  LT 
Sbjct: 62  VVTTEF-----NIEGNPIPEFIEMVLEIRPTQVTLVPDGNDVLTSNAGWDTLTNKDFLTP 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            + R    G R S+F   N     ++ A   G D IELYT  + + Y+    + I     
Sbjct: 117 IIKRFKEAGIRTSVFV--NPIVEMVEGAFEIGTDRIELYTEAFASRYDQDPNKAI--TPY 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A+ A  + L INAGHDL++ NI      IP + E+S+GHA    +L  G +  +
Sbjct: 173 IDAAKKANLLGLGINAGHDLSLDNIAFFAKNIPGLLEVSIGHALICESLYLGFENVI 229


>gi|88705947|ref|ZP_01103655.1| Pyridoxal phosphate biosynthetic protein PdxJ [Congregibacter
           litoralis KT71]
 gi|88699661|gb|EAQ96772.1| Pyridoxal phosphate biosynthetic protein PdxJ [Congregibacter
           litoralis KT71]
          Length = 254

 Score =  154 bits (390), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 94/256 (36%), Positives = 134/256 (52%), Gaps = 22/256 (8%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++SVNLN VA++RN R+   P++     + + +GA  +TVHPRPDQRHIR  D  ++  +
Sbjct: 3   ALSVNLNKVALIRNSRDTSIPDVPEHATLCIDAGADSITVHPRPDQRHIRADDCRQLAAM 62

Query: 64  IDEQFPKAELNIEGYPNE--------------TFLNLCERYKPEQITLVPDDPHQLTSDH 109
           +  +F     NIEG P                 F+ L    +P Q TLVPD   QLTSDH
Sbjct: 63  LTVEF-----NIEGNPFAGSRASDRKGVSDYPGFMELIRELRPAQCTLVPDGDAQLTSDH 117

Query: 110 GWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY 169
           G+D       L   +A L  LG R SLF D    + ++ A+   GAD IELYT  +    
Sbjct: 118 GFDLHAQADDLEPVLAELRALGVRSSLFMDPVPGQMAIAAS--IGADRIELYTESFAEAV 175

Query: 170 NNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAAT 229
           +  +  +    +   TA  A +  L +NAGHDL +QN+P +   +P + E+S+GHA    
Sbjct: 176 SCGRGVQECFERFRKTADAALEAGLGVNAGHDLNLQNLP-VFRKLPGLMEVSIGHALTVD 234

Query: 230 ALECGVKEAVFCFRRA 245
           AL  G+  AV  +R A
Sbjct: 235 ALRMGMPAAVKAYREA 250


>gi|254281567|ref|ZP_04956535.1| pyridoxal phosphate biosynthesis protein PdxJ [gamma
           proteobacterium NOR51-B]
 gi|219677770|gb|EED34119.1| pyridoxal phosphate biosynthesis protein PdxJ [gamma
           proteobacterium NOR51-B]
          Length = 252

 Score =  154 bits (390), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 98/257 (38%), Positives = 139/257 (54%), Gaps = 24/257 (9%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +S+NLN +A++RN R+   P+++   +  + +GA G+TVHPRPDQRHIR  D  E++ 
Sbjct: 2   TILSINLNKIALIRNSRDTTIPDVLDHARQCIAAGAGGITVHPRPDQRHIRADDCRELKA 61

Query: 63  LIDEQFPKAELNIEGYP--------------NETFLNLCERYKPEQITLVPDDPHQLTSD 108
            ID      ELNIEG P                 F+ L E  +P Q TLVPD   QLTSD
Sbjct: 62  GID-----VELNIEGNPFAPPRSSDRAGVSDYPGFMALVEEVRPAQATLVPDGDAQLTSD 116

Query: 109 HGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC 168
           HG+D   +   L   + +L   G R+SLF D      ++  A+  GAD IELYT  Y   
Sbjct: 117 HGFDLEVDGERLQPVIEQLKAWGCRVSLFMD--PLPEAMAMARDAGADRIELYTERYARA 174

Query: 169 YNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAA 228
           +      +  L      A+ A K+ L +NAGHDL + N+P+    IP   E+S+GHAF  
Sbjct: 175 HAAGDYLQA-LTDYQAAARAAAKVGLGVNAGHDLNLSNLPDF--DIPECLEVSIGHAFTV 231

Query: 229 TALECGVKEAVFCFRRA 245
            AL+ G++ A+  + +A
Sbjct: 232 DALQYGIERAIQLYLQA 248


>gi|329894520|ref|ZP_08270334.1| Pyridoxine 5'-phosphate synthase [gamma proteobacterium IMCC3088]
 gi|328923045|gb|EGG30370.1| Pyridoxine 5'-phosphate synthase [gamma proteobacterium IMCC3088]
          Length = 253

 Score =  152 bits (385), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 96/250 (38%), Positives = 143/250 (57%), Gaps = 23/250 (9%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++SVN+N VA+LRN R+   P++V      +  GA G+TVHPRPDQRHIR  D   +++ 
Sbjct: 3   ALSVNVNKVALLRNSRDTVIPSVVDYALRCIHYGAHGITVHPRPDQRHIRVDDCYALKQA 62

Query: 64  IDEQFPKAELNIEGYPNE--------------TFLNLCERYKPEQITLVPDDPHQLTSDH 109
           +       ELNIEG P                 F+ L +  +P Q TLVPD   QLTSDH
Sbjct: 63  L-----SVELNIEGNPFSPPMPSTRKGVSDYPGFMPLVDAIRPAQCTLVPDANDQLTSDH 117

Query: 110 GWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY 169
           G+D  ++   L   + +L   G R S+F D N +  +L AA L GAD +ELYT  +   +
Sbjct: 118 GFDLERDADKLRPILQQLKEWGVRSSIFVDPNPSTVAL-AADL-GADRVELYTETFAREF 175

Query: 170 NNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAAT 229
              + ++  L   A TA+ A +  L+INAGHDL + N+ +L + +P+++E+S+GHA  A 
Sbjct: 176 EQGRGQQ-SLELFARTAEAAYEAGLEINAGHDLNLDNL-SLFSDLPHLAEVSIGHALTAD 233

Query: 230 ALECGVKEAV 239
           AL  G+++ +
Sbjct: 234 ALYLGLEQTI 243


>gi|262196445|ref|YP_003267654.1| pyridoxine 5'-phosphate synthase [Haliangium ochraceum DSM 14365]
 gi|262079792|gb|ACY15761.1| Pyridoxine 5'-phosphate synthase [Haliangium ochraceum DSM 14365]
          Length = 255

 Score =  147 bits (370), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 91/242 (37%), Positives = 129/242 (53%), Gaps = 5/242 (2%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+ ++SVNLN VA+LRN R    P  V   +  + +GA GLT+H R D+RH R  D+  +
Sbjct: 1   MAINLSVNLNKVALLRNSRGADNPCPVRAAEACIAAGAPGLTLHWREDERHTREGDVRAL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R+L DE+    E N+EG      + +    +  Q TLVP  P ++TSDHGWD  +    L
Sbjct: 61  RKLADER--GVEFNLEGDARPAIVAIALELRVTQFTLVPVTPGEITSDHGWDLPREHDTL 118

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
              + R    G R S+F D      ++ AA  TG D +E+YT PY A +    Q++    
Sbjct: 119 APILERCRAAGVRTSIFMDPVA--ENMAAAARTGVDRVEIYTEPYAAAFGTATQDQALAQ 176

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
             A  A    +  L +NAGHDL + N+P L  A P I E+S+GHA  A AL  G++  V 
Sbjct: 177 TAAAVAAARAR-GLGVNAGHDLDLYNLPLLARAAPGIDEVSIGHALIADALYWGLERTVR 235

Query: 241 CF 242
            +
Sbjct: 236 AY 237


>gi|153208694|ref|ZP_01946941.1| pyridoxal phosphate biosynthetic protein PdxJ [Coxiella burnetii
           'MSU Goat Q177']
 gi|161830213|ref|YP_001597339.1| pyridoxine 5'-phosphate synthase [Coxiella burnetii RSA 331]
 gi|165919311|ref|ZP_02219397.1| pyridoxal phosphate biosynthetic protein PdxJ [Coxiella burnetii
           RSA 334]
 gi|81628700|sp|Q83BL1|PDXJ_COXBU RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|189036746|sp|A9KFA7|PDXJ_COXBN RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|189036747|sp|A9N936|PDXJ_COXBR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|120575805|gb|EAX32429.1| pyridoxal phosphate biosynthetic protein PdxJ [Coxiella burnetii
           'MSU Goat Q177']
 gi|161762080|gb|ABX77722.1| pyridoxal phosphate biosynthetic protein PdxJ [Coxiella burnetii
           RSA 331]
 gi|165916971|gb|EDR35575.1| pyridoxal phosphate biosynthetic protein PdxJ [Coxiella burnetii
           RSA 334]
          Length = 240

 Score =  141 bits (356), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 131/235 (55%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R + +P+ V    +A+++GA G+T+H R D+RHI+  D+  ++R +
Sbjct: 4   LGVNIDHIATLRQARGVDYPDPVEAAMMAIEAGADGITLHLREDRRHIQDDDVRNLKRKL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
               P   +N+E    E  +   E  KPE   LVP+   +LT++ G D    Q  L K  
Sbjct: 64  --TVP---MNLEMATAEDIIQFAEEIKPEHCCLVPEKREELTTEGGLDVAGQQNTLKKVC 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL  +G  +SLF D    E  + AAK  GA  IE++TG Y     + +  +  L ++A 
Sbjct: 119 ARLAKVGIEVSLFID--PEEKQIDAAKAAGAPVIEIHTGHYANAKTDHEHNQ-QLKRIAD 175

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L +NAGH LTI N+ + I AIP I+E+++GH+  +  +  G+ EAV
Sbjct: 176 AAAYADSLGLTVNAGHGLTIHNVQS-IAAIPVINELNIGHSIISRGVLIGLAEAV 229


>gi|209363807|ref|YP_001423906.2| pyridoxine 5'-phosphate synthase [Coxiella burnetii Dugway
           5J108-111]
 gi|212219217|ref|YP_002306004.1| pyridoxine 5'-phosphate synthase [Coxiella burnetii CbuK_Q154]
 gi|215919198|ref|NP_820477.2| pyridoxine 5'-phosphate synthase [Coxiella burnetii RSA 493]
 gi|206584082|gb|AAO90991.2| pyridoxal phosphate biosynthetic protein [Coxiella burnetii RSA
           493]
 gi|207081740|gb|ABS77445.2| pyridoxal phosphate biosynthetic protein [Coxiella burnetii Dugway
           5J108-111]
 gi|212013479|gb|ACJ20859.1| pyridoxal phosphate biosynthetic protein [Coxiella burnetii
           CbuK_Q154]
          Length = 251

 Score =  141 bits (355), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 82/235 (34%), Positives = 130/235 (55%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R + +P+ V    +A+++GA G+T+H R D+RHI+  D+  ++R +
Sbjct: 15  LGVNIDHIATLRQARGVDYPDPVEAAMMAIEAGADGITLHLREDRRHIQDDDVRNLKRKL 74

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   +N+E    E  +   E  KPE   LVP+   +LT++ G D    Q  L K  
Sbjct: 75  -----TVPMNLEMATAEDIIQFAEEIKPEHCCLVPEKREELTTEGGLDVAGQQNTLKKVC 129

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL  +G  +SLF D    E  + AAK  GA  IE++TG Y     + +  +  L ++A 
Sbjct: 130 ARLAKVGIEVSLFID--PEEKQIDAAKAAGAPVIEIHTGHYANAKTDHEHNQ-QLKRIAD 186

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L +NAGH LTI N+ + I AIP I+E+++GH+  +  +  G+ EAV
Sbjct: 187 AAAYADSLGLTVNAGHGLTIHNVQS-IAAIPVINELNIGHSIISRGVLIGLAEAV 240


>gi|212212140|ref|YP_002303076.1| pyridoxine 5'-phosphate synthase [Coxiella burnetii CbuG_Q212]
 gi|212010550|gb|ACJ17931.1| pyridoxal phosphate biosynthetic protein [Coxiella burnetii
           CbuG_Q212]
          Length = 251

 Score =  141 bits (355), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 82/235 (34%), Positives = 130/235 (55%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R + +P+ V    +A+++GA G+T+H R D+RHI+  D+  ++R +
Sbjct: 15  LGVNIDHIATLRQARGVDYPDPVEAAMMAIEAGADGITLHLREDRRHIQDDDVRNLKRKL 74

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   +N+E    E  +   E  KPE   LVP+   +LT++ G D    Q  L K  
Sbjct: 75  -----TVPMNLEMATAEDIIQFAEEIKPEHCCLVPEKREELTTEGGLDVAGQQNTLKKIC 129

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL  +G  +SLF D    E  + AAK  GA  IE++TG Y     + +  +  L ++A 
Sbjct: 130 ARLAKVGIEVSLFID--PEEKQIDAAKAAGAPVIEIHTGHYANAKTDHEHNQ-QLKRIAD 186

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L +NAGH LTI N+ + I AIP I+E+++GH+  +  +  G+ EAV
Sbjct: 187 AAAYADSLGLTVNAGHGLTIHNVQS-IAAIPVINELNIGHSIISRGVLIGLAEAV 240


>gi|270159974|ref|ZP_06188630.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           longbeachae D-4968]
 gi|289165282|ref|YP_003455420.1| Pyridoxal phosphate biosynthetic protein pdxJ [Legionella
           longbeachae NSW150]
 gi|269988313|gb|EEZ94568.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           longbeachae D-4968]
 gi|288858455|emb|CBJ12333.1| Pyridoxal phosphate biosynthetic protein pdxJ [Legionella
           longbeachae NSW150]
          Length = 248

 Score =  140 bits (354), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 84/240 (35%), Positives = 134/240 (55%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R   +P+ V     A ++GA G+T+H R D RHI+  D+  IR+++
Sbjct: 7   LGVNIDHIATVRQARGTRYPDPVQAAIDAEEAGADGITLHMREDLRHIQARDVRLIRQVL 66

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  LN  E   PE   LVP+   +LT++ G D + +  ++ + V
Sbjct: 67  -----QTRMNLELAVTEAMLNFAEEISPEHTCLVPEKREELTTEGGLDIITHHKIVEQAV 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D +  +  ++AA   GA  IEL+TG Y       QQ+   L ++  
Sbjct: 122 RRLQAMGSEVSLFIDPDLEQ--IKAAAEIGAPVIELHTGCYADATGVEQQQH-ELERIKR 178

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A  ++L +NAGH L   N+ + I AI  + E+++GHA  A AL CG+KEAV   R+
Sbjct: 179 AAEYAAGLNLIVNAGHGLNYHNVQS-IAAIKELHELNIGHAIIARALFCGMKEAVRHMRQ 237


>gi|254497720|ref|ZP_05110494.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           drancourtii LLAP12]
 gi|254353067|gb|EET11828.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           drancourtii LLAP12]
          Length = 240

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 132/238 (55%), Gaps = 9/238 (3%)

Query: 7   VNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDE 66
           +N++ +A +R  R   +P+ V     A ++GA G+T+H R D RHI+  D+  I++++  
Sbjct: 1   MNIDHIATVRQARGTRYPDPVQAALDAEEAGADGITLHMREDLRHIQARDVRVIKQVL-- 58

Query: 67  QFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVAR 126
              +  +N+E    E  L+  E   PE   LVP+   +LT++ G D L +Q  +   V R
Sbjct: 59  ---QTRMNLELAVTEAMLDFAEEISPEHTCLVPEKREELTTEGGLDVLTHQKSVEHAVKR 115

Query: 127 LHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITA 186
           L  +GS +SLF D   + H ++AA   GA  IEL+TG Y    +  QQ+   L ++   A
Sbjct: 116 LQAMGSEVSLFID--PDPHQIKAAAEIGASVIELHTGCYADATHVEQQQH-ELKRIKQAA 172

Query: 187 QLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
           + A  ++L +NAGH L   N+   I AI  + E+++GHA  A AL CG+KEAV   R+
Sbjct: 173 EYAASLNLTVNAGHGLNYHNVQP-IAAINELLELNIGHAIIARALFCGMKEAVKHMRQ 229


>gi|53804234|ref|YP_114110.1| pyridoxine 5'-phosphate synthase [Methylococcus capsulatus str.
           Bath]
 gi|91207538|sp|Q3V8A2|PDXJ_METCA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|53757995|gb|AAU92286.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylococcus
           capsulatus str. Bath]
          Length = 247

 Score =  140 bits (352), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 86/235 (36%), Positives = 132/235 (56%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +R  R+ P+P+++H   +A Q+GA G+T H R D+RHI+  D+  +R  I
Sbjct: 9   LGVNIDHVATIRQARHTPYPSVLHAAFVAEQAGAGGITAHLREDRRHIQDRDIELLREHI 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           + +     LN+E    +  + +  R  P    LVP+   +LT++ G D   +   + +T 
Sbjct: 69  ETR-----LNLEMAVTDEMVAIACRIHPHACCLVPERREELTTEGGLDVAGHLDRIGETC 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D    +  ++AA   GA  IEL+TG Y    N+ Q+  I L KL  
Sbjct: 124 RRLGDAGIEVSLFIDPEPAQ--IEAAARAGAPVIELHTGRYADARND-QERSIELEKLRH 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A +A+ + LQ+NAGH LT  N+   I  IP I E+++GHA  A A   G+KEAV
Sbjct: 181 AASVAEALGLQVNAGHGLTYANV-GAICRIPQIVELNIGHAIVARAFFSGLKEAV 234


>gi|148360404|ref|YP_001251611.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           pneumophila str. Corby]
 gi|296106529|ref|YP_003618229.1| pyridoxine 5-phosphate synthase [Legionella pneumophila 2300/99
           Alcoy]
 gi|91207238|sp|Q3V870|PDXJ_LEGPH RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|166219093|sp|A5IFW5|PDXJ_LEGPC RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|148282177|gb|ABQ56265.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           pneumophila str. Corby]
 gi|295648430|gb|ADG24277.1| pyridoxine 5-phosphate synthase [Legionella pneumophila 2300/99
           Alcoy]
 gi|307609740|emb|CBW99251.1| pyridoxal phosphate biosynthetic protein pdxJ [Legionella
           pneumophila 130b]
          Length = 248

 Score =  139 bits (350), Expect = 3e-31,   Method: Compositional matrix adjust.
 Identities = 86/240 (35%), Positives = 135/240 (56%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R   +P+ V     A ++GA G+T+H R D RHI+  D+    RLI
Sbjct: 7   LGVNIDHIATIRQARGTRYPDPVQAAMDAEEAGADGITLHMREDLRHIQARDV----RLI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +Q  +  +N+E    E  L+  E   PE   LVP+   +LT++ G D L ++ ++ K V
Sbjct: 63  -KQVLQTRMNLELAVTEAMLDFAEEISPEHACLVPEKREELTTEGGLDILTHRNVVEKAV 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D +  +  ++AA   GA  IEL+TG Y    +  +Q    L ++  
Sbjct: 122 RRLQLMGSEVSLFIDPDKEQ--IRAAVDVGAPVIELHTGCYADATSEEKQ-HYELQRIKE 178

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A  ++L +NAGH L   N+   I AI  ++E+++GHA  A AL CG+KEAV   R+
Sbjct: 179 AAEFAASLNLVVNAGHGLHYHNVKP-IAAIRELNELNIGHAIIARALFCGLKEAVRHMRQ 237


>gi|54293919|ref|YP_126334.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           pneumophila str. Lens]
 gi|91207239|sp|Q3V7F6|PDXJ_LEGPL RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|53753751|emb|CAH15209.1| Pyridoxal phosphate biosynthetic protein pdxJ [Legionella
           pneumophila str. Lens]
          Length = 248

 Score =  139 bits (349), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 86/240 (35%), Positives = 135/240 (56%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R   +P+ V     A ++GA G+T+H R D RHI+  D+    RLI
Sbjct: 7   LGVNIDHIATIRQARGTRYPDPVQAAMDAEEAGADGITLHMREDLRHIQARDV----RLI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +Q  +  +N+E    E  L+  E   PE   LVP+   +LT++ G D L ++ ++ K V
Sbjct: 63  -KQVLQTRMNLELAVTEAMLDFAEEISPEHSCLVPEKREELTTEGGLDILTHRNVVEKAV 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D +  +  ++AA   GA  IEL+TG Y    +  +Q    L ++  
Sbjct: 122 RRLQLMGSEVSLFIDPDKEQ--IRAAVDVGAPVIELHTGCYADATSEEKQ-HYELQRIKE 178

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A  ++L +NAGH L   N+   I AI  ++E+++GHA  A AL CG+KEAV   R+
Sbjct: 179 AAEFAASLNLVVNAGHGLHYHNVKP-IAAIRELNELNIGHAIIARALFCGLKEAVRHMRQ 237


>gi|52841181|ref|YP_094980.1| pyridoxine 5'-phosphate synthase [Legionella pneumophila subsp.
           pneumophila str. Philadelphia 1]
 gi|52628292|gb|AAU27033.1| pyridoxal phosphate biosynthetic protein PdxJ [Legionella
           pneumophila subsp. pneumophila str. Philadelphia 1]
          Length = 268

 Score =  139 bits (349), Expect = 6e-31,   Method: Compositional matrix adjust.
 Identities = 86/240 (35%), Positives = 135/240 (56%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R   +P+ V     A ++GA G+T+H R D RHI+  D+    RLI
Sbjct: 27  LGVNIDHIATIRQARGTRYPDPVQAAMDAEEAGADGITLHMREDLRHIQARDV----RLI 82

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +Q  +  +N+E    E  L+  E   PE   LVP+   +LT++ G D L ++ ++ K V
Sbjct: 83  -KQVLQTRMNLELAVTEAMLDFAEEISPEHACLVPEKREELTTEGGLDILTHRNVVEKAV 141

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D +  +  ++AA   GA  IEL+TG Y    +  +Q    L ++  
Sbjct: 142 RRLQLMGSEVSLFIDPDKEQ--IRAAVDVGAPVIELHTGCYADATSEEKQ-HYELQRIKE 198

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A  ++L +NAGH L   N+   I AI  ++E+++GHA  A AL CG+KEAV   R+
Sbjct: 199 AAEFAASLNLVVNAGHGLHYHNVKP-IAAIRELNELNIGHAIIARALFCGLKEAVRHMRQ 257


>gi|170767556|ref|ZP_02902009.1| pyridoxine 5'-phosphate synthase [Escherichia albertii TW07627]
 gi|170123890|gb|EDS92821.1| pyridoxine 5'-phosphate synthase [Escherichia albertii TW07627]
          Length = 243

 Score =  138 bits (347), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRGKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADEEQIKAAADVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AASFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|325295099|ref|YP_004281613.1| Pyridoxine 5'-phosphate synthase [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325065547|gb|ADY73554.1| Pyridoxine 5'-phosphate synthase [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 244

 Score =  137 bits (346), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 138/237 (58%), Gaps = 10/237 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R    P+ VH   IA  +GA  +T+H R D+RH+   DL  I+ +I
Sbjct: 7   LGVNIDHVATVRNARRTFEPDPVHAAVIADLAGADQITLHVREDRRHVNERDLKLIKEVI 66

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                 + +N+E    E  ++L  + KP Q+TLVP+   ++T++ G D    +  + +TV
Sbjct: 67  -----HSRVNLEMAATEEMVSLAIQVKPHQVTLVPEKREEITTEGGLDVAGQKEKIEETV 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN--NPQQERIFLNKL 182
            RL + G  ++LF D   +E  ++AAK   AD +EL+TG Y   +N    ++ +  + +L
Sbjct: 122 KRLKSAGIVVNLFID--PDEEQIRAAKEVNADAVELHTGRYAEAFNEKKEKEIKEEIERL 179

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A+L +++ L++ AGH LT +N+  + + IP I E+++GH+  A A+  G+KEAV
Sbjct: 180 KRAAKLGKELGLKVYAGHGLTYKNVKPIAD-IPEIEELNIGHSIVANAVLKGLKEAV 235


>gi|309702950|emb|CBJ02281.1| pyridoxine 5'-phosphate synthase [Escherichia coli ETEC H10407]
 gi|323936304|gb|EGB32595.1| pyridoxine 5'-phosphate synthase [Escherichia coli E1520]
 gi|332344439|gb|AEE57773.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           UMNK88]
          Length = 243

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|293415833|ref|ZP_06658476.1| pyridoxine 5'-phosphate synthase [Escherichia coli B185]
 gi|291433481|gb|EFF06460.1| pyridoxine 5'-phosphate synthase [Escherichia coli B185]
          Length = 243

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRNAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|300920732|ref|ZP_07137138.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 115-1]
 gi|300412303|gb|EFJ95613.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 115-1]
          Length = 248

 Score =  137 bits (345), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 71  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 126 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241


>gi|74313126|ref|YP_311545.1| pyridoxine 5'-phosphate synthase [Shigella sonnei Ss046]
 gi|91207569|sp|Q3YYV2|PDXJ_SHISS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|73856603|gb|AAZ89310.1| pyridoxine biosynthesis [Shigella sonnei Ss046]
 gi|323167802|gb|EFZ53497.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella sonnei 53G]
          Length = 243

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G +ISLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLTDAGIQISLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|54296967|ref|YP_123336.1| pyridoxine 5'-phosphate synthase [Legionella pneumophila str.
           Paris]
 gi|91207237|sp|Q3V7G1|PDXJ_LEGPA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|53750752|emb|CAH12159.1| Pyridoxal phosphate biosynthetic protein pdxJ [Legionella
           pneumophila str. Paris]
          Length = 248

 Score =  137 bits (345), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 85/240 (35%), Positives = 135/240 (56%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R   +P+ V     A ++GA G+T+H R D RHI+  D+    RLI
Sbjct: 7   LGVNIDHIATIRQARGTRYPDPVQAAMDAEEAGADGITLHMREDLRHIQARDV----RLI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +Q  +  +N+E    E  L+  E   PE   LVP+   +LT++ G D L ++ ++ + V
Sbjct: 63  -KQVLQTRMNLELAVTEAMLDFAEEILPEHACLVPEKREELTTEGGLDILTHRNVVERAV 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D +  +  ++AA   GA  IEL+TG Y    +  +Q    L ++  
Sbjct: 122 RRLQLMGSEVSLFIDPDKEQ--IRAAVDVGAPVIELHTGCYADATSEEKQ-HYELQRIKE 178

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A  ++L +NAGH L   N+   I AI  ++E+++GHA  A AL CG+KEAV   R+
Sbjct: 179 AAEFAASLNLVVNAGHGLHYHNVKP-IAAIRELNELNIGHAIIARALFCGLKEAVRHMRQ 237


>gi|300817659|ref|ZP_07097874.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 107-1]
 gi|300820757|ref|ZP_07100907.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 119-7]
 gi|300904252|ref|ZP_07122111.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 84-1]
 gi|300927059|ref|ZP_07142811.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 182-1]
 gi|300927690|ref|ZP_07143258.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 187-1]
 gi|300951718|ref|ZP_07165537.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 116-1]
 gi|300958795|ref|ZP_07170907.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 175-1]
 gi|301302931|ref|ZP_07209059.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 124-1]
 gi|301330334|ref|ZP_07222981.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 78-1]
 gi|301648328|ref|ZP_07248068.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 146-1]
 gi|331643188|ref|ZP_08344323.1| pyridoxine 5'-phosphate synthase [Escherichia coli H736]
 gi|331654026|ref|ZP_08355027.1| pyridoxine 5'-phosphate synthase [Escherichia coli M718]
 gi|331678560|ref|ZP_08379235.1| pyridoxine 5'-phosphate synthase [Escherichia coli H591]
 gi|300314543|gb|EFJ64327.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 175-1]
 gi|300403785|gb|EFJ87323.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 84-1]
 gi|300416943|gb|EFK00254.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 182-1]
 gi|300449002|gb|EFK12622.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 116-1]
 gi|300464243|gb|EFK27736.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 187-1]
 gi|300526510|gb|EFK47579.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 119-7]
 gi|300529647|gb|EFK50709.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 107-1]
 gi|300841866|gb|EFK69626.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 124-1]
 gi|300843668|gb|EFK71428.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 78-1]
 gi|301073604|gb|EFK88410.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 146-1]
 gi|315256592|gb|EFU36560.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 85-1]
 gi|324020022|gb|EGB89241.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 117-3]
 gi|331039986|gb|EGI12206.1| pyridoxine 5'-phosphate synthase [Escherichia coli H736]
 gi|331048875|gb|EGI20951.1| pyridoxine 5'-phosphate synthase [Escherichia coli M718]
 gi|331075020|gb|EGI46340.1| pyridoxine 5'-phosphate synthase [Escherichia coli H591]
          Length = 248

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 71  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 126 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241


>gi|15832684|ref|NP_311457.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           Sakai]
 gi|16130489|ref|NP_417059.1| pyridoxine 5'-phosphate synthase [Escherichia coli str. K-12
           substr. MG1655]
 gi|89109370|ref|AP_003150.1| pyridoxine 5'-phosphate synthase [Escherichia coli str. K-12
           substr. W3110]
 gi|157158897|ref|YP_001463887.1| pyridoxine 5'-phosphate synthase [Escherichia coli E24377A]
 gi|157162043|ref|YP_001459361.1| pyridoxine 5'-phosphate synthase [Escherichia coli HS]
 gi|168748366|ref|ZP_02773388.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4113]
 gi|168757775|ref|ZP_02782782.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4401]
 gi|168761185|ref|ZP_02786192.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4501]
 gi|168768668|ref|ZP_02793675.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4486]
 gi|168773510|ref|ZP_02798517.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4196]
 gi|168778541|ref|ZP_02803548.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4076]
 gi|168787924|ref|ZP_02812931.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC869]
 gi|168798946|ref|ZP_02823953.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC508]
 gi|170019153|ref|YP_001724107.1| pyridoxine 5'-phosphate synthase [Escherichia coli ATCC 8739]
 gi|170082173|ref|YP_001731493.1| pyridoxine 5'-phosphate synthase [Escherichia coli str. K-12
           substr. DH10B]
 gi|188495429|ref|ZP_03002699.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           53638]
 gi|191167992|ref|ZP_03029794.1| pyridoxine 5'-phosphate synthase [Escherichia coli B7A]
 gi|193064042|ref|ZP_03045127.1| pyridoxine 5'-phosphate synthase [Escherichia coli E22]
 gi|193068330|ref|ZP_03049293.1| pyridoxine 5'-phosphate synthase [Escherichia coli E110019]
 gi|194429293|ref|ZP_03061820.1| pyridoxine 5'-phosphate synthase [Escherichia coli B171]
 gi|194437613|ref|ZP_03069709.1| pyridoxine 5'-phosphate synthase [Escherichia coli 101-1]
 gi|195936711|ref|ZP_03082093.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           O157:H7 str. EC4024]
 gi|208808919|ref|ZP_03251256.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208814486|ref|ZP_03255815.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208819341|ref|ZP_03259661.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209396227|ref|YP_002272039.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209920043|ref|YP_002294127.1| pyridoxine 5'-phosphate synthase [Escherichia coli SE11]
 gi|217326667|ref|ZP_03442750.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218547908|ref|YP_002381699.1| pyridoxine 5'-phosphate synthase [Escherichia fergusonii ATCC
           35469]
 gi|218555145|ref|YP_002388058.1| pyridoxine 5'-phosphate synthase [Escherichia coli IAI1]
 gi|218696192|ref|YP_002403859.1| pyridoxine 5'-phosphate synthase [Escherichia coli 55989]
 gi|238901729|ref|YP_002927525.1| pyridoxine 5'-phosphate synthase [Escherichia coli BW2952]
 gi|253772537|ref|YP_003035368.1| pyridoxine 5'-phosphate synthase [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254162539|ref|YP_003045647.1| pyridoxine 5'-phosphate synthase [Escherichia coli B str. REL606]
 gi|254794514|ref|YP_003079351.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           TW14359]
 gi|256021750|ref|ZP_05435615.1| pyridoxine 5'-phosphate synthase [Escherichia sp. 4_1_40B]
 gi|260845249|ref|YP_003223027.1| pyridoxine 5'-phosphate synthase [Escherichia coli O103:H2 str.
           12009]
 gi|260856658|ref|YP_003230549.1| pyridoxine 5'-phosphate synthase [Escherichia coli O26:H11 str.
           11368]
 gi|260869251|ref|YP_003235653.1| pyridoxine 5'-phosphate synthase [Escherichia coli O111:H- str.
           11128]
 gi|261223000|ref|ZP_05937281.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261259449|ref|ZP_05951982.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291283839|ref|YP_003500657.1| Pyridoxine 5'-phosphate synthase [Escherichia coli O55:H7 str.
           CB9615]
 gi|293446918|ref|ZP_06663340.1| pyridoxine 5'-phosphate synthase [Escherichia coli B088]
 gi|297521528|ref|ZP_06939914.1| pyridoxine 5'-phosphate synthase [Escherichia coli OP50]
 gi|301022062|ref|ZP_07185989.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 196-1]
 gi|307139200|ref|ZP_07498556.1| pyridoxine 5'-phosphate synthase [Escherichia coli H736]
 gi|307313865|ref|ZP_07593481.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli W]
 gi|312973190|ref|ZP_07787362.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           1827-70]
 gi|331669314|ref|ZP_08370162.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA271]
 gi|67470415|sp|P0A794|PDXJ_ECOLI RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|67470416|sp|P0A795|PDXJ_ECO57 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|34811392|pdb|1M5W|A Chain A, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811393|pdb|1M5W|B Chain B, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811394|pdb|1M5W|C Chain C, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811395|pdb|1M5W|D Chain D, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811396|pdb|1M5W|E Chain E, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811397|pdb|1M5W|F Chain F, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811398|pdb|1M5W|G Chain G, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|34811399|pdb|1M5W|H Chain H, 1.96 A Crystal Structure Of Pyridoxine 5'-Phosphate
           Synthase In Complex With 1-Deoxy-D-Xylulose Phosphate
 gi|147137|gb|AAA24315.1| pdxJ [Escherichia coli]
 gi|147555|gb|AAA21845.1| pdxJ [Escherichia coli]
 gi|1033153|gb|AAA79826.1| CG Site No. 416 [Escherichia coli str. K-12 substr. MG1655]
 gi|1788917|gb|AAC75617.1| pyridoxine 5'-phosphate synthase [Escherichia coli str. K-12
           substr. MG1655]
 gi|13362901|dbj|BAB36853.1| pyridoxine biosynthesis [Escherichia coli O157:H7 str. Sakai]
 gi|85675455|dbj|BAE76740.1| pyridoxine 5'-phosphate synthase [Escherichia coli str. K12 substr.
           W3110]
 gi|157067723|gb|ABV06978.1| pyridoxine 5'-phosphate synthase [Escherichia coli HS]
 gi|157080927|gb|ABV20635.1| pyridoxine 5'-phosphate synthase [Escherichia coli E24377A]
 gi|169754081|gb|ACA76780.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           ATCC 8739]
 gi|169890008|gb|ACB03715.1| pyridoxine 5'-phosphate synthase [Escherichia coli str. K-12
           substr. DH10B]
 gi|187770734|gb|EDU34578.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4196]
 gi|188017072|gb|EDU55194.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4113]
 gi|188490628|gb|EDU65731.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           53638]
 gi|189003261|gb|EDU72247.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4076]
 gi|189355300|gb|EDU73719.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4401]
 gi|189362219|gb|EDU80638.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4486]
 gi|189368383|gb|EDU86799.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4501]
 gi|189372245|gb|EDU90661.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC869]
 gi|189378686|gb|EDU97102.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC508]
 gi|190901999|gb|EDV61746.1| pyridoxine 5'-phosphate synthase [Escherichia coli B7A]
 gi|192929277|gb|EDV82886.1| pyridoxine 5'-phosphate synthase [Escherichia coli E22]
 gi|192958282|gb|EDV88722.1| pyridoxine 5'-phosphate synthase [Escherichia coli E110019]
 gi|194412701|gb|EDX28996.1| pyridoxine 5'-phosphate synthase [Escherichia coli B171]
 gi|194423419|gb|EDX39410.1| pyridoxine 5'-phosphate synthase [Escherichia coli 101-1]
 gi|208728720|gb|EDZ78321.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4206]
 gi|208735763|gb|EDZ84450.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4045]
 gi|208739464|gb|EDZ87146.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4042]
 gi|209157627|gb|ACI35060.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC4115]
 gi|209762908|gb|ACI79766.1| pyridoxine biosynthesis [Escherichia coli]
 gi|209762910|gb|ACI79767.1| pyridoxine biosynthesis [Escherichia coli]
 gi|209762912|gb|ACI79768.1| pyridoxine biosynthesis [Escherichia coli]
 gi|209762914|gb|ACI79769.1| pyridoxine biosynthesis [Escherichia coli]
 gi|209762916|gb|ACI79770.1| pyridoxine biosynthesis [Escherichia coli]
 gi|209913302|dbj|BAG78376.1| pyridoxal phosphate biosynthetic protein [Escherichia coli SE11]
 gi|217319034|gb|EEC27459.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           TW14588]
 gi|218352924|emb|CAU98723.1| pyridoxine 5'-phosphate synthase [Escherichia coli 55989]
 gi|218355449|emb|CAQ88058.1| pyridoxine 5'-phosphate synthase [Escherichia fergusonii ATCC
           35469]
 gi|218361913|emb|CAQ99513.1| pyridoxine 5'-phosphate synthase [Escherichia coli IAI1]
 gi|238863352|gb|ACR65350.1| pyridoxine 5'-phosphate synthase [Escherichia coli BW2952]
 gi|242378165|emb|CAQ32939.1| pyridoxine 5'-phosphate synthase [Escherichia coli BL21(DE3)]
 gi|253323581|gb|ACT28183.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|253974440|gb|ACT40111.1| pyridoxal phosphate biosynthetic protein [Escherichia coli B str.
           REL606]
 gi|253978607|gb|ACT44277.1| pyridoxal phosphate biosynthetic protein [Escherichia coli
           BL21(DE3)]
 gi|254593914|gb|ACT73275.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           TW14359]
 gi|257755307|dbj|BAI26809.1| pyridoxine 5'-phosphate synthase [Escherichia coli O26:H11 str.
           11368]
 gi|257760396|dbj|BAI31893.1| pyridoxine 5'-phosphate synthase [Escherichia coli O103:H2 str.
           12009]
 gi|257765607|dbj|BAI37102.1| pyridoxine 5'-phosphate synthase [Escherichia coli O111:H- str.
           11128]
 gi|260448356|gb|ACX38778.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           DH1]
 gi|290763712|gb|ADD57673.1| Pyridoxine 5'-phosphate synthase [Escherichia coli O55:H7 str.
           CB9615]
 gi|291323748|gb|EFE63176.1| pyridoxine 5'-phosphate synthase [Escherichia coli B088]
 gi|299881367|gb|EFI89578.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 196-1]
 gi|306906366|gb|EFN36881.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli W]
 gi|310331785|gb|EFP99020.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           1827-70]
 gi|315061883|gb|ADT76210.1| pyridoxine 5'-phosphate synthase [Escherichia coli W]
 gi|315137188|dbj|BAJ44347.1| pyridoxine 5'-phosphate synthase [Escherichia coli DH1]
 gi|315615826|gb|EFU96458.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           3431]
 gi|320188905|gb|EFW63564.1| Pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           EC1212]
 gi|320200128|gb|EFW74717.1| Pyridoxine 5'-phosphate synthase [Escherichia coli EC4100B]
 gi|320640813|gb|EFX10307.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           G5101]
 gi|320646159|gb|EFX15099.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H- str.
           493-89]
 gi|320651454|gb|EFX19850.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H- str. H
           2687]
 gi|320657055|gb|EFX24874.1| pyridoxine 5'-phosphate synthase [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662720|gb|EFX30059.1| pyridoxine 5'-phosphate synthase [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320667540|gb|EFX34460.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323156222|gb|EFZ42381.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           EPECa14]
 gi|323159221|gb|EFZ45211.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           E128010]
 gi|323173118|gb|EFZ58749.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           LT-68]
 gi|323177306|gb|EFZ62894.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           1180]
 gi|323184556|gb|EFZ69930.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           1357]
 gi|323377536|gb|ADX49804.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           KO11]
 gi|323941173|gb|EGB37358.1| pyridoxine 5'-phosphate synthase [Escherichia coli E482]
 gi|323944621|gb|EGB40689.1| pyridoxine 5'-phosphate synthase [Escherichia coli H120]
 gi|323961179|gb|EGB56792.1| pyridoxine 5'-phosphate synthase [Escherichia coli H489]
 gi|323971110|gb|EGB66357.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA007]
 gi|324118226|gb|EGC12122.1| pyridoxine 5'-phosphate synthase [Escherichia coli E1167]
 gi|326340370|gb|EGD64174.1| Pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           1125]
 gi|326345053|gb|EGD68797.1| Pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 str.
           1044]
 gi|331064508|gb|EGI36419.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA271]
          Length = 243

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|110642726|ref|YP_670456.1| pyridoxine 5'-phosphate synthase [Escherichia coli 536]
 gi|191174007|ref|ZP_03035524.1| pyridoxine 5'-phosphate synthase [Escherichia coli F11]
 gi|218559485|ref|YP_002392398.1| pyridoxine 5'-phosphate synthase [Escherichia coli S88]
 gi|218690680|ref|YP_002398892.1| pyridoxine 5'-phosphate synthase [Escherichia coli ED1a]
 gi|331658708|ref|ZP_08359652.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA206]
 gi|110344318|gb|ABG70555.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           536]
 gi|190905698|gb|EDV65320.1| pyridoxine 5'-phosphate synthase [Escherichia coli F11]
 gi|218366254|emb|CAR04001.1| pyridoxine 5'-phosphate synthase [Escherichia coli S88]
 gi|218428244|emb|CAR09161.2| pyridoxine 5'-phosphate synthase [Escherichia coli ED1a]
 gi|222034269|emb|CAP77010.1| Pyridoxine 5'-phosphate synthase [Escherichia coli LF82]
 gi|281179613|dbj|BAI55943.1| pyridoxal phosphate biosynthetic protein [Escherichia coli SE15]
 gi|307625888|gb|ADN70192.1| pyridoxine 5'-phosphate synthase [Escherichia coli UM146]
 gi|312947135|gb|ADR27962.1| pyridoxine 5'-phosphate synthase [Escherichia coli O83:H1 str. NRG
           857C]
 gi|323949218|gb|EGB45109.1| pyridoxine 5'-phosphate synthase [Escherichia coli H252]
 gi|323955800|gb|EGB51558.1| pyridoxine 5'-phosphate synthase [Escherichia coli H263]
 gi|331054373|gb|EGI26400.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA206]
          Length = 243

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFATSLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|323188321|gb|EFZ73613.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           RN587/1]
          Length = 243

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFATSLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|91211890|ref|YP_541876.1| pyridoxine 5'-phosphate synthase [Escherichia coli UTI89]
 gi|117624785|ref|YP_853698.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           APEC O1]
 gi|237705074|ref|ZP_04535555.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia sp.
           3_2_53FAA]
 gi|300974164|ref|ZP_07172482.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 200-1]
 gi|331648310|ref|ZP_08349399.1| pyridoxine 5'-phosphate synthase [Escherichia coli M605]
 gi|91073464|gb|ABE08345.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           UTI89]
 gi|115513909|gb|ABJ01984.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           APEC O1]
 gi|226901440|gb|EEH87699.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia sp.
           3_2_53FAA]
 gi|300308903|gb|EFJ63423.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 200-1]
 gi|315288041|gb|EFU47443.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 110-3]
 gi|315300509|gb|EFU59738.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 16-3]
 gi|324014391|gb|EGB83610.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 60-1]
 gi|331042859|gb|EGI15000.1| pyridoxine 5'-phosphate synthase [Escherichia coli M605]
          Length = 248

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILRQTL 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 71  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 126 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFATSLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241


>gi|82777990|ref|YP_404339.1| pyridoxine 5'-phosphate synthase [Shigella dysenteriae Sd197]
 gi|309784621|ref|ZP_07679256.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella dysenteriae
           1617]
 gi|91207568|sp|Q32CV7|PDXJ_SHIDS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|81242138|gb|ABB62848.1| pyridoxine biosynthesis [Shigella dysenteriae Sd197]
 gi|308927518|gb|EFP72990.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella dysenteriae
           1617]
          Length = 243

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGQDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|13786833|pdb|1HO1|A Chain A, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase
 gi|13786834|pdb|1HO1|B Chain B, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase
 gi|13786835|pdb|1HO1|C Chain C, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase
 gi|13786836|pdb|1HO1|D Chain D, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase
 gi|13786837|pdb|1HO4|A Chain A, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase In
           Complex With Pyridoxine 5'-Phosphate And Inorganic
           Phosphate
 gi|13786838|pdb|1HO4|B Chain B, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase In
           Complex With Pyridoxine 5'-Phosphate And Inorganic
           Phosphate
 gi|13786839|pdb|1HO4|C Chain C, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase In
           Complex With Pyridoxine 5'-Phosphate And Inorganic
           Phosphate
 gi|13786840|pdb|1HO4|D Chain D, Crystal Structure Of Pyridoxine 5'-Phosphate Synthase In
           Complex With Pyridoxine 5'-Phosphate And Inorganic
           Phosphate
 gi|28948390|pdb|1IXN|A Chain A, Enzyme-Substrate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948391|pdb|1IXN|B Chain B, Enzyme-Substrate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948392|pdb|1IXN|C Chain C, Enzyme-Substrate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948393|pdb|1IXN|D Chain D, Enzyme-Substrate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948394|pdb|1IXO|A Chain A, Enzyme-Analogue Substrate Complex Of Pyridoxine 5'-
           Phosphate Synthase
 gi|28948395|pdb|1IXO|B Chain B, Enzyme-Analogue Substrate Complex Of Pyridoxine 5'-
           Phosphate Synthase
 gi|28948396|pdb|1IXO|C Chain C, Enzyme-Analogue Substrate Complex Of Pyridoxine 5'-
           Phosphate Synthase
 gi|28948397|pdb|1IXO|D Chain D, Enzyme-Analogue Substrate Complex Of Pyridoxine 5'-
           Phosphate Synthase
 gi|28948398|pdb|1IXP|A Chain A, Enzyme-Phosphate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948399|pdb|1IXP|B Chain B, Enzyme-Phosphate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948400|pdb|1IXP|C Chain C, Enzyme-Phosphate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948401|pdb|1IXP|D Chain D, Enzyme-Phosphate Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948402|pdb|1IXQ|A Chain A, Enzyme-Phosphate2 Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948403|pdb|1IXQ|B Chain B, Enzyme-Phosphate2 Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948404|pdb|1IXQ|C Chain C, Enzyme-Phosphate2 Complex Of Pyridoxine 5'-Phosphate
           Synthase
 gi|28948405|pdb|1IXQ|D Chain D, Enzyme-Phosphate2 Complex Of Pyridoxine 5'-Phosphate
           Synthase
          Length = 242

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 5   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 64

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 65  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 119

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 120 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 176

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 177 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 235


>gi|293410980|ref|ZP_06654556.1| pyridoxine 5'-phosphate synthase [Escherichia coli B354]
 gi|291471448|gb|EFF13932.1| pyridoxine 5'-phosphate synthase [Escherichia coli B354]
          Length = 243

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|82545016|ref|YP_408963.1| pyridoxine 5'-phosphate synthase [Shigella boydii Sb227]
 gi|187733777|ref|YP_001881343.1| pyridoxine 5'-phosphate synthase [Shigella boydii CDC 3083-94]
 gi|91207567|sp|Q31XS3|PDXJ_SHIBS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|81246427|gb|ABB67135.1| pyridoxine biosynthesis [Shigella boydii Sb227]
 gi|187430769|gb|ACD10043.1| pyridoxine 5'-phosphate synthase [Shigella boydii CDC 3083-94]
 gi|320176134|gb|EFW51201.1| Pyridoxine 5'-phosphate synthase [Shigella dysenteriae CDC 74-1112]
 gi|320186363|gb|EFW61097.1| Pyridoxine 5'-phosphate synthase [Shigella flexneri CDC 796-83]
 gi|332092606|gb|EGI97678.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella boydii
           3594-74]
          Length = 243

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLTDAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|170682415|ref|YP_001744753.1| pyridoxine 5'-phosphate synthase [Escherichia coli SMS-3-5]
 gi|218701078|ref|YP_002408707.1| pyridoxine 5'-phosphate synthase [Escherichia coli IAI39]
 gi|170520133|gb|ACB18311.1| pyridoxine 5'-phosphate synthase [Escherichia coli SMS-3-5]
 gi|218371064|emb|CAR18891.1| pyridoxine 5'-phosphate synthase [Escherichia coli IAI39]
          Length = 243

 Score =  137 bits (344), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLAEAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|30063966|ref|NP_838137.1| pyridoxine 5'-phosphate synthase [Shigella flexneri 2a str. 2457T]
 gi|56480141|ref|NP_708416.2| pyridoxine 5'-phosphate synthase [Shigella flexneri 2a str. 301]
 gi|110806509|ref|YP_690029.1| pyridoxine 5'-phosphate synthase [Shigella flexneri 5 str. 8401]
 gi|194432058|ref|ZP_03064347.1| pyridoxine 5'-phosphate synthase [Shigella dysenteriae 1012]
 gi|30042222|gb|AAP17947.1| pyridoxal phosphate biosynthetic protein [Shigella flexneri 2a str.
           2457T]
 gi|56383692|gb|AAN44123.2| pyridoxal phosphate biosynthetic protein [Shigella flexneri 2a str.
           301]
 gi|110616057|gb|ABF04724.1| pyridoxine biosynthesis [Shigella flexneri 5 str. 8401]
 gi|194419587|gb|EDX35667.1| pyridoxine 5'-phosphate synthase [Shigella dysenteriae 1012]
 gi|281601977|gb|ADA74961.1| Pyridoxine 5'-phosphate synthase [Shigella flexneri 2002017]
 gi|313648242|gb|EFS12686.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri 2a
           str. 2457T]
 gi|320182111|gb|EFW57015.1| Pyridoxine 5'-phosphate synthase [Shigella boydii ATCC 9905]
 gi|332088076|gb|EGI93201.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella boydii
           5216-82]
 gi|332089188|gb|EGI94295.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella dysenteriae
           155-74]
 gi|332753973|gb|EGJ84347.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           4343-70]
 gi|332755802|gb|EGJ86160.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           2747-71]
 gi|332761957|gb|EGJ92230.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           K-671]
 gi|332766565|gb|EGJ96770.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           2930-71]
 gi|333000424|gb|EGK20006.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           VA-6]
 gi|333000829|gb|EGK20401.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           K-218]
 gi|333001657|gb|EGK21224.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           K-272]
 gi|333015933|gb|EGK35268.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           K-227]
 gi|333016833|gb|EGK36159.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella flexneri
           K-304]
          Length = 243

 Score =  136 bits (343), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKIRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|26248929|ref|NP_754969.1| pyridoxine 5'-phosphate synthase [Escherichia coli CFT073]
 gi|227887600|ref|ZP_04005405.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           83972]
 gi|300982268|ref|ZP_07175979.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 45-1]
 gi|301047203|ref|ZP_07194295.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 185-1]
 gi|26109335|gb|AAN81537.1|AE016764_219 Pyridoxal phosphate biosynthetic protein pdxJ [Escherichia coli
           CFT073]
 gi|227835950|gb|EEJ46416.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           83972]
 gi|300300880|gb|EFJ57265.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 185-1]
 gi|300408822|gb|EFJ92360.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 45-1]
 gi|315292460|gb|EFU51812.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 153-1]
          Length = 248

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILRQTL 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 71  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 126 KRLADAGIQVSLFID--ADEDQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFATSLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241


>gi|306814372|ref|ZP_07448534.1| pyridoxine 5'-phosphate synthase [Escherichia coli NC101]
 gi|30316042|sp|Q8FF18|PDXJ_ECOL6 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|305851766|gb|EFM52218.1| pyridoxine 5'-phosphate synthase [Escherichia coli NC101]
 gi|307554583|gb|ADN47358.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli ABU
           83972]
          Length = 243

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADEDQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFATSLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|215487908|ref|YP_002330339.1| pyridoxine 5'-phosphate synthase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218706068|ref|YP_002413587.1| pyridoxine 5'-phosphate synthase [Escherichia coli UMN026]
 gi|293406006|ref|ZP_06649998.1| pyridoxine 5'-phosphate synthase [Escherichia coli FVEC1412]
 gi|298381806|ref|ZP_06991405.1| pyridoxine 5'-phosphate synthase [Escherichia coli FVEC1302]
 gi|312965480|ref|ZP_07779712.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           2362-75]
 gi|331684214|ref|ZP_08384810.1| pyridoxine 5'-phosphate synthase [Escherichia coli H299]
 gi|215265980|emb|CAS10389.1| pyridoxine 5'-phosphate synthase [Escherichia coli O127:H6 str.
           E2348/69]
 gi|218433165|emb|CAR14061.1| pyridoxine 5'-phosphate synthase [Escherichia coli UMN026]
 gi|291428214|gb|EFF01241.1| pyridoxine 5'-phosphate synthase [Escherichia coli FVEC1412]
 gi|298279248|gb|EFI20762.1| pyridoxine 5'-phosphate synthase [Escherichia coli FVEC1302]
 gi|312289900|gb|EFR17788.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           2362-75]
 gi|320196400|gb|EFW71024.1| Pyridoxine 5'-phosphate synthase [Escherichia coli WV_060327]
 gi|331079166|gb|EGI50368.1| pyridoxine 5'-phosphate synthase [Escherichia coli H299]
          Length = 243

 Score =  136 bits (343), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLAEAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|296104239|ref|YP_003614385.1| pyridoxine 5-phosphate synthase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
 gi|295058698|gb|ADF63436.1| pyridoxine 5-phosphate synthase [Enterobacter cloacae subsp.
           cloacae ATCC 13047]
          Length = 243

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLTIACDTKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +  ++AA   GA  IE++TG Y    N+ +Q +  L ++A 
Sbjct: 121 KRLADAGILVSLFIDADAEQ--IKAAADVGAPYIEIHTGCYADAKNDAEQAK-ELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVSEMKR 236


>gi|300898321|ref|ZP_07116669.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 198-1]
 gi|300357983|gb|EFJ73853.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 198-1]
          Length = 248

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 71  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 126 KRLAEAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241


>gi|309794382|ref|ZP_07688805.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 145-7]
 gi|308121838|gb|EFO59100.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 145-7]
          Length = 248

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 71  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 126 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AAIFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241


>gi|327398745|ref|YP_004339614.1| Pyridoxine 5'-phosphate synthase [Hippea maritima DSM 10411]
 gi|327181374|gb|AEA33555.1| Pyridoxine 5'-phosphate synthase [Hippea maritima DSM 10411]
          Length = 243

 Score =  136 bits (342), Expect = 3e-30,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 137/240 (57%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +R  R    P  ++   +  ++ A G+T+H R D+RHI+  D+ ++R ++
Sbjct: 3   LGVNIDHVATIREARKTNEPEPIYAALLVQEALADGITMHLREDRRHIQDRDVYQVREIV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  LN+E   NE  + +    KP Q TLVP++  ++T++ G D + N   +++ +
Sbjct: 63  -----KIPLNLEMSLNEEIVRIALDVKPHQATLVPENRQEITTEGGLDVVANSDRVSEVI 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D    E  ++ AK  GAD IEL+TG Y A   +  ++R+ L KL  
Sbjct: 118 KRLKGEGILVSLFID--PQEWQIEQAKNLGADAIELHTGNY-ANAKHDMEKRLELEKLID 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A+ + L ++AGH LT +N+   + AI  I E+++GH+  A ++  G+KEAV   R+
Sbjct: 175 AAKYAKSLGLHVHAGHGLTYENVKP-VAAIKEIEELNIGHSIIAKSVFVGMKEAVSLMRQ 233


>gi|324008473|gb|EGB77692.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 57-2]
          Length = 248

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILRQTL 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 71  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 126 KRLAEAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241


>gi|300935697|ref|ZP_07150667.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 21-1]
 gi|331674013|ref|ZP_08374776.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA280]
 gi|300459131|gb|EFK22624.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 21-1]
 gi|331069286|gb|EGI40678.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA280]
          Length = 248

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 129/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 71  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 126 KRLAEAGILVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241


>gi|189218778|ref|YP_001939419.1| pyridoxine 5'-phosphate synthase [Methylacidiphilum infernorum V4]
 gi|189185636|gb|ACD82821.1| Pyridoxal phosphate biosynthesis protein [Methylacidiphilum
           infernorum V4]
          Length = 256

 Score =  135 bits (341), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 84/244 (34%), Positives = 134/244 (54%), Gaps = 20/244 (8%)

Query: 5   VSVNLNAVAVLRNRR-------NLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDL 57
           + +N++ VA LR  R       +   P+ +   KIA ++GA  +T H R D+RHI+  D+
Sbjct: 14  LGLNIDHVATLRQARYKHAPFSSFAEPSPLQAAKIAQEAGAHSITAHLREDRRHIQDEDM 73

Query: 58  PEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQ 117
             IR+ +        LN+E  P    +      KP ++ LVP+   ++T++ G D  +N+
Sbjct: 74  RLIRQAVKH------LNMEMAPISEMVEKAIDIKPNEVCLVPEKREEITTEGGLDVSRNE 127

Query: 118 ALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI 177
           + L K V  L   G  +SLF D +  +  L+AAK TGA CIEL+TG Y       +Q+RI
Sbjct: 128 STLRKVVQELSQAGITVSLFIDPDPIQ--LKAAKQTGAHCIELHTGQYALA---TEQKRI 182

Query: 178 F--LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
              + K  + A LA+ ++LQ+NAGH L   N+   I ++P++  +++GHA  + AL  G+
Sbjct: 183 EEEIEKHKLCAYLAKDLNLQVNAGHGLNYSNLATYIRSVPFLHTVNIGHAIISEALFSGL 242

Query: 236 KEAV 239
           K AV
Sbjct: 243 KNAV 246


>gi|197249528|ref|YP_002147536.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197213231|gb|ACH50628.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
          Length = 243

 Score =  135 bits (341), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 129/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    +P    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEAMLAIAVETRPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL   G ++SLF D   +E  + AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 ARLAAAGIQVSLFID--ADERQINAAAEVGAPFIEIHTGCYANAETDAEQAK-ELARIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A LA ++ L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATLAARLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMTGLKEAVAEMKR 236


>gi|157144500|ref|YP_001451819.1| pyridoxine 5'-phosphate synthase [Citrobacter koseri ATCC BAA-895]
 gi|157081705|gb|ABV11383.1| hypothetical protein CKO_00218 [Citrobacter koseri ATCC BAA-895]
          Length = 243

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGILVSLFID--ADEEQIKAAADVGAPYIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-QAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236


>gi|301024851|ref|ZP_07188488.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 69-1]
 gi|300396382|gb|EFJ79920.1| pyridoxine 5'-phosphate synthase [Escherichia coli MS 69-1]
          Length = 248

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 71  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 126 KRLAEAGIQVSLFID--ADEGQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241


>gi|323968012|gb|EGB63424.1| pyridoxine 5'-phosphate synthase [Escherichia coli M863]
 gi|327252274|gb|EGE63946.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           STEC_7v]
          Length = 243

 Score =  135 bits (340), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVEIKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++  
Sbjct: 121 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARITK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|294493163|gb|ADE91919.1| pyridoxine 5'-phosphate synthase [Escherichia coli IHE3034]
          Length = 243

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVCILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++A    GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADEEQIKAVAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFATSLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|16761490|ref|NP_457107.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|29140813|ref|NP_804155.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|213425279|ref|ZP_03358029.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Typhi str. E02-1180]
 gi|213583124|ref|ZP_03364950.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-0664]
 gi|213613052|ref|ZP_03370878.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Typhi str. E98-2068]
 gi|213646356|ref|ZP_03376409.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Typhi str. J185]
 gi|20139001|sp|Q8Z4K6|PDXJ_SALTI RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|25345856|pir||AH0828 probable pyridoxal phosphate biosynthetic protein STY2824
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16503790|emb|CAD02780.1| putative pyridoxal phosphate biosynthetic protein [Salmonella
           enterica subsp. enterica serovar Typhi]
 gi|29136438|gb|AAO68004.1| putative pyridoxal phosphate biosynthetic protein [Salmonella
           enterica subsp. enterica serovar Typhi str. Ty2]
          Length = 243

 Score =  135 bits (340), Expect = 6e-30,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 129/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    +P    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLAIAVETRPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL   G ++SLF D   +E  + AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 ARLAAAGIQVSLFID--ADERQINAAAEVGAPFIEIHTGCYANAETDAEQAK-ELARIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A LA ++ L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATLAARLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMTGLKEAVAEMKR 236


>gi|323978406|gb|EGB73491.1| pyridoxine 5'-phosphate synthase [Escherichia coli TW10509]
          Length = 243

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 128/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +PN V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPNPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++  
Sbjct: 121 KRLAEAGILVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARITK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|15803090|ref|NP_289121.1| pyridoxine 5'-phosphate synthase [Escherichia coli O157:H7 EDL933]
 gi|25345853|pir||C85902 pyridoxine biosynthesis [imported] - Escherichia coli  (strain
           O157:H7, substrain EDL933)
 gi|12516981|gb|AAG57679.1|AE005487_3 pyridoxine biosynthesis [Escherichia coli O157:H7 str. EDL933]
          Length = 243

 Score =  135 bits (339), Expect = 7e-30,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +  LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIXTLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|331664132|ref|ZP_08365042.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA143]
 gi|331059931|gb|EGI31908.1| pyridoxine 5'-phosphate synthase [Escherichia coli TA143]
          Length = 243

 Score =  135 bits (339), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D +  +  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFIDADVEQ--IKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|332977453|gb|EGK14228.1| pyridoxal phosphate biosynthetic protein PdxJ [Psychrobacter sp.
           1501(2011)]
          Length = 253

 Score =  135 bits (339), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 85/245 (34%), Positives = 136/245 (55%), Gaps = 12/245 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R + +P+ V    +  Q+GA G+T+H R D+RHI+  D+  ++ L+
Sbjct: 14  LGVNIDHVATLRQARGVNYPDPVEAALLCEQAGADGITLHLREDRRHIQDDDVYRMKPLL 73

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E    E  LN+    KPE I LVP+   +LT++ G D       + + +
Sbjct: 74  -----KTRMNLEMATTEEMLNIALEVKPEWICLVPEKREELTTEGGLDVASQVENIKRYI 128

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI--FLNKL 182
           A LH +GS++SLF D +  +  + AA    AD IEL+TG Y       +   I   LN++
Sbjct: 129 ASLHQVGSKVSLFIDPDAKQ--IDAAIACKADAIELHTGQYAEATLAKESTAIEHELNRI 186

Query: 183 --AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
             A    L+Q+  L +NAGH LT  N+ + I  IP I E+++GHA  A ++  G+++AV 
Sbjct: 187 KSATKYALSQQETLIVNAGHGLTRDNV-SAIARIPGIYELNIGHALIADSVFMGLEKAVA 245

Query: 241 CFRRA 245
             ++A
Sbjct: 246 TMKQA 250


>gi|56412546|ref|YP_149621.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62181143|ref|YP_217560.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161612652|ref|YP_001586617.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|168232156|ref|ZP_02657214.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168466661|ref|ZP_02700515.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168821432|ref|ZP_02833432.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194469519|ref|ZP_03075503.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|197361481|ref|YP_002141117.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|200387784|ref|ZP_03214396.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|224582880|ref|YP_002636678.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238912696|ref|ZP_04656533.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|75481602|sp|Q57LD3|PDXJ_SALCH RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|91207566|sp|Q3V7K1|PDXJ_SALPA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|56126803|gb|AAV76309.1| putative pyridoxal phosphate biosynthetic protein [Salmonella
           enterica subsp. enterica serovar Paratyphi A str. ATCC
           9150]
 gi|62128776|gb|AAX66479.1| carries out condensation and ring closure step after PdxA in
           pyridoxine biosynthesis [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161362016|gb|ABX65784.1| hypothetical protein SPAB_00348 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194455883|gb|EDX44722.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|195630869|gb|EDX49461.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197092957|emb|CAR58387.1| putative pyridoxal phosphate biosynthetic protein [Salmonella
           enterica subsp. enterica serovar Paratyphi A str.
           AKU_12601]
 gi|199604882|gb|EDZ03427.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|205333714|gb|EDZ20478.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205341953|gb|EDZ28717.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|224467407|gb|ACN45237.1| pyridoxal phosphate biosynthetic protein [Salmonella enterica
           subsp. enterica serovar Paratyphi C strain RKS4594]
 gi|320087079|emb|CBY96848.1| Pyridoxine 5'-phosphate synthase PNP synthase [Salmonella enterica
           subsp. enterica serovar Weltevreden str. 2007-60-3289-1]
 gi|322715633|gb|EFZ07204.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
          Length = 243

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 129/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    +P    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLAIAVETRPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL   G ++SLF D   +E  + AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 ARLAAAGIQVSLFID--ADEAQINAAAEVGAPFIEIHTGCYANAETDAEQAK-ELARIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A LA ++ L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATLAARLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMTGLKEAVAEMKR 236


>gi|16765898|ref|NP_461513.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|167549390|ref|ZP_02343149.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167992709|ref|ZP_02573805.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168238323|ref|ZP_02663381.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168243368|ref|ZP_02668300.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168261371|ref|ZP_02683344.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|194445975|ref|YP_002041841.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194447787|ref|YP_002046640.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194736368|ref|YP_002115641.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197265398|ref|ZP_03165472.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|198243503|ref|YP_002216645.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|204929408|ref|ZP_03220482.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205353674|ref|YP_002227475.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207857985|ref|YP_002244636.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|20139015|sp|Q8ZN19|PDXJ_SALTY RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|16421125|gb|AAL21472.1| carries out condensation and ring closure step after PdxA in
           pyridoxine biosynthesis [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|194404638|gb|ACF64860.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194406091|gb|ACF66310.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194711870|gb|ACF91091.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197243653|gb|EDY26273.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197288846|gb|EDY28219.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197938019|gb|ACH75352.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|204321127|gb|EDZ06327.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205273455|emb|CAR38432.1| Pyridoxal phosphate biosynthetic protein pdxJ [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 287/91]
 gi|205325212|gb|EDZ13051.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205329096|gb|EDZ15860.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205337566|gb|EDZ24330.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205349515|gb|EDZ36146.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206709788|emb|CAR34140.1| Pyridoxal phosphate biosynthetic protein pdxJ [Salmonella enterica
           subsp. enterica serovar Enteritidis str. P125109]
 gi|261247773|emb|CBG25601.1| PNP synthase [Salmonella enterica subsp. enterica serovar
           Typhimurium str. D23580]
 gi|267994704|gb|ACY89589.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 14028S]
 gi|301159126|emb|CBW18640.1| Pyridoxal phosphate biosynthetic protein pdxJ [Salmonella enterica
           subsp. enterica serovar Typhimurium str. SL1344]
 gi|312913567|dbj|BAJ37541.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|321222717|gb|EFX47788.1| Pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. TN061786]
 gi|322613348|gb|EFY10290.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322620448|gb|EFY17313.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625084|gb|EFY21913.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322629472|gb|EFY26248.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322633859|gb|EFY30598.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322635465|gb|EFY32176.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322639859|gb|EFY36538.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322644255|gb|EFY40799.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649947|gb|EFY46367.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322654870|gb|EFY51187.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322658202|gb|EFY54468.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322661726|gb|EFY57944.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322669707|gb|EFY65853.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322673286|gb|EFY69391.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322674925|gb|EFY71012.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322682948|gb|EFY78966.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322685609|gb|EFY81604.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|323130909|gb|ADX18339.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Typhimurium str. 4/74]
 gi|323191963|gb|EFZ77201.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323200404|gb|EFZ85485.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323201304|gb|EFZ86371.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323208374|gb|EFZ93314.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211550|gb|EFZ96388.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323215982|gb|EGA00714.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221763|gb|EGA06171.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323225629|gb|EGA09856.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323229347|gb|EGA13471.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235338|gb|EGA19422.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323237476|gb|EGA21539.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245231|gb|EGA29232.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323248805|gb|EGA32732.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323254015|gb|EGA37836.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323259063|gb|EGA42711.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323261985|gb|EGA45550.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323267769|gb|EGA51250.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323269672|gb|EGA53124.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326624400|gb|EGE30745.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Dublin str. 3246]
 gi|326628778|gb|EGE35121.1| pyridoxal phosphate biosynthetic protein PdxJ [Salmonella enterica
           subsp. enterica serovar Gallinarum str. 9]
 gi|332989505|gb|AEF08488.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 243

 Score =  134 bits (338), Expect = 9e-30,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 129/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    +P    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLAIAVETRPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL   G ++SLF D   +E  + AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 ARLAAAGIQVSLFID--ADETQINAAAEVGAPFIEIHTGCYANAETDAEQAK-ELARIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A LA ++ L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATLAARLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMTGLKEAVAEMKR 236


>gi|167041429|gb|ABZ06181.1| putative Pyridoxal phosphate biosynthesis protein PdxJ [uncultured
           marine microorganism HF4000_006O13]
          Length = 258

 Score =  134 bits (338), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 133/240 (55%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V I  IA ++GA  +TVH R D+RHI+ TD+  + RL+
Sbjct: 22  LGVNVDHVATLRQVRGTSYPDPVEIALIAEENGADSITVHLREDRRHIQDTDVERLIRLV 81

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E   N+  ++     KP    LVP+   +LT++ G D       L +  
Sbjct: 82  -----KTRVNLEMAVNDEIIDFACSVKPSDCCLVPEKRQELTTEGGLDVFSQMDRLAEAS 136

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL N G R++ F D    +  ++++++ GA+ +EL+TG Y    +  +Q++  LN++  
Sbjct: 137 ERLKNSGIRVAYFVDPEPKQ--IESSRMAGAEVVELHTGTYADALSQ-KQKKYELNRIRE 193

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A    K+ L+++AGH L  +N    I AI  I E+++GHA  A +L+ G+ +AV   ++
Sbjct: 194 CAAHGTKIGLKVHAGHGLHYENTAQ-IAAISEILELNIGHAIVAKSLDLGIAKAVADMKK 252


>gi|256821983|ref|YP_003145946.1| pyridoxal phosphate biosynthetic protein PdxJ [Kangiella koreensis
           DSM 16069]
 gi|256795522|gb|ACV26178.1| pyridoxal phosphate biosynthetic protein PdxJ [Kangiella koreensis
           DSM 16069]
          Length = 249

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 129/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  + R I
Sbjct: 7   LGVNIDHIATVRNARGTDYPDPVQAAFVAEQNGADGITVHLREDRRHITDRDVELLARTI 66

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  L + ER KP  + LVP+   +LT++ G D    ++ +    
Sbjct: 67  -----QTRMNLEMAVTEEMLAIAERIKPHYVCLVPEKREELTTEGGLDVKGQESKIKDAC 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            R+   G ++SLF D   +E  + AA  TGA  IE++TG Y    +  QQ+ + L K+  
Sbjct: 122 HRMAEAGIQVSLFID--ADEEQINAAARTGAPLIEIHTGAYADAKSTEQQQ-VELVKVKH 178

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             + A    LQ+NAGH L   N+   I AIP I E+++GHA    A+  G+ +AV   ++
Sbjct: 179 GVEHAVSEGLQVNAGHGLQYHNV-QPIAAIPEIVELNIGHAIIGRAVFSGLDKAVSDMKK 237


>gi|284922514|emb|CBG35601.1| pyridoxine 5'-phosphate synthase [Escherichia coli 042]
          Length = 243

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D   +E  ++A+   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLAEAGIQVSLFID--ADEEQIKASAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|167041986|gb|ABZ06723.1| putative Pyridoxal phosphate biosynthesis protein PdxJ [uncultured
           marine microorganism HF4000_141E02]
          Length = 258

 Score =  134 bits (337), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 133/240 (55%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V I  IA ++GA  +TVH R D+RHI+ TD+  + RL+
Sbjct: 22  LGVNVDHVATLRQVRGTSYPDPVEIALIAEENGADSITVHLREDRRHIQDTDVERLIRLV 81

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E   N+  ++     KP    LVP+   +LT++ G D       L +  
Sbjct: 82  -----KTRVNLEMAVNDGIIDFACSVKPSDCCLVPEKRQELTTEGGLDVFSQMDRLAEAS 136

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL N G R++ F D    +  ++++++ GA+ +EL+TG Y    +  +Q++  LN++  
Sbjct: 137 ERLKNSGIRVAYFVDPEPKQ--IESSRMAGAEVVELHTGTYADALSQ-KQKKYELNRIRE 193

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A    K+ L+++AGH L  +N    I AI  I E+++GHA  A +L+ G+ +AV   ++
Sbjct: 194 CAAHGTKIGLKVHAGHGLHYENTAQ-IAAISEILELNIGHAIVAKSLDLGIAKAVADMKK 252


>gi|291279425|ref|YP_003496260.1| pyridoxine 5-phosphate synthase [Deferribacter desulfuricans SSM1]
 gi|290754127|dbj|BAI80504.1| pyridoxine 5-phosphate synthase [Deferribacter desulfuricans SSM1]
          Length = 242

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/247 (33%), Positives = 138/247 (55%), Gaps = 12/247 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +R  R    P+ V    +A   GA G+T+H R D+RHI+  DL  +R +
Sbjct: 3   KLGVNVDHVATVRQARLSIEPDPVRAAVLAELGGADGITIHLREDRRHIQDRDLYLLRDI 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     K  LN+E   NE  +++  + KP+  TLVP+   +LT++ G D + N  L+  T
Sbjct: 63  V-----KTRLNLEMACNEEIIDIALKVKPDMCTLVPEKREELTTEGGLDVISNFELVKDT 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLNKL 182
           V++L + G  +S+F D   +E  L+ A  TGA  +EL+TG Y  A   N  +E   L +L
Sbjct: 118 VSKLRDEGIEVSIFID--PDEAQLEKAIYTGARFVELHTGAYADAKSENRLKE---LKRL 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
            + A++A+ +   +NAGH L   N+ +++  I  + E+++GH+  A ++  G+KEAV   
Sbjct: 173 KLAAKVAKNLGFIVNAGHGLDYYNVIDIVK-IKELYELNIGHSIIARSIYVGIKEAVKEM 231

Query: 243 RRACGQH 249
           +    +H
Sbjct: 232 KDLICKH 238


>gi|116734172|gb|ABK20147.1| pyridoxal phosphate biosynthetic protein [Shigella boydii]
          Length = 243

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 129/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGTTVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQREKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLTDAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+ V   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDTVAEMKR 236


>gi|258622342|ref|ZP_05717367.1| Pyridoxine 5'-phosphate synthase [Vibrio mimicus VM573]
 gi|262166499|ref|ZP_06034236.1| pyridoxine 5'-phosphate synthase [Vibrio mimicus VM223]
 gi|258585358|gb|EEW10082.1| Pyridoxine 5'-phosphate synthase [Vibrio mimicus VM573]
 gi|262026215|gb|EEY44883.1| pyridoxine 5'-phosphate synthase [Vibrio mimicus VM223]
          Length = 243

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 130/238 (54%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +  + AAK  GA  IEL+TG Y    +  +Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQ--IDAAKACGAPFIELHTGHYSDAKSEVEQQN-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV
Sbjct: 175 IAAAASYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLSKAV 231


>gi|161502270|ref|YP_001569382.1| pyridoxine 5'-phosphate synthase [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|160863617|gb|ABX20240.1| hypothetical protein SARI_00300 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 243

 Score =  134 bits (336), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 129/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTDYPDPVQAAFIAEQAGADGITVHLREDRRHISDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    +P    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLAIAVETRPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G ++SLF D   +E  + AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 SRLAAAGIQVSLFID--ADEAQINAAAEVGAPFIEIHTGCYANAKTDAEQSK-ELARIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A LA ++ L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATLAVRLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236


>gi|291613752|ref|YP_003523909.1| pyridoxal phosphate biosynthetic protein PdxJ [Sideroxydans
           lithotrophicus ES-1]
 gi|291583864|gb|ADE11522.1| pyridoxal phosphate biosynthetic protein PdxJ [Sideroxydans
           lithotrophicus ES-1]
          Length = 238

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 132/236 (55%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + +N++ VA LR  R   +PNL+    I  ++GA  +T+H R D+RHI+  D+  +R +
Sbjct: 3   KLGLNIDHVATLRQARGSRYPNLMRAALICEEAGADAITIHLREDRRHIQDADVDILRGM 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     +  +N+E    +  +    R KP  I LVP+   +LT++ G D +++   + + 
Sbjct: 63  L-----QTRMNLECAVTDEMIANALRVKPHDICLVPEKREELTTEGGLDVVKHFDAVQRA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
             R    G R+SLF D +  +  L AAK  GA  IE++TG YG   + P +E+  L ++ 
Sbjct: 118 TQRCTEAGIRVSLFVDADDKQ--LDAAKKAGAPVIEIHTGKYGDADSVPAREQ-ELARIQ 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             A  A  + LQ+NAGH L   N+  ++ AIP+I+E+++GHA  + A+  G+ +AV
Sbjct: 175 RAAVYAHSLGLQVNAGHGLNYHNVRPIV-AIPHIAELNIGHAIISEAVFIGLDQAV 229


>gi|237732550|ref|ZP_04563031.1| pyridoxine 5'-phosphate synthase [Citrobacter sp. 30_2]
 gi|226908089|gb|EEH94007.1| pyridoxine 5'-phosphate synthase [Citrobacter sp. 30_2]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 128/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    I  Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIVEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L++    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLSIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D   +E  ++AA   GA  IE++TG Y     + +Q    L ++A 
Sbjct: 121 KRLADAGILVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAS-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I  IP + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIARIPEMHELNIGHAIIGRAVMSGLKEAVVEMKR 236


>gi|330007689|ref|ZP_08306028.1| pyridoxine 5'-phosphate synthase [Klebsiella sp. MS 92-3]
 gi|328535370|gb|EGF61852.1| pyridoxine 5'-phosphate synthase [Klebsiella sp. MS 92-3]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 127/240 (52%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLTIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D   +E  ++AA   GA  IE++TG Y     + +Q R  L ++A 
Sbjct: 121 QRLADAGILVSLFID--ADEAQIKAAADVGAPYIEIHTGCYADAKTDAEQAR-ELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236


>gi|283786180|ref|YP_003366045.1| pyridoxine 5'-phosphate synthase [Citrobacter rodentium ICC168]
 gi|282949634|emb|CBG89253.1| pyridoxine 5'-phosphate synthase [Citrobacter rodentium ICC168]
          Length = 243

 Score =  133 bits (335), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    +P    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETQPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGILVSLFID--ADEAQIKAAAEVGAPYIEIHTGCYADAQTDAEQAQ-ELARIAR 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236


>gi|238896015|ref|YP_002920751.1| pyridoxine 5'-phosphate synthase [Klebsiella pneumoniae NTUH-K2044]
 gi|238548333|dbj|BAH64684.1| pyridoxal phosphate biosynthetic protein [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
          Length = 243

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 127/240 (52%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLTIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D   +E  ++AA   GA  IE++TG Y     + +Q R  L ++A 
Sbjct: 121 QRLADAGILVSLFID--ADEAQIKAAADVGAPYIEIHTGCYADAKTDAEQAR-ELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236


>gi|261340865|ref|ZP_05968723.1| pyridoxine 5'-phosphate synthase [Enterobacter cancerogenus ATCC
           35316]
 gi|288317295|gb|EFC56233.1| pyridoxine 5'-phosphate synthase [Enterobacter cancerogenus ATCC
           35316]
          Length = 243

 Score =  133 bits (334), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D       +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVTTEGGLDVAGQPEKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D   ++  ++AA   GA  IE++TG Y    N+ +Q +  L ++A 
Sbjct: 121 KRLADAGILVSLFID--ADDAQIKAAADAGAPYIEIHTGCYADAKNDAEQAK-ELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKDAVAEMKR 236


>gi|256017287|ref|ZP_05431152.1| pyridoxine 5'-phosphate synthase [Shigella sp. D9]
          Length = 243

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL +   ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAWIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|332278278|ref|ZP_08390691.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella sp. D9]
 gi|332100630|gb|EGJ03976.1| pyridoxal phosphate biosynthetic protein PdxJ [Shigella sp. D9]
          Length = 248

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 11  LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 71  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL +   ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 126 KRLADAWIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 183 AATFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 241


>gi|195941199|ref|ZP_03086581.1| pyridoxal phosphate biosynthetic protein PdxJ [Escherichia coli
           O157:H7 str. EC4024]
          Length = 239

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 130/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 2   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D       +    
Sbjct: 62  DTR-----MNLEMAVTEEMLTIACDTKPHFCCLVPEKRQEVTTEGGLDVAGQLDKMRDAC 116

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +  ++AA   GA  IE++TG Y    N+ +Q +  L ++A 
Sbjct: 117 KRLADAGILVSLFIDADFAQ--IKAAADVGAPYIEIHTGCYADAKNDAEQAK-ELERIAK 173

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 174 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVSEMKR 232


>gi|319789370|ref|YP_004151003.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermovibrio
           ammonificans HB-1]
 gi|317113872|gb|ADU96362.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermovibrio
           ammonificans HB-1]
          Length = 244

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 130/237 (54%), Gaps = 10/237 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R    P+ VH   IA  +GA  +T+H R D+RH+   DL  I+ LI
Sbjct: 7   LGVNIDHVATVRNARRTFEPDPVHAAVIADLAGADQITLHVREDRRHVNERDLKLIKELI 66

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +     +N+E    E  L +    +P Q+TLVP+   ++T++ G D       +   V
Sbjct: 67  HSR-----VNLEMAVTEEMLQIATSVRPHQVTLVPERREEVTTEGGLDVKGQLERVRAAV 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFLNKL 182
            RL   G  ++LF D    E  ++AA   GA+ +EL+TG Y   +   N  + +  L +L
Sbjct: 122 ERLKGAGIVVNLFID--PEEEQVRAAAEVGANAVELHTGRYAEAFAAGNEGEVQEELERL 179

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A+LA+++ L++ AGH LT +N+   I  IP I E+++GH+  A A+  G+KEAV
Sbjct: 180 KRAAKLAKELGLRVYAGHGLTYKNVKP-IAEIPEIEELNIGHSIVANAVLLGLKEAV 235


>gi|323499984|ref|ZP_08104940.1| pyridoxine 5'-phosphate synthase [Vibrio sinaloensis DSM 21326]
 gi|323314950|gb|EGA68005.1| pyridoxine 5'-phosphate synthase [Vibrio sinaloensis DSM 21326]
          Length = 243

 Score =  133 bits (334), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 131/239 (54%), Gaps = 11/239 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEVAERAGADGITIHLREDRRHIVDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMVEIALKTKPEYVCLVPEKREELTTEGGLDVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLN 180
               +L + G ++SLF D   +   + AAK  GA  IEL+TG Y  A   + QQ+   L 
Sbjct: 118 AATTKLTDAGIKVSLFID--ADREQIDAAKACGAPFIELHTGHYADAVAEDDQQDE--LK 173

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           K+A  A  A  + + +NAGH LT  N+   I AIP I E+++GH+    A+  G+ +AV
Sbjct: 174 KIAAGASYAADLGITVNAGHGLTYHNVAP-IAAIPEIYELNIGHSIIGRAVFDGLHKAV 231


>gi|323491195|ref|ZP_08096381.1| pyridoxine 5'-phosphate synthase [Vibrio brasiliensis LMG 20546]
 gi|323314563|gb|EGA67641.1| pyridoxine 5'-phosphate synthase [Vibrio brasiliensis LMG 20546]
          Length = 243

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 80/238 (33%), Positives = 126/238 (52%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI+  D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEVAERAGADGITIHLREDRRHIKDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    E  + +    KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  ETL-----QTRMNLEMAVTEEMVEIALETKPEYVCLVPEKREELTTEGGLDVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               RL   G ++SLF D   +   + AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 NATQRLTEAGIKVSLFID--ADREQIDAAKACGAPFIELHTGHYADAETEEDQQD-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GH+    A   G+ +AV
Sbjct: 175 IAAGASYAADLGITVNAGHGLTYHNVAP-IAAIPEIYELNIGHSIIGRAAFDGLHKAV 231


>gi|261211552|ref|ZP_05925840.1| pyridoxine 5'-phosphate synthase [Vibrio sp. RC341]
 gi|260839507|gb|EEX66133.1| pyridoxine 5'-phosphate synthase [Vibrio sp. RC341]
          Length = 243

 Score =  132 bits (333), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 129/238 (54%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +  + AAK  GA  IEL+TG Y    +   Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQ--IDAAKACGAPFIELHTGHYSDAKSEVDQQN-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV
Sbjct: 175 IAAAASYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAV 231


>gi|255019672|ref|ZP_05291751.1| Pyridoxine 5'-phosphate synthase [Acidithiobacillus caldus ATCC
           51756]
 gi|254970895|gb|EET28378.1| Pyridoxine 5'-phosphate synthase [Acidithiobacillus caldus ATCC
           51756]
          Length = 241

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 85/242 (35%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
            ++ VN++ VA LR  R   +P+ +    +A + GA  +T H R D+RH++  D+  +R 
Sbjct: 2   VALGVNIDHVATLRQARGTIYPDPLEAAFVAERFGADAITAHLREDRRHMQERDIRLLR- 60

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q  +  LN+E   +E  L L E  +P    LVP+   +LT++ G D  Q +  +  
Sbjct: 61  ----QCLRTRLNLEMAVSEDILGLAEELQPSDCCLVPERRAELTTEGGLDVCQGRERIGL 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
             ARL  +G R+SLF D       L+AA   GA  +EL+TGPY       QQ R  L KL
Sbjct: 117 ACARLAAVGVRVSLFVD--PERRQLEAAAEVGAPVVELHTGPYANACTRAQQ-RDELAKL 173

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQ A  + L+++AGH L   N+   + AIP + E+++GHA  A AL  G+  AV   
Sbjct: 174 REAAQHAAGLGLRVHAGHGLDYPNV-QAVAAIPEVRELNIGHAIVAHALFVGLGPAVAEM 232

Query: 243 RR 244
           +R
Sbjct: 233 KR 234


>gi|146312692|ref|YP_001177766.1| pyridoxine 5'-phosphate synthase [Enterobacter sp. 638]
 gi|145319568|gb|ABP61715.1| pyridoxine 5'-phosphate synthase [Enterobacter sp. 638]
          Length = 243

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 129/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVKILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    Q  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVTTEGGLDVAGQQDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D + ++  ++AA   GA  IE++TG Y    +   Q +  L ++A 
Sbjct: 121 KRLADAGILVSLFIDADFDQ--IKAAAAVGAPYIEIHTGCYADAEDEVAQAK-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I  IP + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAQIPEMFELNIGHAIIGRAVMSGLKEAVSEMKR 236


>gi|311278503|ref|YP_003940734.1| pyridoxal phosphate biosynthetic protein PdxJ [Enterobacter cloacae
           SCF1]
 gi|308747698|gb|ADO47450.1| pyridoxal phosphate biosynthetic protein PdxJ [Enterobacter cloacae
           SCF1]
          Length = 243

 Score =  132 bits (333), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 129/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   ++  ++AA   GA  IE++TG Y        Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADDEQIKAAAEVGAPYIEIHTGCYADAETEDAQAK-ELARIAR 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236


>gi|149374706|ref|ZP_01892480.1| pyridoxal phosphate biosynthetic protein PdxJ [Marinobacter
           algicola DG893]
 gi|149361409|gb|EDM49859.1| pyridoxal phosphate biosynthetic protein PdxJ [Marinobacter
           algicola DG893]
          Length = 244

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 82/235 (34%), Positives = 129/235 (54%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V    +A ++GA G+T+HPR D+RHI+  D+     L+
Sbjct: 7   LGVNIDHVATLRQARGTRYPDPVQAAILAEEAGADGITIHPREDRRHIQDRDV-----LL 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            ++    ++N+E    +  L   E+ +PE + LVP+   +LT++ G D    +A + K  
Sbjct: 62  LKEILTTKMNLEMAVTDAMLAFAEQVRPECVCLVPEKREELTTEGGLDVEGQEARVAKAC 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G+ +SLF D +  +  + AA   GA  +EL+TG Y A   +PQ      N L  
Sbjct: 122 DRLAKIGAEVSLFIDPDVAQ--IDAAVRCGAPVVELHTGEY-AEATDPQIVEGAFNTLQE 178

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               A+K  L +NAGH L   N    + AI  I+E+++GHA  A A+  G+KEAV
Sbjct: 179 AVTYARKKGLVVNAGHGLHYHNTER-VAAIAGINELNIGHAIIARAVFTGLKEAV 232


>gi|295097903|emb|CBK86993.1| pyridoxine 5'-phosphate synthase [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 243

 Score =  132 bits (332), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 129/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D       +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVTTEGGLDVAGQLDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +  ++AA   GA  IE++TG Y    N+  Q +  L ++A 
Sbjct: 121 KRLADAGILVSLFIDADFTQ--IKAAADVGAPYIEIHTGCYADAENDAAQAK-ELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVSEMKR 236


>gi|260436681|ref|ZP_05790651.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. WH 8109]
 gi|260414555|gb|EEX07851.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. WH 8109]
          Length = 249

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 135/237 (56%), Gaps = 12/237 (5%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R+ 
Sbjct: 3   SLGVNIDHIANIREARRTVEPDPVSMALLAELGGADGITVHLREDRRHIQDRDVELLRQT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     ++ LN+E    E  + +  R KP+ +TLVP+   ++T++ G D    +A L   
Sbjct: 63  V-----RSRLNLEMAAIEEMVAIALRIKPDMVTLVPERREEVTTEGGLDVAGQEASLGGM 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLNKL 182
           V  L + G  +SLF D    +  LQA K TGA  +EL+TG Y  A ++   QE   L +L
Sbjct: 118 VQTLQSAGIPVSLFVDPEATQ--LQACKATGACWVELHTGSYADADWSTQPQE---LARL 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                +A+++ L++NAGH LT QN+   I AIP + E+++GH   A ++  G+++AV
Sbjct: 173 QEGTAIARQLGLRVNAGHGLTYQNV-EPIAAIPGMEELNIGHTIVARSVAVGLQQAV 228


>gi|260771919|ref|ZP_05880837.1| pyridoxine 5'-phosphate synthase [Vibrio metschnikovii CIP 69.14]
 gi|260613211|gb|EEX38412.1| pyridoxine 5'-phosphate synthase [Vibrio metschnikovii CIP 69.14]
          Length = 243

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 83/238 (34%), Positives = 129/238 (54%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI+  D+  +R
Sbjct: 3   SILLGVNIDHVATLRNARGTRYPDPVHAAEIAERAGADGITIHLREDRRHIQDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  L +    +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMLEIALNTQPEFVCLVPEKREELTTEGGLDVLGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   +   + AAK  GA  IEL+TG Y    N  +Q+   L K
Sbjct: 118 AATEKLTTAGIKVSLFID--ADREQIDAAKACGAPFIELHTGHYAEASNETEQQN-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV
Sbjct: 175 IAAAAAYASDLGITVNAGHGLTYHNVA-AIAAIPEIYELNIGHAIVGRAVFDGLSKAV 231


>gi|262040300|ref|ZP_06013551.1| pyridoxal phosphate biosynthetic protein PdxJ [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
 gi|259042409|gb|EEW43429.1| pyridoxal phosphate biosynthetic protein PdxJ [Klebsiella
           pneumoniae subsp. rhinoscleromatis ATCC 13884]
          Length = 243

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 127/240 (52%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLTIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D   ++  ++AA   GA  IE++TG Y     + +Q R  L ++A 
Sbjct: 121 QRLADAGILVSLFID--ADQAQIKAAADVGAPYIEIHTGCYADAKTDAEQAR-ELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236


>gi|91227849|ref|ZP_01262022.1| pyridoxal phosphate biosynthetic protein [Vibrio alginolyticus
           12G01]
 gi|91188359|gb|EAS74655.1| pyridoxal phosphate biosynthetic protein [Vibrio alginolyticus
           12G01]
          Length = 244

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 130/238 (54%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     +  +N+E    +  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  ETI-----QTRMNLEMAVTDEMIEIALQTKPEFVCLVPEKREELTTEGGLDVVGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G ++SLF D   +   ++AAK  GA  IEL+TG Y       +Q+   L K
Sbjct: 118 AATKKLTDAGIKVSLFID--ADRQQIEAAKKCGAPFIELHTGHYADATTEDEQQ-AELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV
Sbjct: 175 IAAGASYAHDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLNKAV 231


>gi|325981702|ref|YP_004294104.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosomonas sp.
           AL212]
 gi|325531221|gb|ADZ25942.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosomonas sp.
           AL212]
          Length = 241

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 128/236 (54%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LR  R   +P+ +    IA  SGA  +T+H R D+RHI+  D+  +R  
Sbjct: 3   ELGVNIDHVATLRQARGTTYPDPIEAALIAESSGADAITLHLREDRRHIQDRDVEILRNR 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        +N+E    +  + +  R KP  I LVP+   +LT++ G D +++   + + 
Sbjct: 63  L-----TTRMNLESAVTDEMIAIALRIKPHDICLVPERREELTTEGGLDVVKHFDQIRRA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
             +L + G R+SLF   N +   + AA   GA  IE++TG Y   ++   QE+ FL ++ 
Sbjct: 118 CEKLGDAGIRVSLFI--NADALQINAAARAGASVIEIHTGSYADAHSFEAQEKHFL-EVQ 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               L + + L++NAGH L  +N+   I AIP ISE+++GHA  A A+  G K AV
Sbjct: 175 EAVGLGRDLGLKVNAGHGLHYENV-QAIAAIPEISELNIGHAIVARAIFVGFKRAV 229


>gi|152971420|ref|YP_001336529.1| pyridoxine 5'-phosphate synthase [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|150956269|gb|ABR78299.1| pyridoxal phosphate biosynthetic protein [Klebsiella pneumoniae
           subsp. pneumoniae MGH 78578]
          Length = 243

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 82/235 (34%), Positives = 125/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLTIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D   +E  ++AA   GA  IE++TG Y     + +Q R  L ++A 
Sbjct: 121 QRLADAGILVSLFID--ADEAQIKAAADVGAPYIEIHTGCYADAKTDAEQAR-ELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAV 231


>gi|283832044|ref|ZP_06351785.1| pyridoxine 5'-phosphate synthase [Citrobacter youngae ATCC 29220]
 gi|291071663|gb|EFE09772.1| pyridoxine 5'-phosphate synthase [Citrobacter youngae ATCC 29220]
          Length = 243

 Score =  132 bits (331), Expect = 6e-29,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 127/240 (52%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    I  Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIVEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D   +E  ++AA   GA  IE++TG Y     + +Q    L ++A 
Sbjct: 121 KRLADAGILVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAS-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I  IP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNV-KAIARIPEMHELNIGHAIIGRAVMSGLKDAVVEMKR 236


>gi|269965788|ref|ZP_06179885.1| Pyridoxine 5'-phosphate synthase [Vibrio alginolyticus 40B]
 gi|269829656|gb|EEZ83893.1| Pyridoxine 5'-phosphate synthase [Vibrio alginolyticus 40B]
          Length = 244

 Score =  132 bits (331), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 130/238 (54%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     +  +N+E    +  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  ETI-----QTRMNLEMAVTDEMVEIALQTKPEFVCLVPEKREELTTEGGLDVVGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G ++SLF D   +   ++AAK  GA  IEL+TG Y       +Q+   L K
Sbjct: 118 AATKKLTDAGIKVSLFID--ADRQQIEAAKKCGAPFIELHTGHYADATTEDEQQ-AELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV
Sbjct: 175 IAAGASYAHDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLNKAV 231


>gi|149918221|ref|ZP_01906713.1| pyridoxal phosphate biosynthetic protein [Plesiocystis pacifica
           SIR-1]
 gi|149820981|gb|EDM80388.1| pyridoxal phosphate biosynthetic protein [Plesiocystis pacifica
           SIR-1]
          Length = 240

 Score =  131 bits (330), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 70/215 (32%), Positives = 117/215 (54%), Gaps = 4/215 (1%)

Query: 26  LVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLN 85
           +V   ++ +++GA G+T+HPR D+RHI   D+ ++   +     + E NIEG P    + 
Sbjct: 1   MVEACRVCVEAGAPGITIHPREDERHITAADIGDVASFLAPHRDRVEFNIEGDPRPALMK 60

Query: 86  LCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEH 145
                +P+Q TLVP  P ++TS+ GW   +++ LL   +A+L   G R+SLF +      
Sbjct: 61  RVLEVEPDQCTLVPVRPGEITSEAGWIPQRDRELLEPVIAQLKGAGIRVSLFVEAESA-- 118

Query: 146 SLQAAKLTGADCIELYTGPYGACYNNPQQ-ERIFLNKLAITAQLAQKMDLQINAGHDLTI 204
           ++  A   GAD +ELYT PY   +   ++  R    +    A+ A +  L +NAGHDL +
Sbjct: 119 AIDWAAELGADRVELYTEPYARAFEAGEEAARASFARYVRAAEHAHQRGLGVNAGHDLDL 178

Query: 205 QNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            N+  L   +P++ E+S+GHA  + A+  G+   V
Sbjct: 179 ANL-GLFATLPHLDEVSIGHALISRAIFEGLDPVV 212


>gi|114775462|ref|ZP_01451030.1| pyridoxal phosphate biosynthetic protein [Mariprofundus
           ferrooxydans PV-1]
 gi|114553573|gb|EAU55954.1| pyridoxal phosphate biosynthetic protein [Mariprofundus
           ferrooxydans PV-1]
          Length = 236

 Score =  131 bits (330), Expect = 7e-29,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 131/239 (54%), Gaps = 10/239 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R   +P+ +    I L +GA+ +T H R D+RHI+  D+  +    
Sbjct: 3   LGVNIDHIATIRQARGTAYPDPLAAVSICLAAGANSITAHLREDRRHIQDRDIEGL---- 58

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   LN+E    +  + +CER KP+   LVP+   +LT++ G D +   + +   V
Sbjct: 59  -AAIDGLHLNMEMGVTDEMVAICERLKPKACCLVPEKREELTTEGGLDVVGQHSRMAAAV 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G R+S+F D    +  ++A++  GA  +EL+TG Y A Y    Q R  L  LA 
Sbjct: 118 ERLSAAGVRVSMFIDPVAEQ--IRASREIGAAVVELHTGHY-ANYQGAAQVR-ELAALAD 173

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A+LA  + L ++AGH LT++N P  I A+P + E+++GHA  A A+  G+ +AV  FR
Sbjct: 174 GAKLAADLGLLVHAGHGLTLENTPA-ICALPEVEELNIGHAIIADAIFKGLHQAVADFR 231


>gi|300114889|ref|YP_003761464.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus
           watsonii C-113]
 gi|299540826|gb|ADJ29143.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus
           watsonii C-113]
          Length = 246

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 132/240 (55%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ +     A Q+GA G+T+H R D+RHI+  D+  +R ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPIQAAIEAEQAGADGITLHLREDRRHIQERDVALLRDIL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                 +++N+E       L + E+Y+PE   LVP+   +LT++ G D       +T+  
Sbjct: 69  -----LSKMNLEMAVTGEMLAIAEQYRPEDCCLVPERREELTTEGGLDVAGQLGRITEAC 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+R+SLF D +  +  ++AA    A  +E++TG + A   + Q+ R    ++  
Sbjct: 124 VRLKEAGTRVSLFIDADPRQ--VEAAAQARAPVVEIHTGHF-ADARDEQRRRKEFQRIVE 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             +  ++  LQ+NAGH L  QN+   I A+P I E+++GHA  A AL  G++ AV   +R
Sbjct: 181 AVKKGREAGLQVNAGHGLNYQNVAA-IAALPDIVELNIGHAIMARALFTGMQSAVGEMKR 239


>gi|37527213|ref|NP_930557.1| pyridoxal phosphate biosynthetic protein PdxJ [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|81572413|sp|Q7N1X8|PDXJ_PHOLL RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|36786647|emb|CAE15711.1| Pyridoxal phosphate biosynthetic protein PdxJ (PNP synthase)
           [Photorhabdus luminescens subsp. laumondii TTO1]
          Length = 243

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 128/236 (54%), Gaps = 11/236 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+T+H R D+RHI   D+  +++ I
Sbjct: 6   LGVNIDHIATVRNARGTHYPDPVQAAFVAEQAGADGITIHLREDRRHITDRDVELLKKTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++  R KPE   LVP+   ++T++ G D +  +  +   V
Sbjct: 66  -----QTRMNLEMAVTDEMVDIACRIKPEFCCLVPEKRQEVTTEGGLDVIGQKDKVAAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEH-SLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
            RL + G  +SLF D    EH  + AA   GA  IE++TG Y    N  +QE+ F +++ 
Sbjct: 121 KRLSDAGILVSLFIDA---EHRQIDAANEVGAPFIEIHTGAYADAKNEVEQEKEF-HRIK 176

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             A  A    L +NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV
Sbjct: 177 AAATYAASKGLTVNAGHGLTYHNVQR-IAALPEIYELNIGHAIIGRAVFSGLTAAV 231


>gi|254448784|ref|ZP_05062241.1| pyridoxal phosphate biosynthetic protein PdxJ [gamma
           proteobacterium HTCC5015]
 gi|198261625|gb|EDY85913.1| pyridoxal phosphate biosynthetic protein PdxJ [gamma
           proteobacterium HTCC5015]
          Length = 246

 Score =  131 bits (329), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 133/240 (55%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ VA LR  R   +P+ +   ++A ++GA G+T+H R D+RHI+  D+   +  +
Sbjct: 6   LGINIDHVATLRQARLTTYPSPLKAAQLAEKAGADGITLHLREDRRHIQDADVAAFKTEL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +     +N+E    E  + + E   P  + LVP+   +LT++ G D ++ ++ + K V
Sbjct: 66  GTR-----MNLELAVTEEMIAIAENTAPFAVCLVPEKREELTTEGGLDVVKYRSAVEKAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G R+SLF D    +  +Q AK  GA  +EL+TG Y    +   +E   L ++  
Sbjct: 121 SRLAKAGCRVSLFIDAEPEQ--IQCAKAIGASVVELHTGRYAEADSVAARES-ELARIRE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A LA  + L ++AGH L + N+ + I AI  +SE+++GHA  A A+  G++ AV   R+
Sbjct: 178 GAALADSLGLLVHAGHGLNLDNVAD-IAAIEVVSELNIGHAIVADAVFVGMEAAVTAMRQ 236


>gi|330811507|ref|YP_004355969.1| Pyridoxal phosphate biosynthetic protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
 gi|327379615|gb|AEA70965.1| Pyridoxal phosphate biosynthetic protein [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 247

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 86/243 (35%), Positives = 127/243 (52%), Gaps = 13/243 (5%)

Query: 1   MSTS----VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTD 56
           MSTS    + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D
Sbjct: 1   MSTSNRILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERD 60

Query: 57  LPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQN 116
           +     L+ +   +  +N E    E  +   ER +P  I LVP+   +LT++ G D    
Sbjct: 61  V-----LLLKDVLQTRMNFEMGVTEEMMAFAERIRPAHICLVPETRQELTTEGGLDVAGQ 115

Query: 117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER 176
           +A ++  V RL  +G+ +SLF D   +E  ++A+K  GA  IEL+TG Y A    P    
Sbjct: 116 EARISMAVERLSKIGAEVSLFID--ADERQIEASKRVGAPAIELHTGRY-ADAQTPTDVA 172

Query: 177 IFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVK 236
             L ++A          L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K
Sbjct: 173 DELQRVADGVACGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFK 231

Query: 237 EAV 239
            AV
Sbjct: 232 SAV 234


>gi|149910152|ref|ZP_01898798.1| pyridoxal phosphate biosynthetic protein [Moritella sp. PE36]
 gi|149806738|gb|EDM66702.1| pyridoxal phosphate biosynthetic protein [Moritella sp. PE36]
          Length = 245

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 82/235 (34%), Positives = 127/235 (54%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P+ VH   +A  +GA G+TVH R D+RHI+  D+  ++  I
Sbjct: 6   LGVNIDHIATLRQARGTTYPDPVHAAAVAELNGADGITVHLREDRRHIQDRDVRVLKETI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E       L++    KPE + LVP+   +LT++ G D L  Q  +T+ V
Sbjct: 66  -----QTRMNLEMAVTAEMLDIACEIKPEFVCLVPEKREELTTEGGLDVLGQQDKITQAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D   ++  + AA  +GA  IE++TG Y    +  +Q+   L K+A 
Sbjct: 121 KRLSEAGILVSLFID--ADKEQIDAAVASGAPYIEVHTGAYADAESEGEQQA-ELKKIAA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               A    L++NAGH L   N+   I AIP I E+++GHA  A A   G+ +AV
Sbjct: 178 GVSYAHNAGLKVNAGHGLHYHNV-QPIAAIPEIYELNIGHAIIARAAFDGLGKAV 231


>gi|311693678|gb|ADP96551.1| pyridoxal phosphate biosynthetic protein PdxJ [marine bacterium
           HP15]
          Length = 246

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 129/235 (54%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V    +A ++GA G+T+HPR D+RHI+  D+     L+
Sbjct: 7   LGVNIDHVATLRQARGTRYPDPVQAALMAEEAGADGITIHPREDRRHIQDRDV-----LL 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            ++  + ++N+E    +  L   E+ +PE + LVP+   +LT++ G D    ++ + K  
Sbjct: 62  LKEVLQTKMNLEMAVTDAMLAFAEQVRPECVCLVPEKREELTTEGGLDVEGQESRVAKAC 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G+ +SLF D +  +  + AA   GA  +EL+TG Y A    P  E      +A 
Sbjct: 122 ERLARIGAEVSLFIDPDPVQ--IDAAVRCGAPVVELHTGEY-AEAETPDAENAAFKTIAD 178

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               A+K  L +NAGH L   N    + AI  I+E+++GHA  A A+  G+KEAV
Sbjct: 179 AVAYARKKGLIVNAGHGLHYHNTER-VAAIHGINELNIGHAIIARAVFTGLKEAV 232


>gi|70728456|ref|YP_258205.1| pyridoxine 5'-phosphate synthase [Pseudomonas fluorescens Pf-5]
 gi|91207558|sp|Q4KHS8|PDXJ_PSEF5 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|68342755|gb|AAY90361.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           fluorescens Pf-5]
          Length = 248

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 127/243 (52%), Gaps = 13/243 (5%)

Query: 1   MSTS----VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTD 56
           M+TS    + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D
Sbjct: 1   MTTSNRILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERD 60

Query: 57  LPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQN 116
           +     L+ +   +  +N E    E  +   ER +P  I LVP+   +LT++ G D    
Sbjct: 61  V-----LLLKDVLQTRMNFEMGVTEEMMAFAERIRPAHICLVPETRQELTTEGGLDVAGQ 115

Query: 117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER 176
           +A +   V RL  +GS +SLF D   +E  ++A+K  GA  IEL+TG Y A    P +  
Sbjct: 116 EARIKAAVERLSKIGSEVSLFID--ADERQIEASKRVGAPAIELHTGRY-ADAQTPSEVA 172

Query: 177 IFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVK 236
             L ++     +     L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K
Sbjct: 173 EELQRIVDGVAVGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFK 231

Query: 237 EAV 239
            AV
Sbjct: 232 GAV 234


>gi|87124717|ref|ZP_01080565.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           RS9917]
 gi|86167596|gb|EAQ68855.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           RS9917]
          Length = 249

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 132/241 (54%), Gaps = 10/241 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R  
Sbjct: 3   SLGVNIDHIANVRQARRTVEPDPVSYALLAELGGADGITVHLREDRRHIQDRDVDLLR-- 60

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              Q  ++ LN+E         +  R +P+ +TLVP+   ++T++ G D       L + 
Sbjct: 61  ---QTVRSRLNLEMAATTEMEAIALRIRPDMVTLVPEKREEVTTEGGLDVAGQVEPLQRL 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL + G  +SLF D +  +  LQA + TGA  +EL+TG Y A    P Q  + L +L 
Sbjct: 118 VGRLQDAGIGVSLFVDADARQ--LQACRTTGARWVELHTGRY-AEAAWPDQP-LELARLI 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             + +A+ +DL++NAGH LT QN+   + AI  + E+++GH   A AL  G++ AV   +
Sbjct: 174 EGSAIARNLDLRVNAGHGLTYQNV-EAVAAIEGMEELNIGHTIVARALAVGLQSAVSEMK 232

Query: 244 R 244
           R
Sbjct: 233 R 233


>gi|301064611|ref|ZP_07205007.1| pyridoxine 5'-phosphate synthase [delta proteobacterium NaphS2]
 gi|300441359|gb|EFK05728.1| pyridoxine 5'-phosphate synthase [delta proteobacterium NaphS2]
          Length = 239

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 128/237 (54%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
            +++VN++ VA +R  R +  P+ V    IA  +GA G+  H R D+RHI   DL  +R 
Sbjct: 2   ATLAVNVDHVATIREARGIDAPDPVLAAGIAELAGADGIICHLREDRRHINDRDLKLLRE 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +     K +LN+E    +  + +    KP+ +TLVP+   +LT++ G D L   A   +
Sbjct: 62  TV-----KTKLNMEMAAVDEMVEIALSVKPDMVTLVPEKRQELTTEGGLDVLARPAHYGE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RLH  G ++SLF D +  +  + AA+    D IE++TG Y    +  + E +F  ++
Sbjct: 117 VVGRLHEAGIKVSLFIDPDPEQ--VGAARDCRGDIIEIHTGHYAEAKSEEEAEELF-KRV 173

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              AQ A  MDL ++AGH L  QNI    N +P + E S+GH+  A A+  G ++AV
Sbjct: 174 VRAAQAASSMDLGVSAGHGLNYQNIKRFKN-LPLVQEYSIGHSIVAMAVLVGFEKAV 229


>gi|258592309|emb|CBE68618.1| pyridoxal phosphate biosynthetic protein PdxJ (PNP synthase) [NC10
           bacterium 'Dutch sediment']
          Length = 242

 Score =  130 bits (328), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 86/241 (35%), Positives = 130/241 (53%), Gaps = 9/241 (3%)

Query: 7   VNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDE 66
           VN++ +A +R  R    P+ V     A  +GASG+TVH R D+RHI+  D+  +RRL+  
Sbjct: 6   VNVDHIATIRQSRRGVEPDPVQAALFAESAGASGITVHLREDRRHIQDRDVELLRRLV-- 63

Query: 67  QFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVAR 126
              K +LN+E    E  + +    KPE  TLVP+   +LT++ G D   +   + + V R
Sbjct: 64  ---KTKLNLEMAVTEEMIEIALALKPEMATLVPERREELTTEGGLDVHGHIDDVGRAVRR 120

Query: 127 LHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITA 186
           L   G  +SLF D     H + AA   GAD +EL+TG Y        QE   L +L  + 
Sbjct: 121 LREGGIAVSLFID--PEHHQVAAAARAGADFVELHTGSYAEAKGRKAQES-ELTRLIQSV 177

Query: 187 QLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRAC 246
              +++DL+INAGH L  +N+ + I AIP + E+S+GH+  A A+  G++ A+     A 
Sbjct: 178 TAGRELDLRINAGHGLDYRNVGS-IAAIPEVEELSIGHSIIARAVLVGMERAIREMLAAM 236

Query: 247 G 247
           G
Sbjct: 237 G 237


>gi|296136813|ref|YP_003644055.1| pyridoxal phosphate biosynthetic protein PdxJ [Thiomonas intermedia
           K12]
 gi|295796935|gb|ADG31725.1| pyridoxal phosphate biosynthetic protein PdxJ [Thiomonas intermedia
           K12]
          Length = 257

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 139/252 (55%), Gaps = 16/252 (6%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V   + A+++GA  +T H R D+RHIR  D+  ++  +
Sbjct: 14  LGVNIDHVATLRNARGGSFPDPVLAAQQAVEAGADIITFHLREDRRHIRDADVERLKTTL 73

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                 A LN E       L++  R +P+ + LVP+   ++T++ G D       + +  
Sbjct: 74  -----SAPLNFESALAPEMLDIICRVRPQMVCLVPERRQEVTTEGGLDVAGQFDRVREAC 128

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ---ERIFLNK 181
           ARL + G R+SLF + +  +  ++A+   GA CIEL+TG Y   ++   +   +R F ++
Sbjct: 129 ARLADFGCRVSLFIEPSIRQ--IEASAQAGAPCIELHTGAYANAFDAADEAARQREF-DR 185

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +    +L + + LQ NAGH L++Q+ P  I A+P +SE+ +GHA    A+  G+K++V  
Sbjct: 186 IVAGLKLGRSLGLQTNAGHGLSLQSTPA-IAALPEVSELHIGHALIGHAVFVGLKQSVRD 244

Query: 242 FR----RACGQH 249
           F+    RA   H
Sbjct: 245 FQAVIARAVATH 256


>gi|330828485|ref|YP_004391437.1| pyridoxine 5'-phosphate synthase [Aeromonas veronii B565]
 gi|328803621|gb|AEB48820.1| Pyridoxine 5'-phosphate synthase [Aeromonas veronii B565]
          Length = 245

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 130/239 (54%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVEILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  + +  R KP  + LVP+   ++T++ G D     A +T  V
Sbjct: 66  -----QTRMNLEMAVTEEMIGIACRIKPHFVCLVPEKRTEVTTEGGLDVAGQLAKVTDAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL  +G+++SLF D +  +  + AA  +GA  IE++TG Y     + ++   F  ++A 
Sbjct: 121 ARLSAVGAQVSLFIDADPIQ--IDAAAESGAPFIEIHTGRYADATTDAERNAEF-KRIAA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A  A    L++NAGH L   N+   I AIP + E+++GHA    A   G+ +AV   R
Sbjct: 178 GASYAAGKGLKVNAGHGLHYHNV-KAIAAIPELYELNIGHAIIGRAAFDGLAKAVSDMR 235


>gi|78213182|ref|YP_381961.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           CC9605]
 gi|123577976|sp|Q3AJ26|PDXJ_SYNSC RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|78197641|gb|ABB35406.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           CC9605]
          Length = 249

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 134/237 (56%), Gaps = 12/237 (5%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R+ 
Sbjct: 3   SLGVNIDHIANIREARRTVEPDPVSMALLAELGGADGITVHLREDRRHIQDRDVELLRQT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     ++ LN+E    E  + +  R KP+ +TLVP+   ++T++ G D    +A L+  
Sbjct: 63  V-----RSRLNLEMASTEEMVAIALRIKPDMVTLVPERREEVTTEGGLDVAGQKASLSAM 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLNKL 182
           V  L   G  +SLF D    +  LQA K TGA  +EL+TG Y  A ++   QE   L +L
Sbjct: 118 VQTLQAAGIPVSLFVDPEATQ--LQACKNTGACWVELHTGRYADADWSTQPQE---LARL 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                +AQ++ L++NAGH LT QN+   I AI  + E+++GH   A ++  G+++AV
Sbjct: 173 QEGTAIAQQLGLRVNAGHGLTYQNVEP-IAAIAGMEELNIGHTIVARSVAVGLQQAV 228


>gi|92113758|ref|YP_573686.1| pyridoxal phosphate biosynthetic protein PdxJ [Chromohalobacter
           salexigens DSM 3043]
 gi|91796848|gb|ABE58987.1| pyridoxine 5'-phosphate synthase [Chromohalobacter salexigens DSM
           3043]
          Length = 270

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 127/240 (52%), Gaps = 10/240 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P+ V    +A ++GA G+T+H R D+RHI+  D+    R++
Sbjct: 8   LGVNIDHIATLRQARGTRYPDPVQAAMLAEEAGADGITLHLREDRRHIQERDV----RVL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            E      +N+E    E  +   E  +P  + LVP+   +LT++ G D +     +    
Sbjct: 64  AETLAT-RMNLEMAVTEEMIAFAETLRPANVCLVPEKREELTTEGGLDVVGACERVGDAC 122

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D    +  +QAA   GA  +EL+TG Y     + Q  R+   +L  
Sbjct: 123 RRLAAAGCEVSLFIDPEPAQ--IQAAYELGAPTVELHTGAYAEASGDAQ--RVEYQRLVA 178

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A++A ++ L +NAGH L   N+   I AIP I E+++GHA  A AL  G+KEAV   +R
Sbjct: 179 AAEMAFELGLTVNAGHGLHYHNV-EAIAAIPGIHELNIGHAIIARALFVGLKEAVAEMKR 237


>gi|254230527|ref|ZP_04923898.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio sp. Ex25]
 gi|262393273|ref|YP_003285127.1| pyridoxine 5'-phosphate synthase [Vibrio sp. Ex25]
 gi|151936952|gb|EDN55839.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio sp. Ex25]
 gi|262336867|gb|ACY50662.1| pyridoxine 5'-phosphate synthase [Vibrio sp. Ex25]
          Length = 243

 Score =  130 bits (327), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 130/238 (54%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D +     + 
Sbjct: 63  ETI-----QTRMNLEMAVTDEMVEIALQTQPEFVCLVPEKREELTTEGGLDVVGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G ++SLF D   +   ++AAK  GA  IEL+TG Y       +Q+   L K
Sbjct: 118 AATKKLTDAGIKVSLFID--ADRQQIEAAKKCGAPFIELHTGHYADATTEDEQQ-AELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV
Sbjct: 175 IAAGASYAHDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLNKAV 231


>gi|30250249|ref|NP_842319.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosomonas
           europaea ATCC 19718]
 gi|81584556|sp|Q82SJ7|PDXJ_NITEU RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|30181044|emb|CAD86234.1| Pyridoxal phosphate biosynthetic protein PdxJ [Nitrosomonas
           europaea ATCC 19718]
          Length = 241

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 84/237 (35%), Positives = 126/237 (53%), Gaps = 11/237 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR-R 62
           ++ VN++ VA +R  R   +P+ V    +A  +GA  +T+H R D+RHI+  D+  +R R
Sbjct: 3   ALGVNIDHVATVRQARGTTYPSPVEAALVAEVAGADAITLHLREDRRHIQENDVVILRDR 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L      K  +N+E    E  +    R KP  I LVP+   +LT++ G D +++   ++ 
Sbjct: 63  L------KTRMNLESAVTEEMIAFACRIKPHDICLVPERREELTTEGGLDVIRHFQQVSV 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              RL   G R+SLF D    +  + AA   GA  IEL+TG Y A    P+ +++ L  +
Sbjct: 117 ACKRLAEAGIRVSLFVDAQAGQ--IDAAVEAGAPVIELHTGRY-ADAATPEMQQVELETI 173

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A  A    LQ+NAGH L  +N    I AIP +SE+++GHA  A AL  G  EAV
Sbjct: 174 RTMAAYAFGRGLQVNAGHGLHYENTVQ-IAAIPELSELNIGHAIVARALFVGFAEAV 229


>gi|328474124|gb|EGF44929.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus 10329]
          Length = 243

 Score =  130 bits (326), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 133/238 (55%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH+ +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHVAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     +  +N+E    E  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  ETI-----QTRMNLEMAVTEEMVEIALKTKPEFVCLVPEKREELTTEGGLDVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   +   ++AAK  GA  IEL+TG Y A     ++++  L K
Sbjct: 118 AATQKLTEAGIKVSLFID--ADRQQIEAAKQCGAPFIELHTGHY-ADAETEEEQQAELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G++++V
Sbjct: 175 IAAGASYADDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLEKSV 231


>gi|148242652|ref|YP_001227809.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. RCC307]
 gi|166219116|sp|A5GU97|PDXJ_SYNR3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|147850962|emb|CAK28456.1| Pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           RCC307]
          Length = 252

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 131/236 (55%), Gaps = 10/236 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ +NL+ +A +R  R    P+ VH+  +A   GA G+TVH R D+RHI+  D+  +R+ 
Sbjct: 3   SLGINLDHIATVRQARRTVEPDPVHLALLAELGGADGITVHLREDRRHIQDRDVELLRQT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     +  LN+E       + +    KP+ +TLVP+   ++T++ G D +   A L   
Sbjct: 63  V-----RTRLNLEMAATAEMVAIALTIKPDMVTLVPEKRQEVTTEGGLDVVSQAAALQGQ 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +++L   G  +SLF D       LQA++ +GA  +EL+TG Y     +  Q+ + L +L 
Sbjct: 118 ISQLQGAGIPVSLFVD--PERAQLQASQRSGARWVELHTGSYAEASWS--QQPLELARLI 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                A+++ L++NAGH LT QN+   I AI  + E+++GH   A A+  G++EAV
Sbjct: 174 EGTTEARQLGLRVNAGHGLTYQNVEP-IAAISGMEELNIGHTVMARAMAVGLQEAV 228


>gi|284108788|ref|ZP_06386453.1| Pyridoxal phosphate (active vitamin B6) biosynthesis PdxJ
           [Candidatus Poribacteria sp. WGA-A3]
 gi|283829862|gb|EFC34153.1| Pyridoxal phosphate (active vitamin B6) biosynthesis PdxJ
           [Candidatus Poribacteria sp. WGA-A3]
          Length = 242

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 83/239 (34%), Positives = 135/239 (56%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R    P+ +    +A   GA GL VH R D+RHI+  DL  +R ++
Sbjct: 4   LGVNIDHVATLRQARGGHEPDPIAAAVLADLGGADGLVVHLREDRRHIQERDLNLLRDIV 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
               P A LN+E   ++    +  R +P+++TLVP+   +LT++ G   ++++  LT  +
Sbjct: 64  ----PSA-LNLEMAADDATAKIALRVRPDKVTLVPERRQELTTEGGLAVMEHRKRLTTFI 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
              H+    +SLF D +  +  ++AA   GAD +EL+TG Y A  ++PQ  R  ++ L  
Sbjct: 119 RLFHDAQIPVSLFIDPDHRQ--IRAAHKVGADAVELHTGTY-ANSHHPQDIRKEVDALVH 175

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A LAQ++ L++NAGH LT  NI +L   I  I E ++GH+  + A+  G++ AV   R
Sbjct: 176 GANLAQQLGLEVNAGHGLTYHNISHL-TGITDIVEFNIGHSIISRAVLVGLERAVREMR 233


>gi|227328578|ref|ZP_03832602.1| pyridoxine 5'-phosphate synthase [Pectobacterium carotovorum subsp.
           carotovorum WPP14]
          Length = 243

 Score =  129 bits (325), Expect = 3e-28,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 128/236 (54%), Gaps = 11/236 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R  +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRILRETL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  LN+    KP    LVP+   ++T++ G D    Q  + K V
Sbjct: 66  -----QTRMNLEMAVTEEMLNIACEVKPHFCCLVPEKRQEVTTEGGLDVAGQQEKIDKAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL      +SLF D   ++  + AA  +GA  IE++TG Y    ++  ++  F  ++  
Sbjct: 121 ARLSQANILVSLFID--ADKRQIDAAVASGAPYIEIHTGAYADALDDEARQHEF-ERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNI-PNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A    L++NAGH LT  N+ P  I A+P + E+++GHA    A+  G+K+AV
Sbjct: 178 SATYAAAKGLKVNAGHGLTYHNVLP--IAALPEMHELNIGHAIIGRAVMSGLKDAV 231


>gi|153835466|ref|ZP_01988133.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio harveyi HY01]
 gi|156975789|ref|YP_001446696.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio harveyi ATCC
           BAA-1116]
 gi|269960402|ref|ZP_06174775.1| Pyridoxine 5''-phosphate synthase [Vibrio harveyi 1DA3]
 gi|148867977|gb|EDL67174.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio harveyi HY01]
 gi|156527383|gb|ABU72469.1| hypothetical protein VIBHAR_03533 [Vibrio harveyi ATCC BAA-1116]
 gi|269834829|gb|EEZ88915.1| Pyridoxine 5''-phosphate synthase [Vibrio harveyi 1DA3]
          Length = 243

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 130/239 (54%), Gaps = 11/239 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     +  +N+E    +  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  ETI-----QTRMNLEMAVTDEMVEIALQTKPEFVCLVPEKREELTTEGGLDVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLN 180
               +L   G ++SLF D   +   + AAK  GA  IEL+TG Y  A     QQ+   L 
Sbjct: 118 AATQKLTEAGIKVSLFID--ADRQQIDAAKACGAPYIELHTGHYADATTEEDQQDE--LK 173

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           K+A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G++++V
Sbjct: 174 KIAAGASYADDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLEKSV 231


>gi|189347224|ref|YP_001943753.1| pyridoxine 5'-phosphate synthase [Chlorobium limicola DSM 245]
 gi|189341371|gb|ACD90774.1| pyridoxal phosphate biosynthetic protein PdxJ [Chlorobium limicola
           DSM 245]
          Length = 264

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 83/244 (34%), Positives = 132/244 (54%), Gaps = 13/244 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +SVN++ +A LRN RN   P+ V    IA +SGA+G+  H R D+RHIR  DL  +R   
Sbjct: 28  LSVNIDHIATLRNARNEFDPDPVEAALIAEKSGAAGIVCHLREDRRHIRDLDLERLR--- 84

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q    +L++E    +    +  + KPE +TLVP+   +LT++ G+D  ++   L + +
Sbjct: 85  --QAVTTKLDLEMAMTQEMQEIALKTKPELVTLVPEKREELTTEGGFDITRHYKTLAEFI 142

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L++    +S+F +   N  ++  AK  GAD +EL+TG Y     + ++E+  L K+  
Sbjct: 143 KPLNDASIAVSIFIEPEQN--AIDLAKKAGADIVELHTGIYSLKKTDEEREK-ELEKIRH 199

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAA----TALECGVKEAVF 240
            A  A+ + L + AGH L  +N  +  + I  I E+S+GHA  A    T LE  VKE + 
Sbjct: 200 AALFAKTLGLSVVAGHGLNYRNAASF-SRIMQIEEVSIGHAIIARAAFTGLEAAVKEMLQ 258

Query: 241 CFRR 244
             RR
Sbjct: 259 LLRR 262


>gi|324113091|gb|EGC07067.1| pyridoxine 5'-phosphate synthase [Escherichia fergusonii B253]
 gi|325496356|gb|EGC94215.1| pyridoxine 5'-phosphate synthase [Escherichia fergusonii ECD227]
          Length = 243

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  DTR-----MNLEMAVTEEMLAIAVETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G ++SLF D   +E  ++AA   GA  IE++TG Y     + +Q +  L ++A 
Sbjct: 121 KRLADAGIQVSLFID--ADEEQIKAAAEVGAPFIEIHTGCYADAKTDAEQAQ-ELARIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I AIP + E+++GHA    A+  G+K+AV   +R
Sbjct: 178 AAAFAASLGLKVNAGHGLTYHNV-KAIAAIPEMHELNIGHAIIGRAVMTGLKDAVAEMKR 236


>gi|206580518|ref|YP_002237093.1| pyridoxine 5'-phosphate synthase [Klebsiella pneumoniae 342]
 gi|288934055|ref|YP_003438114.1| pyridoxal phosphate biosynthetic protein PdxJ [Klebsiella variicola
           At-22]
 gi|290508251|ref|ZP_06547622.1| pyridoxine 5'-phosphate synthase [Klebsiella sp. 1_1_55]
 gi|206569576|gb|ACI11352.1| pyridoxine 5'-phosphate synthase [Klebsiella pneumoniae 342]
 gi|288888784|gb|ADC57102.1| pyridoxal phosphate biosynthetic protein PdxJ [Klebsiella variicola
           At-22]
 gi|289777645|gb|EFD85642.1| pyridoxine 5'-phosphate synthase [Klebsiella sp. 1_1_55]
          Length = 243

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 80/240 (33%), Positives = 127/240 (52%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R  +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRETL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +     +N+E    E  L +    KP    LVP+   ++T++ G D    +  +    
Sbjct: 66  HTR-----MNLEMAVTEEMLTIACETKPHFCCLVPEKRQEVTTEGGLDVAGQRDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +  ++AA   GA  IE++TG Y     +  Q +  L ++A 
Sbjct: 121 QRLADAGILVSLFIDADNEQ--IKAAADVGAPYIEIHTGCYADAKTDAGQAK-ELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASLGLKVNAGHGLTYHNV-KAIAALPEMHELNIGHAIIGRAVMSGLKEAVAEMKR 236


>gi|33240539|ref|NP_875481.1| pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus subsp. marinus str. CCMP1375]
 gi|81664417|sp|Q7VBK3|PDXJ_PROMA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|33238067|gb|AAQ00134.1| Pyridoxal phosphate biosynthesis protein [Prochlorococcus marinus
           subsp. marinus str. CCMP1375]
          Length = 246

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 82/238 (34%), Positives = 129/238 (54%), Gaps = 12/238 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           TS+ VN++ +A +R  R    P+ V +  +A   GA G+T+H R D+RHI+  DL  +R 
Sbjct: 2   TSLGVNIDHIANIRQARLANEPDPVQMALLAELGGADGITIHLREDRRHIQDRDLKLLRE 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            I     K+ LN+E       + +    KP+ ITLVP+   ++T++ G D   N   L +
Sbjct: 62  TI-----KSRLNLEMAATTEMIEIALDLKPDMITLVPERREEITTEGGLDVASNAKSLKE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLNK 181
            V ++ +     SLF D N  +  L+A+   GA  +EL+TGPY  A + N   E     K
Sbjct: 117 IVTKMESCCIPTSLFVDANSKQ--LEASSKIGATWVELHTGPYARASWKNQPLE---FAK 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           ++     A+ + L++NAGH LT QN+   I +I  + E+++GH   A A+  G+KEAV
Sbjct: 172 ISEGVARARNLGLRVNAGHGLTYQNVEP-IASITEMEELNIGHTIIARAIAIGLKEAV 228


>gi|312881715|ref|ZP_07741492.1| pyridoxine 5'-phosphate synthase [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370605|gb|EFP98080.1| pyridoxine 5'-phosphate synthase [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 243

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 128/238 (53%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVKILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     +  +N+E    +  + +    KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  ETI-----QTRMNLEMAVTDEMIAIAIDTKPEYVCLVPEKREELTTEGGLDVVGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G ++SLF D   +   + AAK  GA  +EL+TG Y    ++  ++   L K
Sbjct: 118 AATNKLSDAGIKVSLFID--ADREQIMAAKECGAPFVELHTGQYAEAKSDEDKQN-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GH+    A   G+ +AV
Sbjct: 175 IAAGASYAHGLGITVNAGHGLTYHNVTP-IAAIPEIFELNIGHSIIGRAAFDGLHKAV 231


>gi|294340982|emb|CAZ89377.1| Pyridoxal phosphate biosynthetic protein pdxJ (PNP synthase)
           [Thiomonas sp. 3As]
          Length = 254

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 139/252 (55%), Gaps = 16/252 (6%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V   + A+++GA  +T H R D+RHIR  D+  ++  +
Sbjct: 11  LGVNIDHVATLRNARGGSFPDPVLAAQQAVEAGADIITFHLREDRRHIRDADVERLKATL 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                 A LN E       L++  R +P+ + LVP+   ++T++ G D       + +  
Sbjct: 71  -----SAPLNFESALAPEMLDIICRVRPQMVCLVPERRQEVTTEGGLDVAGQFDRVREAC 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ---ERIFLNK 181
           ARL + G R+SLF + +  +  ++A+   GA CIEL+TG Y   ++   +   +R F ++
Sbjct: 126 ARLADFGCRVSLFIEPSIWQ--IEASAQAGAPCIELHTGAYANAFDAADEAARQREF-DR 182

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +    +L + + LQ NAGH L++Q+ P  I A+P +SE+ +GHA    A+  G+K++V  
Sbjct: 183 IVAGLKLGRSLGLQTNAGHGLSLQSTPA-IAALPEVSELHIGHALIGHAVFVGLKQSVRD 241

Query: 242 FR----RACGQH 249
           F+    RA   H
Sbjct: 242 FQAVIARAVATH 253


>gi|257486567|ref|ZP_05640608.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
 gi|331010049|gb|EGH90105.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. tabaci
           ATCC 11528]
          Length = 246

 Score =  129 bits (324), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKSAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAQTPTEVAEELQRIAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGVAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|77457224|ref|YP_346729.1| pyridoxine 5'-phosphate synthase [Pseudomonas fluorescens Pf0-1]
 gi|91207560|sp|Q3KHL6|PDXJ_PSEPF RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|77381227|gb|ABA72740.1| pyridoxine 5'-phosphate synthase [Pseudomonas fluorescens Pf0-1]
          Length = 247

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 82/235 (34%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  +   ER +P  I LVP+   +LT++ G D    +  +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMMAFAERIRPAHICLVPETRQELTTEGGLDVAGQEERIRAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLSKIGSEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAETPSEVAEELKRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKSAV 234


>gi|117925157|ref|YP_865774.1| pyridoxine 5'-phosphate synthase [Magnetococcus sp. MC-1]
 gi|166219096|sp|A0L8S5|PDXJ_MAGSM RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|117608913|gb|ABK44368.1| pyridoxine 5'-phosphate synthase [Magnetococcus sp. MC-1]
          Length = 243

 Score =  129 bits (324), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 134/240 (55%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P+ V     A ++GA  +TVH R D+RHI+  D+     ++
Sbjct: 4   LGVNIDHIATLRQARGERYPDPVDAAFAAERAGADSITVHLREDRRHIQDRDV-----VL 58

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +Q  + ++N+E   +E  L L ER+KP+   LVP+  H+LT++ G D + N+  L   V
Sbjct: 59  LQQTCQTKINLEMAASEPMLTLAERWKPQDCCLVPEKRHELTTEGGLDVVGNRHRLADAV 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARLH+ G R+SLF D +  +  + AA   GA  +E++TG Y       Q+  + L +L  
Sbjct: 119 ARLHDAGIRVSLFVDPDLEQ--ISAAGAIGATVVEMHTGRYANAATQAQRN-LELEQLYR 175

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L ++AGH LT  N+   I  +P + E+++GHA  A A+  G++ AV   +R
Sbjct: 176 AAHQASLNGLTVHAGHGLTYHNV-QPIARLPDLKELNIGHAIIARAVMVGMESAVKEMKR 234


>gi|330877432|gb|EGH11581.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv.
           morsprunorum str. M302280PT]
          Length = 246

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 122/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            ++  +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKEVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVSGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAQTPTEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|289628147|ref|ZP_06461101.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. aesculi
           str. NCPPB3681]
 gi|289649887|ref|ZP_06481230.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. aesculi
           str. 2250]
 gi|330871238|gb|EGH05947.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. aesculi
           str. 0893_23]
          Length = 246

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKSAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAQTPTEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKSAV 234


>gi|298488680|ref|ZP_07006709.1| Pyridoxal phosphate biosynthetic protein pdxJ [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
 gi|298156753|gb|EFH97844.1| Pyridoxal phosphate biosynthetic protein pdxJ [Pseudomonas
           savastanoi pv. savastanoi NCPPB 3335]
          Length = 246

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAQTPTEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKSAV 234


>gi|254507464|ref|ZP_05119598.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio
           parahaemolyticus 16]
 gi|219549534|gb|EED26525.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio
           parahaemolyticus 16]
          Length = 243

 Score =  129 bits (323), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 125/238 (52%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEVAERAGADGITIHLREDRRHINDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     +  +N+E    +  + +    +PE + LVP+   +LT++ G D +     + 
Sbjct: 63  ETI-----QTRMNLEMAVTDEMVEIALNTQPEYVCLVPEKREELTTEGGLDVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   +   + AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATQKLSEAGIKVSLFID--ADREQIDAAKACGAPFIELHTGHYADAETEEDQQD-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GH+    A   G+ +AV
Sbjct: 175 IAAGASYAADLGITVNAGHGLTYHNVA-AIAAIPEIYELNIGHSIIGRAAFDGLHKAV 231


>gi|209695940|ref|YP_002263870.1| pyridoxine 5'-phosphate synthase [Aliivibrio salmonicida LFI1238]
 gi|208009893|emb|CAQ80206.1| pyridoxal phosphate biosynthetic protein PdxJ [Aliivibrio
           salmonicida LFI1238]
          Length = 243

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 81/243 (33%), Positives = 132/243 (54%), Gaps = 9/243 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA+G+T+H R D+RHI+  D+    
Sbjct: 3   SILLGVNIDHVATLRNARGTKYPDPVHAAEIAERAGAAGITIHLREDRRHIKDRDV---- 58

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           R++ E   +  +N+E    +  + +    +PE + LVP+   +LT++ G + +     + 
Sbjct: 59  RILRETL-QTRMNLEMAVTDEMVGIALETQPEFVCLVPEKREELTTEGGLNVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
                L   G ++SLF D +  +  + AA   GA  IEL+TG Y A     + E+I L K
Sbjct: 118 AATQTLSKAGIKVSLFIDADNAQ--IDAAVACGAPFIELHTGAY-ADAETEEAEQIELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +A  A  A    L +NAGH LT  N+   I A+P I E+++GH+    A+  G+++AV  
Sbjct: 175 IAAGATYAASKGLIVNAGHGLTYHNV-EAIAALPEIYELNIGHSIMGRAVFDGLEKAVAD 233

Query: 242 FRR 244
             R
Sbjct: 234 MHR 236


>gi|302186920|ref|ZP_07263593.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. syringae
           642]
          Length = 246

 Score =  129 bits (323), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 122/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A  + P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAHTPTEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|253988789|ref|YP_003040145.1| pyridoxine 5'-phosphate synthase [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253780239|emb|CAQ83400.1| pyridoxine 5'-phosphate synthase [Photorhabdus asymbiotica]
          Length = 243

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+T+H R D+RHI   D+  + + I
Sbjct: 6   LGVNIDHIATVRNARGTNYPDPVQAAFVAEQAGADGITIHLREDRRHITDRDVELLSQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++  R KPE   LVP+   ++T++ G D +  +  +   V
Sbjct: 66  -----QTRMNLEMAVTDEMVDIACRIKPEFCCLVPEKRQEVTTEGGLDVVGQKDKVMAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D   +   + AA+  GA  IE++TG Y    N  +QE+ F  ++  
Sbjct: 121 KRLSEAGILVSLFID--ADHQQIDAAREVGAPFIEIHTGAYADAENEIEQEKEF-QRIKK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L +NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV
Sbjct: 178 AATYAVGIGLTVNAGHGLTYHNVQR-IAALPEIYELNIGHAIIGRAVFSGLTAAV 231


>gi|66047175|ref|YP_237016.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. syringae
           B728a]
 gi|75500900|sp|Q4ZPE4|PDXJ_PSEU2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|63257882|gb|AAY38978.1| Pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas syringae
           pv. syringae B728a]
          Length = 246

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEDMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAQTPTEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLVVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|114331753|ref|YP_747975.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosomonas
           eutropha C91]
 gi|122313496|sp|Q0AF72|PDXJ_NITEC RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|114308767|gb|ABI60010.1| pyridoxine 5'-phosphate synthase [Nitrosomonas eutropha C91]
          Length = 241

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 83/237 (35%), Positives = 125/237 (52%), Gaps = 11/237 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ VA LR  R   +P+ +    +A +SGA  +T+H R D+RHI+  D+  +R  
Sbjct: 3   ALGVNIDHVATLRQARGTDYPSPIKAALVAEESGADAITLHLREDRRHIQEEDVIILRER 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     K  +N+E    E  ++   R KP  I LVP+   +LT++ G D +++   ++  
Sbjct: 63  L-----KTRMNLESAVTEEMISFACRIKPHDICLVPERREELTTEGGLDVIRHFDQVSAA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLNKL 182
             RL   G R+SLF D   ++  + AA   GA  IEL+TG Y  A  +  QQ    L  +
Sbjct: 118 CKRLTEAGIRVSLFVDARADQ--IDAAIRVGAPVIELHTGHYADAATSEAQQAE--LETI 173

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A  A    LQ+NAGH L  QN    I  IP I+E+++GHA  A AL  G  +AV
Sbjct: 174 RSMAAYAFSRGLQVNAGHSLHYQN-TTPIAFIPEITELNIGHAIVARALFIGFAQAV 229


>gi|330898518|gb|EGH29937.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. japonica
           str. M301072PT]
          Length = 246

 Score =  128 bits (322), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAQTPTEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|330989029|gb|EGH87132.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv.
           lachrymans str. M301315]
          Length = 246

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAQTPTEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|261253897|ref|ZP_05946470.1| pyridoxine 5'-phosphate synthase [Vibrio orientalis CIP 102891]
 gi|260937288|gb|EEX93277.1| pyridoxine 5'-phosphate synthase [Vibrio orientalis CIP 102891]
          Length = 243

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 126/238 (52%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHIVDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +  + KPE + LVP+   +LT++ G D   +   + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMVEIALKTKPEYVCLVPEKREELTTEGGLDVAGHLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
                L   G ++SLF D   +   + AAK  GA  +EL+TG Y        Q+   L K
Sbjct: 118 AATQTLSEAGIKVSLFID--ADREQIDAAKACGAPFVELHTGHYADAETEEDQQD-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GH+    A+  G+ +AV
Sbjct: 175 IAAGASYAADLGITVNAGHGLTYHNVAP-IAAIPEIFELNIGHSIMGRAVFDGLNKAV 231


>gi|90407382|ref|ZP_01215567.1| pyridoxal phosphate biosynthetic protein [Psychromonas sp. CNPT3]
 gi|90311533|gb|EAS39633.1| pyridoxal phosphate biosynthetic protein [Psychromonas sp. CNPT3]
          Length = 246

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 127/240 (52%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P   H+  IA  SGA G+T+H R D+RHI   D+      I
Sbjct: 6   LGVNIDHVATLRNARGTCYPEPAHLAGIAETSGADGITIHLREDRRHIIDRDVA-----I 60

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++  + KP  + LVP+   +LT++ G D           V
Sbjct: 61  LAQTLQTRMNLEMAITDEMIDIAIKTKPAFVCLVPEKRAELTTEGGLDVAGALDKTRSAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D + N+  + AA  +GA  IEL+TG Y    ++  Q  + L ++A 
Sbjct: 121 QRLTQAGIQVSLFIDADKNQ--IDAALASGAPYIELHTGKYADALDDEMQA-LELQRVAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L++NAGH L   N+   I A+P I E+++GHA  A AL  G+  AV   +R
Sbjct: 178 MATYAHGLGLKVNAGHGLNYHNVKA-IAALPEIIELNIGHAIIARALVDGLSVAVQEMKR 236


>gi|229588604|ref|YP_002870723.1| pyridoxine 5'-phosphate synthase [Pseudomonas fluorescens SBW25]
 gi|259530390|sp|C3K6Z0|PDXJ_PSEFS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|229360470|emb|CAY47327.1| pyridoxal phosphate biosynthetic protein [Pseudomonas fluorescens
           SBW25]
          Length = 247

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 85/243 (34%), Positives = 126/243 (51%), Gaps = 13/243 (5%)

Query: 1   MSTS----VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTD 56
           MSTS    + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D
Sbjct: 1   MSTSNRILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERD 60

Query: 57  LPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQN 116
           +     L+ +   +  +N E    E  +   ER +P  I LVP+   +LT++ G D    
Sbjct: 61  V-----LLLKDVLQTRMNFEMGVTEEMMAFAERIRPAHICLVPETRQELTTEGGLDVAGQ 115

Query: 117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER 176
           +A +   V RL  +GS +SLF D   +E  ++A++  GA  IEL+TG Y A    P +  
Sbjct: 116 EARIKAAVERLSKIGSEVSLFID--ADERQIEASRRVGAPAIELHTGRY-ADATTPTEVA 172

Query: 177 IFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVK 236
             L ++           L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K
Sbjct: 173 DELQRIIDGVNCGLNEGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFK 231

Query: 237 EAV 239
            AV
Sbjct: 232 GAV 234


>gi|330973035|gb|EGH73101.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. aceris
           str. M302273PT]
          Length = 246

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEDMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAQTPTEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|71733905|ref|YP_276081.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv.
           phaseolicola 1448A]
 gi|91207557|sp|Q48EV6|PDXJ_PSE14 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|71554458|gb|AAZ33669.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas syringae
           pv. phaseolicola 1448A]
 gi|320325571|gb|EFW81633.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. glycinea
           str. B076]
 gi|320327143|gb|EFW83157.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. glycinea
           str. race 4]
          Length = 246

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIRSAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAQTPTEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|330957804|gb|EGH58064.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv.
           maculicola str. ES4326]
          Length = 246

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 84/235 (35%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLVKIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAQTPAEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   I AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAIAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|260899638|ref|ZP_05908033.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus AQ4037]
 gi|308110551|gb|EFO48091.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus AQ4037]
          Length = 243

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 132/238 (55%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     +  +N+E    E  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  ETI-----QTRMNLEMAVTEEMVEIALKTKPEFVCLVPEKREELTTEGGLDVVGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   +   ++AAK  GA  IEL+TG Y A     ++++  L K
Sbjct: 118 AATQKLTEAGIKVSLFID--ADRQQIEAAKQCGAPFIELHTGHY-ADAETEEEQQAELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G++++V
Sbjct: 175 IAAGASYADDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLEKSV 231


>gi|260775205|ref|ZP_05884103.1| pyridoxine 5'-phosphate synthase [Vibrio coralliilyticus ATCC
           BAA-450]
 gi|260608906|gb|EEX35068.1| pyridoxine 5'-phosphate synthase [Vibrio coralliilyticus ATCC
           BAA-450]
          Length = 243

 Score =  128 bits (322), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 128/238 (53%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEVAERAGADGITIHLREDRRHIVDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D   +   + 
Sbjct: 63  ETI-----QTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVAGHVEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
                L   G ++SLF D +  +  + AAK  GA  IEL+TG Y    N+  Q+   L K
Sbjct: 118 AATKILTEAGIKVSLFIDADREQ--IDAAKACGAPYIELHTGHYADAENDEDQQD-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GH+    A   G+ +AV
Sbjct: 175 IAAGASYAADLGITVNAGHGLTYHNVAP-IAAIPEIYELNIGHSIIGRAAFDGLHKAV 231


>gi|50122197|ref|YP_051364.1| pyridoxine 5'-phosphate synthase [Pectobacterium atrosepticum
           SCRI1043]
 gi|91207234|sp|Q3V7N3|PDXJ_ERWCT RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|49612723|emb|CAG76173.1| pyridoxal phosphate biosynthetic protein [Pectobacterium
           atrosepticum SCRI1043]
          Length = 243

 Score =  128 bits (322), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 127/236 (53%), Gaps = 11/236 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R  P+P+ V    +A Q+GA G+TVH R D+RHI   D+  +R  +
Sbjct: 6   LGVNIDHIATLRNARGTPYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRILRETL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  LN+    KP    LVP+   ++T++ G D    Q  +   V
Sbjct: 66  -----QTRMNLEMAVTEEMLNIACEVKPHFCCLVPEKRQEVTTEGGLDVAGQQEKIDNAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL      +SLF D   ++  + AA  +GA  IE++TG Y    ++  ++  F  ++  
Sbjct: 121 ARLSQANILVSLFID--ADKRQIDAAVASGAAYIEIHTGAYADAPDDETRQHEF-ERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNI-PNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+ P  I A+P + E+++GHA    A+  G+K+AV
Sbjct: 178 AATYAAAKGLKVNAGHGLTYHNVLP--IAALPEMHELNIGHAIIGRAVISGLKDAV 231


>gi|258626726|ref|ZP_05721548.1| Pyridoxine 5'-phosphate synthase [Vibrio mimicus VM603]
 gi|262170593|ref|ZP_06038271.1| pyridoxine 5'-phosphate synthase [Vibrio mimicus MB-451]
 gi|258580982|gb|EEW05909.1| Pyridoxine 5'-phosphate synthase [Vibrio mimicus VM603]
 gi|261891669|gb|EEY37655.1| pyridoxine 5'-phosphate synthase [Vibrio mimicus MB-451]
          Length = 243

 Score =  128 bits (321), Expect = 8e-28,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 130/238 (54%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +  + AAK  GA  IEL+TG Y    +  +Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQ--IDAAKACGAPFIELHTGHYSDAKSEVEQQN-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV
Sbjct: 175 IAAAAAYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLSKAV 231


>gi|332308046|ref|YP_004435897.1| pyridoxal phosphate biosynthetic protein PdxJ [Glaciecola
           agarilytica 4H-3-7+YE-5]
 gi|332175375|gb|AEE24629.1| pyridoxal phosphate biosynthetic protein PdxJ [Glaciecola
           agarilytica 4H-3-7+YE-5]
          Length = 245

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 85/240 (35%), Positives = 128/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ VH   IA ++GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVHAADIAERAGADGITVHLREDRRHIVDRDVALLRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           + +     LN+E    +  L++  + KPE   LVP+   +LT++ G D   NQ  + +  
Sbjct: 66  NTR-----LNLEMAVTDEMLDIALKTKPEFCCLVPEKREELTTEGGLDVAGNQQKIAQAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +SLF D +  +  + AA    A  IE++TG Y    N  +QE   L KL  
Sbjct: 121 KQLAEAGILVSLFIDADFAQ--IDAAVACNAPYIEIHTGQYAEAKNELEQE-AELAKLVA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             + A    L++NAGH L   N+   I AI  I E+++GHA  A A   G+ +AV   RR
Sbjct: 178 GIEYADAKGLKVNAGHGLHYHNVKP-IAAIEQIIELNIGHAIIARAAFDGLDKAVADMRR 236


>gi|28899343|ref|NP_798948.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus RIMD
           2210633]
 gi|260365944|ref|ZP_05778434.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus K5030]
 gi|260878966|ref|ZP_05891321.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus AN-5034]
 gi|260898317|ref|ZP_05906813.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus Peru-466]
 gi|32129842|sp|Q87LP2|PDXJ_VIBPA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|28807579|dbj|BAC60832.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio
           parahaemolyticus RIMD 2210633]
 gi|308085239|gb|EFO34934.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus Peru-466]
 gi|308090510|gb|EFO40205.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus AN-5034]
 gi|308113211|gb|EFO50751.1| pyridoxine 5'-phosphate synthase [Vibrio parahaemolyticus K5030]
          Length = 243

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 132/238 (55%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     +  +N+E    E  + +  + KPE + LVP+   +LT++ G D +     + 
Sbjct: 63  ETI-----QTRMNLEMAVTEEMVEIALKTKPEFVCLVPEKREELTTEGGLDVVGQLDKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   +   ++AAK  GA  IEL+TG Y A     ++++  L K
Sbjct: 118 AATQKLTEAGIKVSLFID--ADRQQIEAAKQCGAPFIELHTGHY-ADAETEEEQQAELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G++++V
Sbjct: 175 IAAGASYADDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLEKSV 231


>gi|225024984|ref|ZP_03714176.1| hypothetical protein EIKCOROL_01873 [Eikenella corrodens ATCC
           23834]
 gi|224942214|gb|EEG23423.1| hypothetical protein EIKCOROL_01873 [Eikenella corrodens ATCC
           23834]
          Length = 257

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 130/235 (55%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +    +A   GA  +T+H R D+RHI+  D+  I++ I
Sbjct: 17  LGVNIDHVATLRNARGTRYPSPLEAALVAETHGADLITLHLREDRRHIKDADVFAIKQAI 76

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E       L+   + +PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 77  -----RTRMNLEMALTTEMLDNALQVQPEDVCIVPEKRQEVTTEGGLDVLAQQQTVAEFT 131

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL+  G R+SLF D   +E  ++AA+  GA  IEL+TG Y    ++  ++   L +L  
Sbjct: 132 QRLNTAGIRVSLFID--ADEQQIKAARDVGAQAIELHTGAYADATSHTVRQNELL-RLEE 188

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A ++ L +NAGH LTI N+  +   +P I E+++GHA  A A+  G+ EA+
Sbjct: 189 AAYFASELGLVVNAGHGLTIHNVAPVARILP-IRELNIGHALIAQAVFLGLPEAI 242


>gi|330964517|gb|EGH64777.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv.
           actinidiae str. M302091]
          Length = 246

 Score =  128 bits (321), Expect = 9e-28,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAQTPTEVAEELQRVAN 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|28871356|ref|NP_793975.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|38257961|sp|Q87XG4|PDXJ_PSESM RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|28854607|gb|AAO57670.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas syringae
           pv. tomato str. DC3000]
 gi|331015604|gb|EGH95660.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv.
           lachrymans str. M302278PT]
          Length = 246

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/235 (34%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  +EL+TG Y A    P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAVELHTGRY-ADAQTPTEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|262273707|ref|ZP_06051520.1| pyridoxine 5'-phosphate synthase [Grimontia hollisae CIP 101886]
 gi|262222122|gb|EEY73434.1| pyridoxine 5'-phosphate synthase [Grimontia hollisae CIP 101886]
          Length = 243

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ VH  +IA ++GA G+T+H R D+RHI+  D+  ++  I
Sbjct: 6   LGVNIDHVATVRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHIKDRDVYLLKETI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +N+    KP  + LVP+   +LT++ G D       +    
Sbjct: 66  -----QTRMNLEMAVTDEMVNIALEVKPAYVCLVPEKREELTTEGGLDVAGQLEKVKAAT 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G ++SLF D   +   + AAK  GA  IEL+TG Y     + + +   L K+A 
Sbjct: 121 ETLTAAGIKVSLFID--ADRAQIDAAKACGAPFIELHTGRYAEASTDEEMQ-AELKKIAA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + +++NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV
Sbjct: 178 GASYAADLGIKVNAGHGLTYHNVKP-IAAIPEIYELNIGHAIIGRAVFDGLHKAV 231


>gi|317970356|ref|ZP_07971746.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. CB0205]
          Length = 249

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 129/236 (54%), Gaps = 10/236 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R++
Sbjct: 3   SLGVNIDHIANVRQARRTVEPDPVSYALLAELGGADGITVHLREDRRHIQDRDVELLRQV 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     ++ LN+E         +  R KP+ +TLVP+   ++T++ G D       +   
Sbjct: 63  V-----RSRLNLEMAATAEMEAIALRIKPDMVTLVPEKREEVTTEGGLDVASQLTTIKGI 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
             RL + G  +SLF D   ++  L+A + +GA  +EL+TG Y     N QQ+   L ++ 
Sbjct: 118 SGRLQDAGIGVSLFVDAEASQ--LEACQASGARWVELHTGTYAEA--NWQQQAKELARIT 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               +A+ + L++NAGH LT QN+   I AI  + E+++GH   A AL  G++EAV
Sbjct: 174 EGTFIARSLGLRVNAGHGLTYQNVEP-IAAIEGMEELNIGHTIVARALAVGLEEAV 228


>gi|254226242|ref|ZP_04919835.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae V51]
 gi|125621215|gb|EAZ49556.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae V51]
          Length = 243

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 129/238 (54%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTSYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   +   + AAK  GA  IEL+TG Y    ++  Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFID--ADREQIDAAKACGAPFIELHTGHYSDAKSDVDQQN-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV
Sbjct: 175 IAAAAAYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAV 231


>gi|237798716|ref|ZP_04587177.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|237806149|ref|ZP_04592853.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331021569|gb|EGI01626.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. oryzae
           str. 1_6]
 gi|331027262|gb|EGI07317.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. oryzae
           str. 1_6]
          Length = 246

 Score =  128 bits (321), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQVRGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLARIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAQTPTEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|213971116|ref|ZP_03399235.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas syringae
           pv. tomato T1]
 gi|301381867|ref|ZP_07230285.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. tomato
           Max13]
 gi|302063243|ref|ZP_07254784.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. tomato
           K40]
 gi|302132835|ref|ZP_07258825.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. tomato
           NCPPB 1108]
 gi|213924105|gb|EEB57681.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas syringae
           pv. tomato T1]
          Length = 246

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/235 (34%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMLAFAERIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  +EL+TG Y A    P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAVELHTGRY-ADAQTPTEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|240116278|ref|ZP_04730340.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID18]
 gi|260439908|ref|ZP_05793724.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae DGI2]
 gi|268601943|ref|ZP_06136110.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID18]
 gi|291043182|ref|ZP_06568905.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae DGI2]
 gi|268586074|gb|EEZ50750.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID18]
 gi|291012788|gb|EFE04771.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae DGI2]
          Length = 242

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 129/242 (53%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +  +QAA+  GA  IEL+TG Y   +++ +Q R F  +L  
Sbjct: 118 KILTDAGIRVSLFIDADNEQ--IQAARDVGAPVIELHTGAYADAHSHAEQIRQF-ERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|116072442|ref|ZP_01469709.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. BL107]
 gi|116064964|gb|EAU70723.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. BL107]
          Length = 249

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/237 (33%), Positives = 133/237 (56%), Gaps = 12/237 (5%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R+ 
Sbjct: 3   SLGVNIDHIANIREARRTVEPDPVPMAMLAELGGADGITVHLREDRRHIQDRDVELLRQT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     ++ LN+E    +  + +  + KP+ +TLVP+   ++T++ G D +   + LT  
Sbjct: 63  V-----RSRLNLEMAATDEMVAIALKVKPDMVTLVPEHRQEVTTEGGLDVVAQLSELTGM 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLNKL 182
           V+RL + G  +SLF D    +  LQ    +GA  +EL+TG Y  A +N    E   L +L
Sbjct: 118 VSRLQSNGIPVSLFVDPAATQ--LQGCIDSGARWVELHTGRYAEASWNEQPHE---LARL 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                 A+ M L++NAGH LT QN+   + AIP + E+++GH   A A+  G+++AV
Sbjct: 173 TEGTATARAMGLRVNAGHGLTYQNV-EPVAAIPGMEELNIGHTIVARAVVVGLQQAV 228


>gi|289548888|ref|YP_003473876.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermocrinis albus
           DSM 14484]
 gi|289182505|gb|ADC89749.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermocrinis albus
           DSM 14484]
          Length = 241

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 80/244 (32%), Positives = 134/244 (54%), Gaps = 16/244 (6%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R    P+ V    IA Q+GA  +T+H R D+RHI+  DL  I++L+
Sbjct: 3   LGVNIDHVATLRQARRTFEPSPVLAALIAQQAGAHQITLHLREDRRHIQDEDLELIKKLV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
               P   +N+E  P E    +  R +P++ TLVP+   ++T++ G D ++ ++ L   +
Sbjct: 63  I--LP---VNLEMAPTEEMKMIALRVRPDRCTLVPERRQEITTEGGLDVVKLESFLRDYL 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN-----NPQQERIFL 179
             L   G  ISLF +    E  ++A+   GAD +EL+TG Y   +N       Q+E   L
Sbjct: 118 KELKEAGIEISLFVE--PQEEQIRASHRVGADAVELHTGRYAELWNQHRFAEAQEE---L 172

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIP-YISEISVGHAFAATALECGVKEA 238
            +L     LA+ + L++ AGH LT QN+  L+  +   + E++VGH+  + A+  G+++A
Sbjct: 173 KRLREAGMLAKSLGLRVYAGHGLTYQNVTQLVAYLKDVVEELNVGHSIVSNAVLFGLEKA 232

Query: 239 VFCF 242
           +  F
Sbjct: 233 IKEF 236


>gi|163781630|ref|ZP_02176630.1| pyridoxal phosphate biosynthetic protein [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159882850|gb|EDP76354.1| pyridoxal phosphate biosynthetic protein [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 245

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/253 (31%), Positives = 136/253 (53%), Gaps = 17/253 (6%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +R  R    P+ V    I  Q+GA  +T+H R D+RHI+  DL  I+ L+
Sbjct: 3   LGVNIDHVATVRQARRTFEPSPVFAALIVQQAGADQITLHLREDRRHIQDRDLELIKELV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
               P   +N+E  P E   ++  R KP+++TLVP+   ++T++ G D    +  L + +
Sbjct: 63  --ILP---VNLEMAPVEEMRSIALRVKPDRVTLVPEKREEITTEGGLDVAGMKGYLREYI 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER--IFLNKL 182
               ++G  +SLF D    E  ++A+   GAD IEL+TG Y   +N  + E   + + +L
Sbjct: 118 EPFKSVGIEVSLFIDPE--ESQVRASAEVGADAIELHTGTYANLWNEHRFEEAEVEIERL 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
               +LA+++ +++ AGH LT QN+  ++     I E+++GH+  A ++       +F  
Sbjct: 176 KRAGELAKELGMKVYAGHGLTYQNVKGVLELSGIIEELNIGHSIIANSV-------IFGL 228

Query: 243 RRACGQHLDNTMR 255
            RA  + L N MR
Sbjct: 229 ERAVKEML-NLMR 240


>gi|229521285|ref|ZP_04410705.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae TM 11079-80]
 gi|229341817|gb|EEO06819.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae TM 11079-80]
          Length = 242

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 129/238 (54%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   +   + AAK  GA  IEL+TG Y    ++  Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFID--ADREQIDAAKACGAPFIELHTGHYSDAKSDVDQQN-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV
Sbjct: 175 IAAAAAYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAV 231


>gi|121728972|ref|ZP_01681976.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae V52]
 gi|147675577|ref|YP_001217960.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae O395]
 gi|262167289|ref|ZP_06034999.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae RC27]
 gi|121628738|gb|EAX61205.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae V52]
 gi|146317460|gb|ABQ21999.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           O395]
 gi|227014350|gb|ACP10560.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           O395]
 gi|262024264|gb|EEY42955.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae RC27]
          Length = 243

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 130/238 (54%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +  + AAK  GA  IEL+TG Y    ++  Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQ--IDAAKACGAPFIELHTGHYSDAKSDVDQQN-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV
Sbjct: 175 IAAAAAYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAV 231


>gi|330950053|gb|EGH50313.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae Cit 7]
          Length = 246

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   ER +P  I LVP+   +L ++ G D    +A +   V
Sbjct: 64  LKDVLQTRMNFEMGVTEEMLAFAERLRPAHICLVPETRQELPTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D   +E  + A+K  GA  IEL+TG Y A    P +    L ++A 
Sbjct: 124 ERLAKIGCEVSLFID--ADERQIAASKRVGAPAIELHTGRY-ADAQTPTEVAEELQRVAD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  ISE+++GHA  A AL  G K AV
Sbjct: 181 GVAFGLAQGLIVNAGHGLHYHNV-EAVAAIKGISELNIGHALVAHALFVGFKAAV 234


>gi|15642454|ref|NP_232087.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae O1 biovar El Tor
           str. N16961]
 gi|121590989|ref|ZP_01678308.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           2740-80]
 gi|153803089|ref|ZP_01957675.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           MZO-3]
 gi|153826910|ref|ZP_01979577.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           MZO-2]
 gi|153830869|ref|ZP_01983536.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           623-39]
 gi|227082579|ref|YP_002811130.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           M66-2]
 gi|229507482|ref|ZP_04396987.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae BX 330286]
 gi|229512323|ref|ZP_04401802.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae B33]
 gi|229514084|ref|ZP_04403546.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae TMA 21]
 gi|229519459|ref|ZP_04408902.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae RC9]
 gi|229524445|ref|ZP_04413850.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae bv. albensis
           VL426]
 gi|229527065|ref|ZP_04416460.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae 12129(1)]
 gi|229606987|ref|YP_002877635.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae MJ-1236]
 gi|254291658|ref|ZP_04962446.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           AM-19226]
 gi|254849583|ref|ZP_05238933.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           MO10]
 gi|255746871|ref|ZP_05420816.1| pyridoxine 5'-phosphate synthase [Vibrio cholera CIRS 101]
 gi|262162036|ref|ZP_06031052.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae INDRE 91/1]
 gi|297581082|ref|ZP_06943007.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           RC385]
 gi|298500185|ref|ZP_07009990.1| pyridoxal phosphate biosynthesis protein PdxJ [Vibrio cholerae MAK
           757]
 gi|12644545|sp|Q9KPB5|PDXJ_VIBCH RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|9657036|gb|AAF95600.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae O1
           biovar El Tor str. N16961]
 gi|121547166|gb|EAX57295.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           2740-80]
 gi|124121371|gb|EAY40114.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           MZO-3]
 gi|148873638|gb|EDL71773.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           623-39]
 gi|149739273|gb|EDM53535.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           MZO-2]
 gi|150422430|gb|EDN14389.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           AM-19226]
 gi|227010467|gb|ACP06679.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           M66-2]
 gi|229335462|gb|EEO00944.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae 12129(1)]
 gi|229338026|gb|EEO03043.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae bv. albensis
           VL426]
 gi|229344148|gb|EEO09123.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae RC9]
 gi|229349265|gb|EEO14222.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae TMA 21]
 gi|229352288|gb|EEO17229.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae B33]
 gi|229354987|gb|EEO19908.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae BX 330286]
 gi|229369642|gb|ACQ60065.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae MJ-1236]
 gi|254845288|gb|EET23702.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           MO10]
 gi|255735273|gb|EET90673.1| pyridoxine 5'-phosphate synthase [Vibrio cholera CIRS 101]
 gi|262028285|gb|EEY46942.1| pyridoxine 5'-phosphate synthase [Vibrio cholerae INDRE 91/1]
 gi|297534908|gb|EFH73744.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           RC385]
 gi|297540878|gb|EFH76932.1| pyridoxal phosphate biosynthesis protein PdxJ [Vibrio cholerae MAK
           757]
 gi|327484950|gb|AEA79357.1| Pyridoxine 5'-phosphate synthase [Vibrio cholerae LMA3894-4]
          Length = 243

 Score =  127 bits (320), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 129/238 (54%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   +   + AAK  GA  IEL+TG Y    ++  Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFID--ADREQIDAAKACGAPFIELHTGHYSDAKSDVDQQN-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV
Sbjct: 175 IAAAAAYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAV 231


>gi|148981904|ref|ZP_01816562.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrionales
           bacterium SWAT-3]
 gi|145960705|gb|EDK26047.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrionales
           bacterium SWAT-3]
          Length = 245

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 127/238 (53%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+    
Sbjct: 3   SILLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHIVDRDV---- 58

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           R++ E   +  +N+E    +  + +    KPE + LVP+   +LT++ G D +     + 
Sbjct: 59  RILAETI-QTRMNLEMAVTDEMVQIALDTKPEFVCLVPEKREELTTEGGLDVVGQLDKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   +   + AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATQKLSEAGIKVSLFID--ADREQIDAAKACGAPFIELHTGHYADAKTEEDQQD-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV
Sbjct: 175 IAAGASYADDLGITVNAGHGLTYHNVAP-IAALPEIYELNIGHSIMGRAVFDGLNKAV 231


>gi|86606908|ref|YP_475671.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. JA-3-3Ab]
 gi|123505418|sp|Q2JSG7|PDXJ_SYNJA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|86555450|gb|ABD00408.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           JA-3-3Ab]
          Length = 245

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 82/244 (33%), Positives = 134/244 (54%), Gaps = 9/244 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ VA LR  R    P+ V    IA  +GA G+TVH R D+RHI+  D+  +R  
Sbjct: 3   SLGVNIDHVATLRQARRTVEPDPVAAAVIAELAGADGITVHLREDRRHIQERDVRLLR-- 60

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              Q  +  LN+E    +  + +    KP+ +TLVP+   ++T++ G D     + L++ 
Sbjct: 61  ---QTVRTHLNLEMAATDEMVAIALEIKPDYVTLVPERREEVTTEGGLDVAGQVSRLSEV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V++L   G  +SLF D +  +  + AA   GA  +EL+TG Y    +  QQE   L +L 
Sbjct: 118 VSQLQGSGIPVSLFVDPDPIQ--IAAAAQVGARWVELHTGRYAEASSEAQQE-AELAQLR 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             +Q A ++ L++NAGH LT  N+   +  IP + E+++GH+  + A+  G++ AV   R
Sbjct: 175 QASQQAIQLGLRVNAGHGLTYWNV-GPVARIPGMEELNIGHSIISRAVLVGLERAVREMR 233

Query: 244 RACG 247
           +A G
Sbjct: 234 QAMG 237


>gi|304386732|ref|ZP_07369002.1| pyridoxine 5'-phosphate synthase [Neisseria meningitidis ATCC
           13091]
 gi|304339190|gb|EFM05274.1| pyridoxine 5'-phosphate synthase [Neisseria meningitidis ATCC
           13091]
          Length = 255

 Score =  127 bits (319), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 129/242 (53%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 16  LGVNIDHIATVRNARGTIYPSPVEAALIAETHGADLITMHLREDRRHIKDADVFAVKNAI 75

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  +T+  
Sbjct: 76  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQDKITEFT 130

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +  +QAA   GA  IEL+TG Y   +++ +Q + F  ++  
Sbjct: 131 KILTDAGIRVSLFIDADNEQ--IQAAHDVGAPVIELHTGAYADAHSHAEQLKQF-ERIQN 187

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 188 GAHYASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 246

Query: 245 AC 246
           A 
Sbjct: 247 AM 248


>gi|268315827|ref|YP_003289546.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodothermus marinus
           DSM 4252]
 gi|262333361|gb|ACY47158.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodothermus marinus
           DSM 4252]
          Length = 245

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/245 (33%), Positives = 137/245 (55%), Gaps = 13/245 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T + VN++ VA LRN R   +P+ V    +   +GA G+  H R D+RHI   D+  ++ 
Sbjct: 6   TRLLVNIDHVATLRNARRETFPDPVQAAVLCELAGADGIVFHLREDRRHITDRDVFRLKE 65

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     + +L+ E   NE  +++C + +P   TLVP+   ++T++ G D L N+A L +
Sbjct: 66  VV-----QGKLDFELSTNEEIVSICCQVRPHLATLVPERREEITTEGGLDVLANRARLQQ 120

Query: 123 TVARLHNLG-SRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQ--ERIFL 179
            + RL + G   ++LF D +  +  ++AA+  GA+ IEL+TG +    N P +   R   
Sbjct: 121 VIPRLFDAGIEEVALFVDPDPRQ--IEAAREVGANAIELHTGDFA---NAPTEAARRAEA 175

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            KLA  A++A ++ LQ++AGH L   N P     +P++ E+S+G A  A A+  G++ AV
Sbjct: 176 EKLAAAARVAHELGLQVHAGHGLDYHNYPLFRETVPHVHEVSIGFAIIARAVLVGLETAV 235

Query: 240 FCFRR 244
              RR
Sbjct: 236 REMRR 240


>gi|312959176|ref|ZP_07773695.1| Pyridoxine 5'-phosphate synthase [Pseudomonas fluorescens WH6]
 gi|311286946|gb|EFQ65508.1| Pyridoxine 5'-phosphate synthase [Pseudomonas fluorescens WH6]
          Length = 247

 Score =  127 bits (319), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 84/243 (34%), Positives = 126/243 (51%), Gaps = 13/243 (5%)

Query: 1   MSTS----VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTD 56
           M+TS    + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D
Sbjct: 1   MTTSNRILLGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERD 60

Query: 57  LPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQN 116
           +     L+ +   +  +N E    E  +   ER +P  I LVP+   +LT++ G D    
Sbjct: 61  V-----LLLKDVLQTRMNFEMGVTEEMMAFAERIRPAHICLVPETRQELTTEGGLDVAGQ 115

Query: 117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER 176
           +A +   V RL  +GS +SLF D   +E  ++A++  GA  IEL+TG Y A    P +  
Sbjct: 116 EARIKAAVERLSRIGSEVSLFID--ADERQIEASRRVGAPAIELHTGRY-ADATTPTEVA 172

Query: 177 IFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVK 236
             L ++           L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K
Sbjct: 173 DELQRIIDGVNCGLGEGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFK 231

Query: 237 EAV 239
            AV
Sbjct: 232 GAV 234


>gi|59712691|ref|YP_205467.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio fischeri
           ES114]
 gi|75431523|sp|Q5E317|PDXJ_VIBF1 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|59480792|gb|AAW86579.1| pyridoxine 5'-phosphate synthase [Vibrio fischeri ES114]
          Length = 243

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 130/244 (53%), Gaps = 11/244 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA+G+T+H R D+RHI+  D+  +R
Sbjct: 3   SILLGVNIDHVATLRNARGTKYPDPVHAAEIAERAGAAGITIHLREDRRHIKDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +    KPE + LVP+   +LT++ G +       + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMVGIALETKPEFVCLVPEKREELTTEGGLNVSGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLN 180
               +L   G ++SLF D   ++  + AA   GA  IEL+TG Y  A     QQ+   L 
Sbjct: 118 AATQKLTEAGIKVSLFID--ADKEQIDAAVECGAPFIELHTGAYADAETEEAQQDE--LK 173

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           K+A  A  A    L +NAGH LT  N+   I A+P I E+++GH+    A+  G+++AV 
Sbjct: 174 KIAAGASYAASKGLIVNAGHGLTYHNV-EAIAALPEIYELNIGHSIMGRAMFDGLEKAVA 232

Query: 241 CFRR 244
              R
Sbjct: 233 DMHR 236


>gi|33863362|ref|NP_894922.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str. MIT
           9313]
 gi|81577360|sp|Q7V6Q5|PDXJ_PROMM RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|33640811|emb|CAE21266.1| Pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9313]
          Length = 245

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 131/242 (54%), Gaps = 12/242 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  DL  +R  
Sbjct: 3   SLGVNIDHIANVRQARQTVEPDPVPMALLAELGGADGITVHLREDRRHIQDRDLDLLRAT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     ++ LN+E       + +  + +P+ +TLVP+   ++T++ G D    Q  L   
Sbjct: 63  V-----RSRLNLEMAATAEMVGIALKIQPDMVTLVPERRQEVTTEGGLDVAAQQGSLKGM 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLNKL 182
           V +L   G  +SLF D    +  L+AA  +GA  +EL+TG Y  AC+ +   E   L +L
Sbjct: 118 VDQLQVAGIPVSLFVDPVSQQ--LEAAFKSGARWVELHTGAYAEACWADQSFE---LARL 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
                 A+ + L++NAGH LT QN+   + AI  I E+++GH   A ++  G+KEAV   
Sbjct: 173 TEATARARSLGLRVNAGHGLTYQNV-EAVAAIEGIEELNIGHTIVARSIAVGLKEAVREM 231

Query: 243 RR 244
           +R
Sbjct: 232 KR 233


>gi|163783865|ref|ZP_02178843.1| pyridoxal phosphate biosynthetic protein [Hydrogenivirga sp.
           128-5-R1-1]
 gi|159880862|gb|EDP74388.1| pyridoxal phosphate biosynthetic protein [Hydrogenivirga sp.
           128-5-R1-1]
          Length = 241

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/243 (32%), Positives = 131/243 (53%), Gaps = 13/243 (5%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ +A +R  R    P+ V    IA +SGA  +T+H R D+RHI+  DL  I+  
Sbjct: 2   KLGVNIDHIATIREARKTFEPDPVKGALIAQESGADQITLHLREDRRHIQDEDLFRIKVN 61

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I     K  +N+E  P E    +    KP +ITLVP+   ++T++ G D   N   +   
Sbjct: 62  I----TKIPINLEMAPTEEMKRIAIDVKPNRITLVPEKREEITTEGGLDVAGNLEYIKNF 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF--LNK 181
           V  +   G  ++LF D + N+  + A+  TGAD +EL+TG Y   + N    RI   L +
Sbjct: 118 VKEVKETGINVALFIDPDTNQ--IDASLETGADAVELHTGEYANAFGN----RIIKELER 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A+ A++  L++ AGH LT +N+ + +  IP I E+++GH+  A ++  G+ +AV  
Sbjct: 172 LQFAAKYAKEKGLKVFAGHGLTYENVKS-VAEIPEIEELNIGHSIIANSVFLGLDKAVEK 230

Query: 242 FRR 244
            +R
Sbjct: 231 MKR 233


>gi|325142931|gb|EGC65290.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis 961-5945]
          Length = 242

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 128/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA+  GA  +EL+TG Y    ++ +Q R F  ++  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAARDVGAPVVELHTGAYADARSHAEQIRQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|27364937|ref|NP_760465.1| pyridoxine 5'-phosphate synthase [Vibrio vulnificus CMCP6]
 gi|37681012|ref|NP_935621.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio vulnificus
           YJ016]
 gi|320155323|ref|YP_004187702.1| pyridoxine 5'-phosphate synthase [Vibrio vulnificus MO6-24/O]
 gi|30316012|sp|Q8DC73|PDXJ_VIBVU RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|61214243|sp|Q7MHP1|PDXJ_VIBVY RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|27361083|gb|AAO09992.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio vulnificus
           CMCP6]
 gi|37199762|dbj|BAC95592.1| pyridoxal phosphate biosynthesis protein [Vibrio vulnificus YJ016]
 gi|319930635|gb|ADV85499.1| pyridoxine 5'-phosphate synthase [Vibrio vulnificus MO6-24/O]
          Length = 243

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 127/238 (53%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTKYPDPVHAAEVAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D   +   + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMIEIALKTQPEYVCLVPEKREELTTEGGLDVAGHLDKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D +  +  + AAK  GA  IEL+TG Y        Q    L K
Sbjct: 118 AATEKLTAAGIKVSLFIDADREQ--IDAAKACGAPFIELHTGHYADAATEADQLD-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GHA    A+  G+ +AV
Sbjct: 175 IAAGASYAADLGITVNAGHGLTYHNVAP-IAALPEIYELNIGHAIIGRAVFDGLHKAV 231


>gi|153214521|ref|ZP_01949430.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           1587]
 gi|124115323|gb|EAY34143.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio cholerae
           1587]
          Length = 243

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   +   + AAK  GA  IEL+TG Y    ++  Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFID--ADREQIDAAKACGAPFIELHTGHYSDAKSDVDQQN-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A    + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV
Sbjct: 175 IAAAAAYAHDFGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAV 231


>gi|298369908|ref|ZP_06981224.1| pyridoxine 5'-phosphate synthase [Neisseria sp. oral taxon 014 str.
           F0314]
 gi|298281368|gb|EFI22857.1| pyridoxine 5'-phosphate synthase [Neisseria sp. oral taxon 014 str.
           F0314]
          Length = 242

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V    +A   GA  +T+H R D+RH++  D+  ++  I
Sbjct: 3   LGVNIDHVATLRNARGTTYPSPVEAALVAETHGADLITLHLREDRRHMKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L       PE + +VP+   ++T++ G D L  Q  + + V
Sbjct: 63  -----RTRLNLEMALTEEMLENALNVMPEDVCIVPEKRQEITTEGGLDVLAQQDKVAQYV 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +G +  +QAA   GA  IEL+TG Y    N+ ++ R  L ++  
Sbjct: 118 KTLTDAGIRVSLFIDADGGQ--IQAAHEVGAPVIELHTGAYADAPNHAERAR-QLARIEN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A A+  G+ EAV
Sbjct: 175 GAHFAADLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQAVFLGLPEAV 228


>gi|197335650|ref|YP_002156883.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio fischeri
           MJ11]
 gi|197317140|gb|ACH66587.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio fischeri
           MJ11]
          Length = 243

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 130/244 (53%), Gaps = 11/244 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA+G+T+H R D+RHI+  D+  +R
Sbjct: 3   SILLGVNIDHVATLRNARGTKYPDPVHAAEIAERAGAAGITIHLREDRRHIKDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +    KPE + LVP+   +LT++ G +       + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMVGIALETKPEFVCLVPEKREELTTEGGLNVSGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLN 180
               +L   G ++SLF D +  +  + AA   GA  IEL+TG Y  A     QQ+   L 
Sbjct: 118 AATQKLTEAGIKVSLFIDADKKQ--IDAAVECGAPFIELHTGAYADAETEEAQQDE--LK 173

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           K+A  A  A    L +NAGH LT  N+   I A+P I E+++GH+    A+  G+++AV 
Sbjct: 174 KIAAGASYAASKGLIVNAGHGLTYHNV-EAIAALPEIYELNIGHSIMGRAMFDGLEKAVS 232

Query: 241 CFRR 244
              R
Sbjct: 233 DMHR 236


>gi|262404771|ref|ZP_06081326.1| pyridoxine 5'-phosphate synthase [Vibrio sp. RC586]
 gi|262349803|gb|EEY98941.1| pyridoxine 5'-phosphate synthase [Vibrio sp. RC586]
          Length = 243

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 81/238 (34%), Positives = 128/238 (53%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHVATLRNARGTQYPDPVHAAEIAERAGADGITIHLREDRRHITDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D L     + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMVEIALQTQPEYVCLVPEKREELTTEGGLDVLGQLERVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   +   + AAK  GA  IEL+TG Y    +   Q+   L K
Sbjct: 118 AATEKLTAAGIKVSLFID--ADREQIDAAKACGAPFIELHTGHYSDAKSEVDQQN-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV
Sbjct: 175 IAAAAAYAHDLGITVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLAKAV 231


>gi|269101849|ref|ZP_06154546.1| pyridoxine 5'-phosphate synthase [Photobacterium damselae subsp.
           damselae CIP 102761]
 gi|268161747|gb|EEZ40243.1| pyridoxine 5'-phosphate synthase [Photobacterium damselae subsp.
           damselae CIP 102761]
          Length = 243

 Score =  127 bits (318), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 83/240 (34%), Positives = 128/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ VH  +IA ++GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHVATLRNARGTRYPDPVHAAEIAERAGADGITVHLREDRRHITDRDVRILRETI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    KPE + LVP+   +LT++ G D       +    
Sbjct: 66  -----QTRMNLEMAVTDEMVAIALEIKPEYVCLVPEKREELTTEGGLDVAGQLEKVKSAT 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G ++SLF D   +   + AAK  GA  IEL+TG Y    N  +Q    L K+A 
Sbjct: 121 EKLTAAGIKVSLFID--ADRLQIDAAKACGAPFIELHTGHYADATNECEQ-LAELKKIAA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + +++NAGH LT  N+ + I AIP + E+++GH+    AL  G+  AV   R+
Sbjct: 178 AASYAADLGIKVNAGHGLTYHNV-SAIAAIPELYELNIGHSIMGRALFDGLSTAVADMRQ 236


>gi|332295630|ref|YP_004437553.1| Pyridoxine 5'-phosphate synthase [Thermodesulfobium narugense DSM
           14796]
 gi|332178733|gb|AEE14422.1| Pyridoxine 5'-phosphate synthase [Thermodesulfobium narugense DSM
           14796]
          Length = 250

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 133/236 (56%), Gaps = 12/236 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R + +P+ +    I+L +GA  +TVH R D+RHI+  D+ +IR+ +
Sbjct: 7   LGVNVDHVATLRESRRITYPDPLSAASISLAAGADLITVHLREDRRHIQDNDVLKIRKAV 66

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D       LN+E       ++   + KP ++TLVP+   +LT++ G D  +N   L + +
Sbjct: 67  D------NLNLEMACVPQIVSFALKVKPNKVTLVPEKREELTTEGGLDLSKNYDSLKENI 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF-LNKLA 183
           + L + G  +SLF D   +E S++ +   GAD +EL+TG Y    +  + ER F L +L 
Sbjct: 121 STLKSNGIEVSLFID--PDEFSIEKSATLGADSVELHTGRYADSMD--EIERDFELERLK 176

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             + LA++  L + AGH L   N+   I  IP I E+++GH+  + A+  G+ +AV
Sbjct: 177 KASVLAKEAGLNVYAGHGLNKDNVWQ-IALIPEIEELNIGHSIISRAVFVGIFKAV 231


>gi|290476131|ref|YP_003469031.1| carries out condensation and ring closure step after PdxA in
           pyridoxine biosynthesis [Xenorhabdus bovienii SS-2004]
 gi|289175464|emb|CBJ82267.1| carries out condensation and ring closure step after PdxA in
           pyridoxine biosynthesis [Xenorhabdus bovienii SS-2004]
          Length = 243

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 127/236 (53%), Gaps = 11/236 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ +A +RN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  + + I
Sbjct: 6   LGINIDHIATVRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVQLLAKTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++  + KP    LVP+   ++T++ G D L  +  +   V
Sbjct: 66  -----QTRMNLEMAVTDEMIDIACQIKPVFCCLVPEKRQEVTTEGGLDVLGQKVHIAAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN-KLA 183
            RL   G  +SLF D   +   + AA   GA  IE++TG Y    N+ QQE+ FL  K A
Sbjct: 121 KRLSEAGIFVSLFID--ADHQQIAAAAEVGAPFIEIHTGAYADAENDIQQEQEFLRIKEA 178

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +T   A    +++NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV
Sbjct: 179 VT--YAAGKGIKVNAGHGLTYHNVQR-IAALPEIYELNIGHAIIGRAVFSGLSAAV 231


>gi|238021371|ref|ZP_04601797.1| hypothetical protein GCWU000324_01270 [Kingella oralis ATCC 51147]
 gi|237868351|gb|EEP69357.1| hypothetical protein GCWU000324_01270 [Kingella oralis ATCC 51147]
          Length = 243

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 127/241 (52%), Gaps = 9/241 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ VA LRN R   +P+ +    +A  +GA  +T+H R D+RHI+  D+  IR+ I
Sbjct: 3   LGINIDHVATLRNARGASYPSPLEAALVAETNGADAITLHLREDRRHIKDADVFAIRQAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E    E  L    +  PE + +VP+   ++T++ G D +     +   V
Sbjct: 63  -----KTRMNLEMAMTEEMLANALQVMPEDVCIVPEKRTEVTTEGGLDVVGQPEKVRDYV 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           A+LH +G R+SLF D       +QAA   GA  IEL+TG Y A    P      L K+  
Sbjct: 118 AKLHAVGIRVSLFID--AERAQIQAAYDCGARVIELHTGAY-ADAPTPAARAAELAKIRE 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + + +NAGH LT+QN+   I  I  I E+++GH+  A A+  G+ +A+   + 
Sbjct: 175 AAAFADGLGITVNAGHGLTVQNV-GAIAQIEQIVELNIGHSIIAQAIFLGLPDAIRQMKE 233

Query: 245 A 245
           A
Sbjct: 234 A 234


>gi|260551502|ref|ZP_05825686.1| pyridoxal phosphate biosynthesis protein [Acinetobacter sp.
           RUH2624]
 gi|260405496|gb|EEW98989.1| pyridoxal phosphate biosynthesis protein [Acinetobacter sp.
           RUH2624]
          Length = 241

 Score =  126 bits (317), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 80/246 (32%), Positives = 129/246 (52%), Gaps = 11/246 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTTYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     K  +N+E    +  +   +  KP+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RPLL-----KTRMNLELAVTDEMVEFAKEIKPQHVCFVPEKRQEVTTEGGLDVVTNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFL 179
                 L  LG  +SLF D +  +  + AA   GA  IEL+TG Y  A     QQE   L
Sbjct: 116 KAATQALAALGCDVSLFIDADFAQ--IDAAVACGAPTIELHTGAYADAATEQEQQEE--L 171

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++    + A    L +NAGH L ++NI   I AIP I E+++GH+  A ++  G+ +AV
Sbjct: 172 ARIVKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHELNIGHSIIADSVFVGLAQAV 230

Query: 240 FCFRRA 245
              ++A
Sbjct: 231 KDMKKA 236


>gi|198283252|ref|YP_002219573.1| pyridoxine 5'-phosphate synthase [Acidithiobacillus ferrooxidans
           ATCC 53993]
 gi|218667027|ref|YP_002425835.1| pyridoxal phosphate biosynthetic protein PdxJ [Acidithiobacillus
           ferrooxidans ATCC 23270]
 gi|226694865|sp|B7J9K4|PDXJ_ACIF2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|226700968|sp|B5EQL6|PDXJ_ACIF5 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|198247773|gb|ACH83366.1| pyridoxal phosphate biosynthetic protein PdxJ [Acidithiobacillus
           ferrooxidans ATCC 53993]
 gi|218519240|gb|ACK79826.1| pyridoxal phosphate biosynthetic protein PdxJ [Acidithiobacillus
           ferrooxidans ATCC 23270]
          Length = 241

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 81/241 (33%), Positives = 122/241 (50%), Gaps = 9/241 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ VA LR  R   +P+ V    +A ++GA  +T H R D+RHI   D+      
Sbjct: 3   ALGVNIDHVATLRQARGTRYPDPVEAAFVAERAGADAITAHLREDRRHIVERDVE----- 57

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I  Q  +  LN+E    E  L + ER  P    LVP+   +LT++ G D     + + + 
Sbjct: 58  ILSQTLRTRLNLEMAVEEGVLRVAERLSPSDCCLVPERRAELTTEGGLDVAGQLSRIKEA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
             RL     R+SLF D   +   L+AA  TGA  +EL+TG Y    +   +    L ++ 
Sbjct: 118 CQRLAAAKVRVSLFVD--PDPFQLEAAMETGAPVVELHTGRYANTADTATRAE-ELGQIT 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A  A  + LQ+NAGH L   N+   + AIPYI E+++GHA  A A+  G+  AV   +
Sbjct: 175 SAASFADSLGLQVNAGHGLDYHNV-QAVAAIPYIRELNIGHAIVAHAVFVGMATAVADMK 233

Query: 244 R 244
           R
Sbjct: 234 R 234


>gi|149192070|ref|ZP_01870295.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio shilonii AK1]
 gi|148834095|gb|EDL51107.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio shilonii AK1]
          Length = 244

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 127/238 (53%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + +N++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SILLGINIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     +  +N+E    +  +++  + +PE + LVP+   +LT++ G D       + 
Sbjct: 63  ETL-----QTRMNLEMAVTDEMIDIALKTQPEFVCLVPEKREELTTEGGLDVKGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   +   + AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATEKLSAAGIKVSLFID--ADREQIDAAKAAGAPFIELHTGHYADAETEEDQQD-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV
Sbjct: 175 IAAGASYAADIGITVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLHKAV 231


>gi|124022665|ref|YP_001016972.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str. MIT
           9303]
 gi|166219105|sp|A2C897|PDXJ_PROM3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|123962951|gb|ABM77707.1| Pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9303]
          Length = 245

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 83/243 (34%), Positives = 134/243 (55%), Gaps = 12/243 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
            S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  DL  +R 
Sbjct: 2   ASLGVNIDHIANVRQARQTVEPDPVPMALLAELGGADGITVHLREDRRHIQDRDLELLRA 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +     ++ LN+E       + +  + +P+ +TLVP+   ++T++ G D    Q  L  
Sbjct: 62  TV-----RSRLNLEMAATPEMVGIALKIQPDMVTLVPERRQEVTTEGGLDVAAQQGSLKG 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLNK 181
            V +L   G  +SLF D    +  L+AA  +GA  +EL+TG Y  AC+ N   E   LN+
Sbjct: 117 MVDQLQVAGIPVSLFVDPVSQQ--LEAACKSGARWVELHTGAYAEACWANQSFELARLNE 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
              TA+ A+ + L++NAGH LT QN+   + AI  I E+++GH   A ++  G++EAV  
Sbjct: 175 --ATAR-ARSLGLRVNAGHGLTYQNV-EAVAAIEGIEELNIGHTIVARSIAVGLQEAVRE 230

Query: 242 FRR 244
            +R
Sbjct: 231 MKR 233


>gi|163802961|ref|ZP_02196848.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio sp. AND4]
 gi|159173251|gb|EDP58079.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio sp. AND4]
          Length = 243

 Score =  126 bits (317), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 129/239 (53%), Gaps = 11/239 (4%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+  +R
Sbjct: 3   SIYLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D       + 
Sbjct: 63  ETI-----QTRMNLEMAVTDEMVEIALKTQPEFVCLVPEKREELTTEGGLDVAGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLN 180
               +L   G ++SLF D   +   + AAK  GA  +EL+TG Y  A     QQ+   L 
Sbjct: 118 AATHKLTEAGIKVSLFID--ADRQQIDAAKACGAPYVELHTGHYADATTEEDQQDE--LK 173

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           K+A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G++++V
Sbjct: 174 KIAAGASYADDLGIIVNAGHGLTYHNVAP-IAALPEIYELNIGHSIIGRAVFDGLEKSV 231


>gi|32490946|ref|NP_871200.1| pyridoxine 5'-phosphate synthase [Wigglesworthia glossinidia
           endosymbiont of Glossina brevipalpis]
 gi|30316008|sp|Q8D304|PDXJ_WIGBR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|25166152|dbj|BAC24343.1| pdxJ [Wigglesworthia glossinidia endosymbiont of Glossina
           brevipalpis]
          Length = 245

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 131/235 (55%), Gaps = 10/235 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V +  +A  +GA  +T H R D RHI   D+  I++ I
Sbjct: 6   LGVNVDHVASLRNVRGGKFPDPVQLAILAEIAGADSITTHLREDNRHINEKDVICIKKSI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                ++ LN+E    +  +N      P    LVP++  ++T++ G D ++N+  L K +
Sbjct: 66  -----QSRLNLEISTKKEMINKAINILPYSCCLVPENRQEITTESGIDVIKNKKYLKKVI 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L +LG ++SLF D   N+  + ++    ADCIE+ TG Y        +E I L KL  
Sbjct: 121 CKLKSLGIKVSLFVDPIKNQ--ILSSSEINADCIEINTGKYSEQDKKENKEEINLIKLC- 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A+ A K+ L+++AGH L   N+ +++N I  I E+++GH+  + +L  G++ AV
Sbjct: 178 -AKYANKLGLEVHAGHGLNYFNVRSIVN-IKEIKELNIGHSIISRSLIVGMQNAV 230


>gi|118580672|ref|YP_901922.1| pyridoxine 5'-phosphate synthase [Pelobacter propionicus DSM 2379]
 gi|166219103|sp|A1AR94|PDXJ_PELPD RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|118503382|gb|ABK99864.1| pyridoxine 5'-phosphate synthase [Pelobacter propionicus DSM 2379]
          Length = 239

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 82/236 (34%), Positives = 132/236 (55%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + +N++ VA +R  R    P+ V    +   +GA G+T+H R D+RHI+  DL  +RR 
Sbjct: 3   KLGLNVDHVATVRQARGGMEPDPVTAAALGELAGAEGITIHLREDRRHIQDRDLEILRRT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     K +LN+E    +  + +  R KPEQ+TLVP+   +LT++ G D + N   +T  
Sbjct: 63  V-----KTKLNLEMAATQEMVRIALRTKPEQVTLVPEKRQELTTEGGLDVILNLKAITDA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL + G  +SLF D   ++  ++AA  +GAD IE++TG Y    + P Q+R  L ++ 
Sbjct: 118 VKRLRDGGIVVSLFVD--PDQEQIKAANKSGADYIEIHTGAYADAPDWPSQKR-QLEEID 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              +LA K+ + +NAGH +   NI  L  A+  I E ++GH+  A A+  G+  AV
Sbjct: 175 AAIKLASKVGMGVNAGHGINYVNIKPL-AALGGIEEYNIGHSIMARAILVGMDRAV 229


>gi|117620211|ref|YP_855346.1| pyridoxine 5'-phosphate synthase [Aeromonas hydrophila subsp.
           hydrophila ATCC 7966]
 gi|117561618|gb|ABK38566.1| pyridoxal phosphate biosynthetic protein PdxJ [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 245

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 129/239 (53%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVEILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  + +  R +P  + LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTEEMIGIACRIQPHFVCLVPEKRTEVTTEGGLDVAGQLDKVTDAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL  +G+++SLF D +  +  + AA  +GA  IE++TG Y     + ++   F  ++A 
Sbjct: 121 ARLSAVGAQVSLFIDADPLQ--IDAAAESGAPFIEIHTGRYADATTDAERNAEF-KRIAA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A  A    L++NAGH L   N+   I AIP + E+++GHA    A   G+ +AV   R
Sbjct: 178 GASYAAGKGLKVNAGHGLHYHNV-KAIAAIPELYELNIGHAIIGRAAFDGLAKAVSDMR 235


>gi|59801846|ref|YP_208558.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           gonorrhoeae FA 1090]
 gi|239999575|ref|ZP_04719499.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae 35/02]
 gi|240113376|ref|ZP_04727866.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae MS11]
 gi|268595388|ref|ZP_06129555.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae 35/02]
 gi|268599449|ref|ZP_06133616.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae MS11]
 gi|293398515|ref|ZP_06642693.1| pyridoxal phosphate biosynthesis protein PdxJ [Neisseria
           gonorrhoeae F62]
 gi|75432413|sp|Q5F6P1|PDXJ_NEIG1 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|59718741|gb|AAW90146.1| putative pyridoxal phosphate biosynthetic protein [Neisseria
           gonorrhoeae FA 1090]
 gi|268548777|gb|EEZ44195.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae 35/02]
 gi|268583580|gb|EEZ48256.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae MS11]
 gi|291610986|gb|EFF40083.1| pyridoxal phosphate biosynthesis protein PdxJ [Neisseria
           gonorrhoeae F62]
 gi|317164826|gb|ADV08367.1| pyridoxine 5''''-phosphate synthase [Neisseria gonorrhoeae
           TCDC-NG08107]
          Length = 242

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 128/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA+  GA  +EL+TG Y    ++ +Q R F  ++  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAARDVGAPVVELHTGAYADAQSHAEQIRQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|15676359|ref|NP_273495.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis MC58]
 gi|12644544|sp|Q9K0V9|PDXJ_NEIMB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|7225673|gb|AAF40885.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis MC58]
 gi|316985791|gb|EFV64734.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis H44/76]
 gi|325140962|gb|EGC63469.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis CU385]
 gi|325199635|gb|ADY95090.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis H44/76]
          Length = 242

 Score =  126 bits (316), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  +    
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAGFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA+  GA  +EL+TG Y    ++ +Q R F  ++  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAARDVGAPVVELHTGAYADARSHAEQIRQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|218768787|ref|YP_002343299.1| pyridoxine 5'-phosphate synthase [Neisseria meningitidis Z2491]
 gi|12644549|sp|Q9RQV9|PDXJ_NEIMA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|6274540|gb|AAF06688.1|AF163663_13 PdxJ [Neisseria meningitidis]
 gi|121052795|emb|CAM09141.1| pyridoxal phophate biosynthetic protein [Neisseria meningitidis
           Z2491]
          Length = 242

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 128/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQDKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA+  GA  +EL+TG Y    ++ +Q R F  ++  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAARDVGAPVVELHTGAYADARSHAEQIRQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHFASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|325136836|gb|EGC59434.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M0579]
          Length = 242

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 128/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTIYPSPVEAALIAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQDKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA+  GA  +EL+TG Y    ++ +Q + F  +L  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAARDVGAPVVELHTGAYADARSHAEQLKQF-ERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|223939480|ref|ZP_03631357.1| pyridoxal phosphate biosynthetic protein PdxJ [bacterium Ellin514]
 gi|223891865|gb|EEF58349.1| pyridoxal phosphate biosynthetic protein PdxJ [bacterium Ellin514]
          Length = 246

 Score =  126 bits (316), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 131/240 (54%), Gaps = 12/240 (5%)

Query: 4   SVSVNLNAVAVLRNRR----NLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPE 59
            + VN++ VA LR  R        P+ +    I+  +GA G+T H R D+RHI+  D+  
Sbjct: 3   KLGVNIDHVATLREARYRGTGQGEPDPISAALISESAGAHGITAHLREDRRHIQDRDVWN 62

Query: 60  IRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQAL 119
           +R+ I     K  LN+E       + +  + KPE + LVP+   ++T++ G D + N   
Sbjct: 63  LRKAI-----KTRLNLEMANAPEIVEIALKLKPEIVCLVPEKRQEVTTEGGLDVVGNLQS 117

Query: 120 LTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFL 179
           LT+T  R+ + G  +SLF      +  +QAA   GA  IEL+TG +   +N   +  + L
Sbjct: 118 LTETRKRMTDAGIEVSLFIAAEPAQ--VQAASRVGAQFIELHTGAFAEHFNQKVERNLEL 175

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            +L   A+ A  + +Q+NAGH L  +N+P L++ +P++ E+++GH+  + A+  G++ AV
Sbjct: 176 ARLITAAKQAHALGIQVNAGHGLNYENLP-LLHTVPHLVELNIGHSVISRAITVGLETAV 234


>gi|89075085|ref|ZP_01161526.1| pyridoxal phosphate biosynthetic protein [Photobacterium sp. SKA34]
 gi|89049172|gb|EAR54737.1| pyridoxal phosphate biosynthetic protein [Photobacterium sp. SKA34]
          Length = 243

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 126/239 (52%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATLRNARGTSYPDPVHAAEVAERAGADGITIHLREDRRHINDRDVRILRETI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    KPE + LVP+   +LT++ G D       +    
Sbjct: 66  -----QTRMNLEMAVTDEMVAIALDVKPEYVCLVPEKREELTTEGGLDVSGQLEKVKAAT 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G ++SLF D   +   + AA   GA  IEL+TG Y        Q    L K+A 
Sbjct: 121 EKLTAAGIKVSLFID--ADRAQIDAAHACGAPFIELHTGQYAEAKTEEAQLD-ELKKVAA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A  A  + +++NAGH LT  N+  LI A+P + E+++GH+    A+  G++++V   R
Sbjct: 178 GASYAHNLGIKVNAGHGLTYHNV-KLIAALPELYELNIGHSIMGRAMFDGLEKSVADMR 235


>gi|15606602|ref|NP_213982.1| pyridoxal phosphate biosynthetic protein PdxJ [Aquifex aeolicus
           VF5]
 gi|6225837|sp|O67417|PDXJ_AQUAE RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|2983816|gb|AAC07372.1| pyridoxal phosphate synthetase [Aquifex aeolicus VF5]
          Length = 242

 Score =  125 bits (315), Expect = 4e-27,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 134/250 (53%), Gaps = 17/250 (6%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +R  R    P+ V    IA Q+GA  +T+H R D+RHI+  DL  I+ LI
Sbjct: 3   LGVNVDHVATVRQARRTFEPSPVFAALIAQQAGADQITLHLREDRRHIQDRDLELIKELI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
               P   +N+E  P E    +  R KP++ITLVP+   ++T++ G D +  +  L + +
Sbjct: 63  --TIP---VNLEMAPTEEMREIALRVKPDRITLVPERREEITTEGGLDVVSLKEKLKEYL 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE--RIFLNKL 182
             +   G  +SLF +    +  + A+   GAD IE++TG Y   +N  + E  +  LN++
Sbjct: 118 KPIKEAGIEVSLFIE--AQKEQIDASVEVGADAIEIHTGRYANLWNEHRFEEAKEELNRI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIP-YISEISVGHAFAATALECGVKEAVFC 241
              A  A++  L++ AGH LT  N+ + +  +  Y+ E+++GH+  A A+       +F 
Sbjct: 176 KEAAIYAKEKGLKVYAGHGLTYHNVKDFVRELKGYVEELNIGHSIVANAV-------IFG 228

Query: 242 FRRACGQHLD 251
           F RA  + L+
Sbjct: 229 FERAVKEMLN 238


>gi|86607950|ref|YP_476712.1| pyridoxine 5'-phosphate synthase [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|123503702|sp|Q2JP46|PDXJ_SYNJB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|86556492|gb|ABD01449.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 239

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 132/244 (54%), Gaps = 9/244 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A LR  R    P+ V    IA  +GA G+TVH R D+RHI+  D+  +R  
Sbjct: 3   SLGVNIDHIATLRQARRTVEPDPVAAAVIAELAGADGITVHLREDRRHIQDRDVRLLR-- 60

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              Q  +  LN+E    E  + +    KP+ +TLVP+   ++T++ G D     + L   
Sbjct: 61  ---QTVRTHLNLEMAATEEMVAIALEVKPDYVTLVPERREEITTEGGLDVAGQVSRLRDV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V +L   G  +SLF D +  +  + AA   GA  +EL+TG Y A  ++  Q ++ L+ L 
Sbjct: 118 VGQLQGSGIPVSLFIDPDPTQ--IAAAAQVGARWVELHTGRY-AEASSAAQRQVELDHLE 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             +Q A ++ L++NAGH LT  N+   +  IP + E+++GH+  + A+  G+  AV   R
Sbjct: 175 KASQQALQLGLRVNAGHGLTYWNV-GPVARIPGMEELNIGHSIISRAVLVGLDRAVREMR 233

Query: 244 RACG 247
           +A G
Sbjct: 234 QAMG 237


>gi|253689437|ref|YP_003018627.1| pyridoxal phosphate biosynthetic protein PdxJ [Pectobacterium
           carotovorum subsp. carotovorum PC1]
 gi|251756015|gb|ACT14091.1| pyridoxal phosphate biosynthetic protein PdxJ [Pectobacterium
           carotovorum subsp. carotovorum PC1]
          Length = 243

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 125/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R  +
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRILRDTL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  LN+    KP    LVP+   ++T++ G D    Q  +   V
Sbjct: 66  -----QTRMNLEMAVTEEMLNIACEVKPHFCCLVPEKRQEVTTEGGLDVAGQQEKINNAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL      +SLF D   ++  + AA  +GA  IE++TG Y    ++  ++  F  ++  
Sbjct: 121 ARLSQANILVSLFID--ADKRQIDAAVASGAPYIEIHTGAYADAPDDEARQHEF-ERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+K+AV
Sbjct: 178 AATYAAAQGLKVNAGHGLTYHNV-QPIAALPEMHELNIGHAIIGRAVMSGLKDAV 231


>gi|77164313|ref|YP_342838.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus oceani
           ATCC 19707]
 gi|254434738|ref|ZP_05048246.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus oceani
           AFC27]
 gi|91207549|sp|Q3JCY8|PDXJ_NITOC RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|76882627|gb|ABA57308.1| pyridoxine 5'-phosphate synthase [Nitrosococcus oceani ATCC 19707]
 gi|207091071|gb|EDZ68342.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus oceani
           AFC27]
          Length = 246

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ +     A Q+GA G+T+H R D+RHI+  D+  +R ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPIQAAIEAEQAGADGITLHLREDRRHIQERDVALLRDVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                 +++N+E       L + E+Y PE   LVP+   +LT++ G +     A +T+  
Sbjct: 69  -----VSKMNLEMAVTGEMLAIAEKYCPEDCCLVPERREELTTEGGLNVTGQLARITEAC 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+R+SLF D +  +  ++AA    A  IE++TG +    +   + + F  ++  
Sbjct: 124 VRLKEAGTRVSLFIDADPRQ--VEAAAQANAPVIEIHTGHFADARDERNRRKEF-QRIVE 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             +  +++ LQ+NAGH L  QN+   I A+  I E+++GHA  A AL  G++ AV   +R
Sbjct: 181 AVKRGREVGLQVNAGHGLNYQNVAA-IAALSDIVELNIGHAIIARALFTGMQSAVGEMKR 239


>gi|218513039|ref|ZP_03509879.1| pyridoxine 5'-phosphate synthase [Rhizobium etli 8C-3]
          Length = 117

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 59/115 (51%), Positives = 77/115 (66%)

Query: 134 ISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMD 193
           +SLFADG+G+  ++  AK  GAD IELYTGPYG CY+ P++    L  L  TA  A  + 
Sbjct: 1   VSLFADGDGDAQAVTIAKAVGADRIELYTGPYGGCYDAPERAAPILEALGKTADAALAIG 60

Query: 194 LQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRRACGQ 248
           L +NAGHDLT+ N+P L+  IP ++E+S+GH   A ALE G+ E V  F RACGQ
Sbjct: 61  LAVNAGHDLTVANLPALVKRIPDLAEVSIGHGLTADALEYGMAETVRRFCRACGQ 115


>gi|269213841|ref|ZP_05982975.2| pyridoxine 5'-phosphate synthase [Neisseria cinerea ATCC 14685]
 gi|269145174|gb|EEZ71592.1| pyridoxine 5'-phosphate synthase [Neisseria cinerea ATCC 14685]
          Length = 255

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 127/235 (54%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 16  LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 75

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  P+ + +VP+   ++T++ G D L  Q  + +  
Sbjct: 76  -----RTRLNLEMALTEEMLENALKVMPQDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 130

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +  +QAA+  GA  IEL+TG Y   +++ +Q + F  +L  
Sbjct: 131 KILTDAGIRVSLFIDADNEQ--IQAARDVGAPVIELHTGAYADAHSHAEQLKQF-ERLQN 187

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV
Sbjct: 188 GAHFASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAV 241


>gi|91202475|emb|CAJ72114.1| strongly similar to pyridoxal phosphate biosynthetic protein PdxJ
           (PNP synthase) [Candidatus Kuenenia stuttgartiensis]
          Length = 249

 Score =  125 bits (315), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 136/250 (54%), Gaps = 14/250 (5%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LR  R    P+ V     A+  GA  +TVH R D+RHI+  D+  +R  
Sbjct: 3   KLGVNIDHVATLRQARKTYEPDPVTAASFAILGGADIITVHLREDRRHIQDRDILLLRET 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +   F K  LN+E    +  +++  + KPEQ+ LVP+   ++T++ G D    ++++ + 
Sbjct: 63  V---FTK--LNLEMSIADEIVDIAIKTKPEQVALVPEKRQEVTTEGGLDVASQKSVIGRV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL + G  ISLF D    E  + AAK  G+  IEL+TG Y    +   + + +  KL 
Sbjct: 118 VKRLADAGILISLFID--PEEEQIIAAKEVGSQFIELHTGNYANAKDVNLRAK-WTEKLR 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV---- 239
              ++A  + L++NAGH LT QN+ +++ ++  + E+ +GH+  + ++  G+K+AV    
Sbjct: 175 QGIKIAHGLGLRVNAGHGLTYQNVGHIVESLD-VEELHIGHSIVSRSVFVGIKKAVQEMK 233

Query: 240 -FCFRRACGQ 248
              FR +  +
Sbjct: 234 DLIFRHSMAK 243


>gi|226328138|ref|ZP_03803656.1| hypothetical protein PROPEN_02029 [Proteus penneri ATCC 35198]
 gi|225203842|gb|EEG86196.1| hypothetical protein PROPEN_02029 [Proteus penneri ATCC 35198]
          Length = 243

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 128/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+T+H R D+RHI   DL     ++
Sbjct: 6   LGVNIDHIATLRNARGTTYPDPVQAAFIAEQAGADGITIHLREDRRHITDRDL-----ML 60

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  LN+E    E  + +  + +P+   LVP+   ++T++ G D + N+A +   +
Sbjct: 61  ISQTVQTRLNLEMAVTEEMIEIACQTQPDFCCLVPEKRQEVTTEGGLDVVGNEAKVADAI 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D +  +  + AA   GA  IE++TG Y    +   QE+ F+ ++  
Sbjct: 121 KRLSLAGIKVSLFIDPDHEQ--INAADRVGAPFIEIHTGAYADAEDEMAQEKEFM-RIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
               A    L++NAGH L   N+   I A+P + E+++GHA    A+  G+  AV   +R
Sbjct: 178 AVTYAASKGLKVNAGHGLHYHNVQR-IAALPELYELNIGHAIIGRAVFSGLAPAVEEMKR 236


>gi|319943508|ref|ZP_08017790.1| pyridoxine 5'-phosphate synthase [Lautropia mirabilis ATCC 51599]
 gi|319743323|gb|EFV95728.1| pyridoxine 5'-phosphate synthase [Lautropia mirabilis ATCC 51599]
          Length = 258

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 79/245 (32%), Positives = 129/245 (52%), Gaps = 14/245 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +R  R    P+ V     A   GA G+TVH R D+RHI+  D   +RRL 
Sbjct: 4   LGVNIDHVATIRQARRTYEPDPVWAAVEAHLGGADGITVHLREDRRHIQDAD---VRRLR 60

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D+   + +LN+E       +++    KPE   LVP+  H++T++ G D L  +A +T  +
Sbjct: 61  DQT--QIKLNLEMAATPEMVDIAIALKPEMAMLVPEGRHEITTEGGLDILSKEAAITDAI 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE------RIF 178
            RL + G   S+F D    +  ++AA   GA   EL+TGPY   ++   ++      R  
Sbjct: 119 RRLADHGIITSVFIDAEPAQ--VEAAARAGASVCELHTGPYAETFHREGRDVASPAIRRE 176

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           L ++A    L Q+  ++ NAGH L   N+   + A+P + E+ +GHA  + A+  G++EA
Sbjct: 177 LERVATAGALIQQAGMRFNAGHGLNYFNV-QPVAALPGVRELHIGHAIVSRAVFVGMREA 235

Query: 239 VFCFR 243
           V   +
Sbjct: 236 VSTMK 240


>gi|94502130|ref|ZP_01308631.1| pyridoxal phosphate biosynthetic protein [Oceanobacter sp. RED65]
 gi|94425732|gb|EAT10739.1| pyridoxal phosphate biosynthetic protein [Oceanobacter sp. RED65]
          Length = 246

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 131/239 (54%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P+ V+   +A ++GA G+T+H R D+RHI+  D+  +R  +
Sbjct: 9   LGVNIDHIATLRQARGTRYPDPVYAALVAEEAGADGITLHLREDRRHIQDADVYALRERL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           + +     +N+E    +  + + +  KP  + LVP+   +LT++ G D L N+A + +  
Sbjct: 69  NTR-----MNLEMAVTDEMVAIAKEVKPHAVCLVPEKREELTTEGGLDVLGNEAKIKQAC 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L ++GS +SLF D +  +  + AA   GA  IE++TG Y    +  + +R  L K+  
Sbjct: 124 DDLASVGSEVSLFIDADTKQ--IDAAVRCGAPVIEIHTGHYAEAQSAAEMQR-ELKKIED 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A  A +  L +NAGH L   N    I AI  ++E+++GHA  A A   G+K+AV   R
Sbjct: 181 GASYALEQGLIVNAGHGLHYHN-TEAIAAISGMNELNIGHAIIAHAAFVGLKQAVKEMR 238


>gi|294789556|ref|ZP_06754791.1| pyridoxine 5'-phosphate synthase [Simonsiella muelleri ATCC 29453]
 gi|294482493|gb|EFG30185.1| pyridoxine 5'-phosphate synthase [Simonsiella muelleri ATCC 29453]
          Length = 242

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 130/237 (54%), Gaps = 14/237 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  I++ I
Sbjct: 3   LGVNIDHVATLRNARGAGYPSPVEAALVAETHGADLITLHLREDRRHIKDADVFAIKQAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E    E  L      +PE + +VP+   ++T++ G D +  Q  +   V
Sbjct: 63  -----KTRMNLEMAMTEEMLANAINVQPEDVCIVPEKRQEITTEGGLDIVAQQDKVADYV 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG--ACYNNPQQERIFLNKL 182
           A+L     R+SLF D +  +  +QAA   GA  IE++TG Y   A ++   +    L ++
Sbjct: 118 AKLQQNQIRVSLFIDADLAQ--IQAAYDVGARVIEIHTGAYAEKAAHDRAAE----LARI 171

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A+ A+K+ + +NAGH LTIQN+   I  IP I E+++GH+  A A+  G+ +A+
Sbjct: 172 RQAAEFAEKLGITVNAGHGLTIQNVAP-IAQIPQIVELNIGHSIIAQAVFLGLPKAI 227


>gi|254494291|ref|ZP_05107462.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae 1291]
 gi|226513331|gb|EEH62676.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae 1291]
          Length = 242

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 128/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  +EL+TG Y   +++ +Q R F  +L  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVVELHTGAYADAHSHAEQIRQF-ERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|260771272|ref|ZP_05880199.1| pyridoxine 5'-phosphate synthase [Vibrio furnissii CIP 102972]
 gi|260613869|gb|EEX39061.1| pyridoxine 5'-phosphate synthase [Vibrio furnissii CIP 102972]
 gi|315179121|gb|ADT86035.1| pyridoxal phosphate biosynthetic protein PdxJ [Vibrio furnissii
           NCTC 11218]
          Length = 243

 Score =  125 bits (314), Expect = 5e-27,   Method: Compositional matrix adjust.
 Identities = 84/240 (35%), Positives = 127/240 (52%), Gaps = 13/240 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA LRN R   +P+ VH  +IA ++GA G+TVH R D+RHI   D+  +R
Sbjct: 3   SILLGVNIDHVATLRNARGTKYPDPVHAAEIAERAGADGITVHLREDRRHILDRDVRILR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I     +  +N+E    +  + +  + +PE + LVP+   +LT++ G D +     + 
Sbjct: 63  ETI-----QTRMNLEMAVTDEMVEIALQTQPEFVCLVPEKREELTTEGGLDVMGQLEKVK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFL 179
                L   G ++SLF D   +   + AAK  GA  IEL+TG Y    C  + Q E   L
Sbjct: 118 AATQTLTAAGIKVSLFID--ADREQIDAAKACGAPFIELHTGHYADATCEVDQQNE---L 172

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            K+A  A  A    + +NAGH LT  N+   I AIP I E+++GHA    A+  G+ +AV
Sbjct: 173 KKIAAAASYAADQGIMVNAGHGLTYHNVAA-IAAIPEIYELNIGHAIIGRAVFDGLSKAV 231


>gi|224825227|ref|ZP_03698333.1| pyridoxal phosphate biosynthetic protein PdxJ [Lutiella nitroferrum
           2002]
 gi|224602898|gb|EEG09075.1| pyridoxal phosphate biosynthetic protein PdxJ [Lutiella nitroferrum
           2002]
          Length = 245

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 77/239 (32%), Positives = 129/239 (53%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ +    +A  +GA  +T+H R D+RHI+  D+  +R++I
Sbjct: 4   LGVNIDHVATLRQARGTRYPSPIEAALVAETAGADLITLHLREDRRHIQDADVVAMRQVI 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E    E  L      KPE + LVP+   ++T++ G D +++   +    
Sbjct: 64  -----KTRMNLEMALTEEMLANALAVKPEDVCLVPEKREEITTEGGLDVIRHFDQVRDYT 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G R+SLF D +  +  ++AA+  GA  IEL+TG Y    +  ++ER  L ++  
Sbjct: 119 LALTEAGIRVSLFIDPDNQQ--IEAARDAGARVIELHTGAYADAVHQAERER-ELARVRE 175

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A  A  +D  +NAGH L+  N+ + + AI  I+E+++GHA  + AL  G  EAV   +
Sbjct: 176 AAVFAAHLDFVVNAGHGLSYHNVKS-VAAIAEIAELNIGHAIVSQALFVGFPEAVRSMK 233


>gi|170720262|ref|YP_001747950.1| pyridoxine 5'-phosphate synthase [Pseudomonas putida W619]
 gi|229485647|sp|B1J4E3|PDXJ_PSEPW RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|169758265|gb|ACA71581.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas putida
           W619]
          Length = 246

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 122/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVVLLKDVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 69  -----QTRMNFEMGVTEEMMAFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D   +E  ++A++  GA  IEL+TG Y A    P +    L ++  
Sbjct: 124 ERLSRTGAEVSLFID--ADERQIEASRRVGAPAIELHTGRY-ADAQTPTEVAEELKRIVD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGVAQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|156932893|ref|YP_001436809.1| pyridoxine 5'-phosphate synthase [Cronobacter sakazakii ATCC
           BAA-894]
 gi|156531147|gb|ABU75973.1| hypothetical protein ESA_00695 [Cronobacter sakazakii ATCC BAA-894]
          Length = 243

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 123/240 (51%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D       +    
Sbjct: 63  --QTLHTRMNLEMAVTEEMLTIACETKPHFCCLVPEKRQEVTTEGGLDVAGQLDKMRDAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +  + AA   GA  IE++TG Y    ++  + R  L ++A 
Sbjct: 121 QRLAAAGILVSLFIDADNAQ--IDAAVAVGAPYIEIHTGCYADAEDDATRAR-ELERIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 178 AATYAASKGLKVNAGHGLTYHNV-QAIAALPEMHELNIGHAIIGRAVMSGLKEAVSEMKR 236


>gi|240081162|ref|ZP_04725705.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae FA19]
 gi|268597272|ref|ZP_06131439.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae FA19]
 gi|268551060|gb|EEZ46079.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae FA19]
          Length = 242

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +  +QAA   GA  +EL+TG Y    ++ +Q R F  +L  
Sbjct: 118 KILTDAGIRVSLFIDADNEQ--IQAAYDVGAPVVELHTGAYADARSHAEQIRQF-ERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|325130815|gb|EGC53549.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis OX99.30304]
          Length = 242

 Score =  125 bits (314), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  +EL+TG Y    ++ +Q R F  ++  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVVELHTGAYADARSHAEQIRQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|16125804|ref|NP_420368.1| pyridoxal phosphate biosynthetic protein PdxJ [Caulobacter
           crescentus CB15]
 gi|221234563|ref|YP_002516999.1| pyridoxine 5'-phosphate synthase [Caulobacter crescentus NA1000]
 gi|20139117|sp|Q9A808|PDXJ_CAUCR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|254781560|sp|B8H623|PDXJ_CAUCN RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|13422944|gb|AAK23536.1| pyridoxal phosphate biosynthetic protein PdxJ [Caulobacter
           crescentus CB15]
 gi|220963735|gb|ACL95091.1| pyridoxal phosphate biosynthetic protein pdxJ [Caulobacter
           crescentus NA1000]
          Length = 254

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 128/245 (52%), Gaps = 7/245 (2%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MS  + VN++ VA +RN R   +P  V   ++AL +GA G+T H R D+RHI   D+  +
Sbjct: 1   MSLRLGVNIDHVATIRNARGASYPEPVRAAELALIAGADGITAHLREDRRHISDADIAVL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
             L  ++     LN E    +  + +    +P    LVP+   ++T++ G D ++ Q  +
Sbjct: 61  TDLCHKRGKP--LNFEMAVTDEMVGIALNARPHAACLVPERREEVTTEGGLDVIKGQKRI 118

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIF 178
               ARL  +G+R+SLF + + ++  ++A    GA  +EL+TG Y   A      +    
Sbjct: 119 ADATARLRTVGARVSLFIEPDPDQ--IRACVTAGAQVVELHTGAYCDAARAGETARAEAI 176

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           L +L   A LA ++ L+++AGH +    +   + AIP I+E+++GH     A+  G+ EA
Sbjct: 177 LKRLKAGAALAHELGLEVHAGHGIDYATVKP-VAAIPQIAELNIGHFLIGEAIFVGLPEA 235

Query: 239 VFCFR 243
           +   R
Sbjct: 236 IHRMR 240


>gi|86146356|ref|ZP_01064680.1| pyridoxal phosphate biosynthetic protein [Vibrio sp. MED222]
 gi|218710566|ref|YP_002418187.1| pyridoxine 5'-phosphate synthase [Vibrio splendidus LGP32]
 gi|85835835|gb|EAQ53969.1| pyridoxal phosphate biosynthetic protein [Vibrio sp. MED222]
 gi|218323585|emb|CAV19823.1| Pyridoxal phosphate biosynthetic protein pdxJ [Vibrio splendidus
           LGP32]
          Length = 245

 Score =  125 bits (314), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 126/238 (52%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+    
Sbjct: 3   SILLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHIVDRDV---- 58

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           R++ E   +  +N+E    +  + +     PE + LVP+   +LT++ G D +     + 
Sbjct: 59  RILAETI-QTRMNLEMAVTDEMVQIALDTNPEFVCLVPEKREELTTEGGLDVVGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D   +   + AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATEKLSAAGIKVSLFID--ADREQIDAAKACGAPFIELHTGHYADAKTEEDQQD-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV
Sbjct: 175 IAAGASYADDLGITVNAGHGLTYHNVAP-IAALPEIYELNIGHSIMGRAVFDGLNKAV 231


>gi|318040192|ref|ZP_07972148.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. CB0101]
          Length = 249

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 128/236 (54%), Gaps = 10/236 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI   D+  +R++
Sbjct: 3   SLGVNIDHIANVRQARRTVEPDPVSYALLAELGGADGITVHLREDRRHIHDRDVELLRQV 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     ++ LN+E         +  R KP+ +TLVP+   ++T++ G D       L   
Sbjct: 63  V-----RSRLNLEMAATPEMEAIALRIKPDMVTLVPEKREEVTTEGGLDVAGQLEPLQGL 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL   G  +SLF D    +  L+A +  GA  +EL+TG Y     + QQ+ + L +L 
Sbjct: 118 VGRLQEAGIGVSLFVDAEPTQ--LEACRAAGARWVELHTGTYAEA--DWQQQPLELARLT 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             + +A+ + L++NAGH LT QN+   + AI  + E+++GH   A AL  G++EAV
Sbjct: 174 EGSFIARSLGLRVNAGHGLTYQNVEP-VAAIEGMEELNIGHTIVARALAVGLEEAV 228


>gi|167035364|ref|YP_001670595.1| pyridoxine 5'-phosphate synthase [Pseudomonas putida GB-1]
 gi|189036752|sp|B0KV24|PDXJ_PSEPG RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|166861852|gb|ABZ00260.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas putida
           GB-1]
          Length = 246

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 122/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVVVLKDVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 69  -----QTRMNFEMGVTEEMMAFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D   +E  ++A++  GA  IEL+TG Y A    P +    L ++  
Sbjct: 124 ERLARTGAEVSLFID--ADERQIEASRRVGAPAIELHTGRY-ADAQTPTEVAEELKRIVD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGVGQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|161870626|ref|YP_001599799.1| pyridoxine 5'-phosphate synthase [Neisseria meningitidis 053442]
 gi|189036750|sp|A9M276|PDXJ_NEIM0 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|161596179|gb|ABX73839.1| pyridoxal phophate biosynthetic protein [Neisseria meningitidis
           053442]
          Length = 242

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  +    
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAGFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  IEL+TG Y   +++ +Q + F  ++  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVIELHTGAYADAHSHAEQMKQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHYASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|145300358|ref|YP_001143199.1| pyridoxine 5'-phosphate synthase [Aeromonas salmonicida subsp.
           salmonicida A449]
 gi|142853130|gb|ABO91451.1| pyridoxal phosphate biosynthetic protein PdxJ [Aeromonas
           salmonicida subsp. salmonicida A449]
          Length = 245

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 127/239 (53%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVEILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  + +  R KP  + LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTEEMIGIACRIKPHFVCLVPEKRTEVTTEGGLDVAGQLDKITDAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G+++SLF D +  +  + AA  +GA  IE++TG Y     +  +   F  ++A 
Sbjct: 121 TRLSAVGAQVSLFIDADPLQ--IDAAADSGAPFIEIHTGRYADATTDTDRNAEF-KRIAA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A  A    L++NAGH L   N+   I AIP + E+++GHA    A   G+ +AV   R
Sbjct: 178 GASYAAGKGLKVNAGHGLHYHNV-KAIAAIPELYELNIGHAIIGRAAFDGLTKAVSDMR 235


>gi|261820522|ref|YP_003258628.1| pyridoxine 5'-phosphate synthase [Pectobacterium wasabiae WPP163]
 gi|261604535|gb|ACX87021.1| pyridoxal phosphate biosynthetic protein PdxJ [Pectobacterium
           wasabiae WPP163]
          Length = 243

 Score =  125 bits (313), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 126/236 (53%), Gaps = 11/236 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R  +
Sbjct: 6   LGINIDHIATLRNARGTAYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRILRETL 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  LN+    KP    LVP+   ++T++ G D    Q  +   V
Sbjct: 66  -----QTRMNLEMAVTEEMLNIACEVKPHFCCLVPEKRQEVTTEGGLDVAGQQEKIDNAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL      +SLF D   ++  + AA  +GA  IE++TG Y    ++  ++  F  ++  
Sbjct: 121 ARLSQANILVSLFID--ADKRQIDAAVASGAPYIEIHTGAYADAPDDETRQHEF-ERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNI-PNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+ P  I A+P + E+++GHA    A+  G+K+AV
Sbjct: 178 AATYAAAQGLKVNAGHGLTYHNVLP--IAALPEMHELNIGHAIIGRAVMSGLKDAV 231


>gi|288576346|ref|ZP_05978630.2| pyridoxine 5'-phosphate synthase [Neisseria mucosa ATCC 25996]
 gi|288565708|gb|EFC87268.1| pyridoxine 5'-phosphate synthase [Neisseria mucosa ATCC 25996]
          Length = 265

 Score =  125 bits (313), Expect = 8e-27,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 127/235 (54%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 26  LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 85

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  P+ + +VP+   ++T++ G D L  Q  + +  
Sbjct: 86  -----RTRLNLEMALTEEMLENALKVMPQDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 140

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D + ++  +QAA   GA  IEL+TG Y   +++ +Q + F  +L  
Sbjct: 141 KILTDAGIRVSLFIDADNDQ--IQAAYDVGAPVIELHTGAYADAHSHAEQIQQF-ERLQN 197

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV
Sbjct: 198 GAHFASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAV 251


>gi|78184987|ref|YP_377422.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. CC9902]
 gi|123580867|sp|Q3AVH3|PDXJ_SYNS9 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|78169281|gb|ABB26378.1| Pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           CC9902]
          Length = 249

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 133/238 (55%), Gaps = 14/238 (5%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R+ 
Sbjct: 3   SLGVNIDHIANIREARRTVEPDPVPMAMLAELGGADGITVHLREDRRHIQDRDVELLRQT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     ++ LN+E       + +  R KP+ +TLVP+   ++T++ G D +   + LT  
Sbjct: 63  V-----RSRLNLEMAATAEMVAIALRVKPDMVTLVPEHRQEVTTEGGLDVVAQLSELTGM 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFLNK 181
           V++L   G  +SLF D   ++  L+    +GA  +EL+TG Y  G+  + P +    L +
Sbjct: 118 VSQLQTSGIPVSLFVDPVASQ--LRGCTDSGARWVELHTGRYAEGSWNDQPHE----LAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           L      A+ M L++NAGH LT QN+   + AIP + E+++GH   A A+  G+++AV
Sbjct: 172 LTEGTATARAMGLRVNAGHGLTYQNV-EPVAAIPGMEELNIGHTIVARAVVVGLQQAV 228


>gi|254672797|emb|CBA06901.1| pyridoxine biosynthesis [Neisseria meningitidis alpha275]
 gi|308388651|gb|ADO30971.1| pyridoxal phosphate biosynthetic protein [Neisseria meningitidis
           alpha710]
 gi|325198869|gb|ADY94325.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis G2136]
          Length = 242

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  +EL+TG Y    ++ +Q + F  +L  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVVELHTGAYADARSHAEQLKQF-ERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|254805523|ref|YP_003083744.1| pyridoxine 5-phosphate synthase [Neisseria meningitidis alpha14]
 gi|254669065|emb|CBA07570.1| pyridoxine 5-phosphate synthase [Neisseria meningitidis alpha14]
 gi|325134815|gb|EGC57451.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M13399]
 gi|325144986|gb|EGC67269.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M01-240013]
 gi|325205514|gb|ADZ00967.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M04-240196]
          Length = 242

 Score =  124 bits (312), Expect = 9e-27,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQDKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  +EL+TG Y    ++ +Q R F  ++  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVVELHTGAYADARSHAEQIRQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|300724129|ref|YP_003713446.1| pyridoxine biosynthesis protein [Xenorhabdus nematophila ATCC
           19061]
 gi|297630663|emb|CBJ91328.1| carries out condensation and ring closure step after PdxA in
           pyridoxine biosynthesis [Xenorhabdus nematophila ATCC
           19061]
          Length = 243

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 126/236 (53%), Gaps = 11/236 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ +A +RN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  + + I
Sbjct: 6   LGINIDHIATVRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVQLLEKTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +  + KP    LVP+   ++T++ G D +  +A +   V
Sbjct: 66  -----QTRMNLEMAVTDEMVGIAVQIKPVFCCLVPEKRQEVTTEGGLDVIGQKAHIAAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN-KLA 183
             L   G  +SLF D +  +  + AA   GA  IE++TG Y    +  QQE+ FL  K A
Sbjct: 121 KTLSEAGILVSLFIDADPQQ--IDAAVAVGAPFIEIHTGAYADAEDEIQQEKEFLRIKEA 178

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +T   A    L++NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV
Sbjct: 179 VT--YASGKGLKVNAGHGLTYHNVQR-IAALPEIYELNIGHAIIGRAVFSGLSAAV 231


>gi|183599774|ref|ZP_02961267.1| hypothetical protein PROSTU_03281 [Providencia stuartii ATCC 25827]
 gi|188022037|gb|EDU60077.1| hypothetical protein PROSTU_03281 [Providencia stuartii ATCC 25827]
          Length = 243

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 124/240 (51%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  ++  I
Sbjct: 6   LGVNIDHIATVRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDIELLKETI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  +N+  R KP    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTEEMINIACRVKPAFCCLVPEKREEVTTEGGLDVAGQLPKITDAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D +  +  + AA+  GA  IE++TG Y       +QE I   ++  
Sbjct: 121 KRLTEAGIQVSLFIDADHTQ--IDAAQAAGAPFIEIHTGAYADAKTEQEQE-IEYRRIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
               A    L++NAGH LT  N+   I  +P I E+++GHA    AL  G+  AV   ++
Sbjct: 178 GVAYAAGKGLKVNAGHGLTYHNVQR-IALLPEIYELNIGHAIIGRALFSGLANAVADMKK 236


>gi|240014752|ref|ZP_04721665.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae DGI18]
 gi|240017200|ref|ZP_04723740.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae FA6140]
 gi|240121275|ref|ZP_04734237.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID24-1]
          Length = 242

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 126/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  +    
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAGFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  +EL+TG Y    ++ +Q R F  +L  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVVELHTGAYADARSHAEQIRQF-ERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|325275441|ref|ZP_08141372.1| pyridoxine 5'-phosphate synthase [Pseudomonas sp. TJI-51]
 gi|324099417|gb|EGB97332.1| pyridoxine 5'-phosphate synthase [Pseudomonas sp. TJI-51]
          Length = 246

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 122/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVVLLKDVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 69  -----QTRMNFEMGVTEEMMAFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D   +E  ++A++  GA  IEL+TG Y A    P +    L ++  
Sbjct: 124 ERLARTGAEVSLFID--ADERQIEASRRVGAPAIELHTGRY-ADAQTPAEVADELRRIVD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGVGQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|240118564|ref|ZP_04732626.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID1]
 gi|268604273|ref|ZP_06138440.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID1]
 gi|268588404|gb|EEZ53080.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID1]
          Length = 242

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  +EL+TG Y    ++ +Q R F  ++  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVVELHTGAYADAQSHAEQIRQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|145588596|ref|YP_001155193.1| pyridoxal phosphate biosynthetic protein PdxJ [Polynucleobacter
           necessarius subsp. asymbioticus QLW-P1DMWA-1]
 gi|145047002|gb|ABP33629.1| pyridoxine 5'-phosphate synthase [Polynucleobacter necessarius
           subsp. asymbioticus QLW-P1DMWA-1]
          Length = 248

 Score =  124 bits (312), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 130/235 (55%), Gaps = 10/235 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ VA LRN R   +P+ +   ++A  +GA  +T+H R D+RHI+  DL  +R LI
Sbjct: 9   LGINIDHVATLRNARGTIYPDPLRAAQLAESAGADLITLHLREDRRHIKDADLFALRPLI 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E       +++  + KP  + LVP+   ++T++ G D + +   +    
Sbjct: 69  -----KTRMNLECAVTPEMIDIACKVKPHDVCLVPEKREEVTTEGGLDVVGHYEAVKAAT 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ++L N G R+SLF D    E  +QAAK  GA  +EL+TG Y     + Q   + L ++  
Sbjct: 124 SQLKNAGIRVSLFID--PEEKQIQAAKDIGATVVELHTGRYADLSGSEQV--VELERIRK 179

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A+  + + L++NAGH L   N+  +  AI  +SE+++GHA  A AL  G ++A+
Sbjct: 180 AAKFGKSIGLRVNAGHGLHEGNVMPM-AAIDELSELNIGHAIVAEALFKGWQKAI 233


>gi|194099317|ref|YP_002002415.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae NCCP11945]
 gi|193934607|gb|ACF30431.1| pyridoxal phosphate biosynthetic protein [Neisseria gonorrhoeae
           NCCP11945]
          Length = 255

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 16  LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 75

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 76  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 130

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  +EL+TG Y    ++ +Q R F  ++  
Sbjct: 131 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVVELHTGAYADAQSHAEQIRQF-ERIQN 187

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 188 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 246

Query: 245 AC 246
           A 
Sbjct: 247 AM 248


>gi|33865444|ref|NP_897003.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. WH 8102]
 gi|81574817|sp|Q7U7S1|PDXJ_SYNPX RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|33632613|emb|CAE07425.1| Pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp. WH
           8102]
          Length = 249

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 131/238 (55%), Gaps = 14/238 (5%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R+ 
Sbjct: 3   SLGVNIDHIANIRQARRTVEPDPVPFAMLAELGGADGITVHLREDRRHIQDRDVQLLRQT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     ++ LN+E    +  + +    +P+ +TLVP+   ++T++ G D     + LT  
Sbjct: 63  V-----RSRLNLEMAATQEMVEIALAVEPDMVTLVPEKREEVTTEGGLDVAAQLSGLTPM 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFLNK 181
           V RL   G  +SLF D    +  L+A + +GA  +EL+TG Y   +  + P Q    L +
Sbjct: 118 VERLQQRGIPVSLFVDAETTQ--LEACRNSGAHWVELHTGTYADASWADQPGQ----LAR 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +   A  A+ + L++NAGH LT QN+   I AIP + E+++GH   A A+  G+++AV
Sbjct: 172 ITEGAATARHLGLRVNAGHGLTYQNV-EPIAAIPGMEELNIGHTIVARAVAVGLQQAV 228


>gi|84390107|ref|ZP_00991369.1| pyridoxal phosphate biosynthetic protein [Vibrio splendidus 12B01]
 gi|84376761|gb|EAP93636.1| pyridoxal phosphate biosynthetic protein [Vibrio splendidus 12B01]
          Length = 245

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/238 (32%), Positives = 125/238 (52%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ +A LRN R   +P+ VH  +IA ++GA G+T+H R D+RHI   D+    
Sbjct: 3   SILLGVNIDHIATLRNARGTKYPDPVHAAEIAERAGADGITIHLREDRRHIVDRDV---- 58

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           R++ E   +  +N+E    +  + +     PE + LVP+   +LT++ G D +     + 
Sbjct: 59  RILAETI-QTRMNLEMAVTDEMVQIALDTNPEFVCLVPEKREELTTEGGLDVVGQLEKIK 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L   G ++SLF D       + AAK  GA  IEL+TG Y        Q+   L K
Sbjct: 118 AATEKLSAAGIKVSLFID--AEREQIDAAKACGAPFIELHTGHYADAKTEEDQQD-ELKK 174

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A  A  A  + + +NAGH LT  N+   I A+P I E+++GH+    A+  G+ +AV
Sbjct: 175 IAAGASYADDLGITVNAGHGLTYHNVAP-IAALPEIYELNIGHSIMGRAVFDGLNKAV 231


>gi|26988169|ref|NP_743594.1| pyridoxine 5'-phosphate synthase [Pseudomonas putida KT2440]
 gi|38258003|sp|Q88MY2|PDXJ_PSEPK RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|24982903|gb|AAN67058.1|AE016334_7 pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas putida
           KT2440]
          Length = 246

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 122/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVVLLKDVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 69  -----QTRMNFEMGVTEEMMAFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D   +E  ++A++  GA  IEL+TG Y A    P +    L ++  
Sbjct: 124 ERLARTGAEVSLFID--ADERQIEASRRVGAPAIELHTGRY-ADAETPTEVAEELKRIVE 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGVGHGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|261855983|ref|YP_003263266.1| pyridoxal phosphate biosynthetic protein PdxJ [Halothiobacillus
           neapolitanus c2]
 gi|261836452|gb|ACX96219.1| pyridoxal phosphate biosynthetic protein PdxJ [Halothiobacillus
           neapolitanus c2]
          Length = 250

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 127/240 (52%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ VA LR  R   +P+ VH   +A QSGA  +T+H R D+RHI+  D+  +R ++
Sbjct: 12  LGLNIDHVATLRQARGTTYPDPVHAALLAEQSGADSITLHLREDRRHIQDRDVLRLRDML 71

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  +      KP    LVP+   +LT++ G D       +    
Sbjct: 72  -----QTRMNLEMAVTEEMIEFACLVKPHDCCLVPEKREELTTEGGLDVAGQIERIYSAC 126

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G R+SLF D +  +  + AA    A  IEL+TG Y    ++  Q++I LN +  
Sbjct: 127 DRLRAAGIRVSLFIDADPRQ--IDAAVACEAPVIELHTGHYADTMDDAGQKQI-LNDIIR 183

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
           +A+ A  + LQ+NAGH L   N+   I AIP I E+++GHA  A ++  G+ +AV   ++
Sbjct: 184 SARDATDVGLQVNAGHGLHYHNV-QAIAAIPQIEELNIGHAIIARSIFTGLPQAVADMKK 242


>gi|237807626|ref|YP_002892066.1| pyridoxine 5'-phosphate synthase [Tolumonas auensis DSM 9187]
 gi|237499887|gb|ACQ92480.1| pyridoxal phosphate biosynthetic protein PdxJ [Tolumonas auensis
           DSM 9187]
          Length = 243

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 85/240 (35%), Positives = 135/240 (56%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHVATLRNARGTAYPDPVFAAALAEQAGAEGITVHLREDRRHITDRDVEILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E    E  L++  R KP+ + LVP+   ++T++ G D       +   V
Sbjct: 66  -----KTRMNLEMAVTEEMLSIACRIKPQFVCLVPEKRQEVTTEGGLDVASQVERIRDAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G+++SLF D +  +  + AA  +GA  IE++TG Y A     ++++  L ++A 
Sbjct: 121 TRLAAVGTQVSLFIDADHAQ--IDAAVASGAPYIEIHTGRY-ADAETEEEQQQELVRIAE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A K  L++NAGH L  QN+   I AIP + E+++GHA    A+  G+ EAV   +R
Sbjct: 178 AAAYASKKGLKVNAGHGLHYQNV-QAIAAIPEMIELNIGHAIIGRAVFSGLPEAVAEMKR 236


>gi|308270605|emb|CBX27217.1| Pyridoxine 5'-phosphate synthase [uncultured Desulfobacterium sp.]
          Length = 240

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 131/236 (55%), Gaps = 10/236 (4%)

Query: 5   VSVNLNAVAVLRN-RRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++VN++ VA LR  R N+ +P+ V+   +A  +GA G+ VH R D+RHI+  D+  +R +
Sbjct: 4   LAVNVDHVATLRRARENVSYPDPVYAAVLAELAGADGIVVHLREDRRHIQDNDVKILRNI 63

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I     + +L +E       + +    KP+ +TLVP+   +LT++ G + L N   ++++
Sbjct: 64  I-----QTKLILEMAATSEMVEIALGIKPDVVTLVPEKRSELTTEGGLNLLVNANAVSES 118

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           VA L N G  +S+F D    +  ++ A    A  +E++TG +       QQE++ L+ + 
Sbjct: 119 VATLQNAGIPVSIFIDPEPEQ--IKLAHKINAAMVEIHTGSFVEAKTKKQQEKV-LSDIR 175

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             A LA K+ + +NAGH L  Q+I      I  ISE S+GH+  A A+  G++ AV
Sbjct: 176 SCAMLANKLKMTVNAGHGLCYQSIKAF-KGIAEISEFSIGHSIIARAVMVGMERAV 230


>gi|241760542|ref|ZP_04758635.1| pyridoxine 5'-phosphate synthase [Neisseria flavescens SK114]
 gi|241319046|gb|EER55548.1| pyridoxine 5'-phosphate synthase [Neisseria flavescens SK114]
          Length = 242

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA   GA  +T+H R D+RHI+ TD+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTIYPSPVEAALIAETHGADLITMHLREDRRHIKDTDVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L       PE + LVP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALNVMPEDVCLVPEKRQEVTTEGGLDVLAQQDKVAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +  +QAA   GA  IEL+TG Y   +++ +Q + F  ++  
Sbjct: 118 KILTDAGIRVSLFIDADNAQ--IQAAHDVGAPVIELHTGAYADAHSHAEQMKQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV
Sbjct: 175 GAHYASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAV 228


>gi|269468623|gb|EEZ80267.1| pyridoxal phosphate biosynthesis protein [uncultured SUP05 cluster
           bacterium]
          Length = 248

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 76/238 (31%), Positives = 126/238 (52%), Gaps = 10/238 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MS  + VN++ +A +R  R   +P+ +    +  QSGA  +T+H R D+RHI+  D+  +
Sbjct: 1   MSIYLGVNIDHIATIRQARGTNYPSPIEGALLCEQSGADSITLHLREDRRHIQDLDVEIL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R   D+   K  +N+E    +  +N+  R KP+   LVP+   +LT++ G D     + +
Sbjct: 61  R---DQLTTK--MNLEMAATDEMVNIASRIKPQDCCLVPEKREELTTEGGLDVASKISRM 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           T   A+L      +SLF D   ++  + AAK  GA  IEL+TG Y     + Q+      
Sbjct: 116 TDVCAKLAESKVIVSLFIDAQKDQ--IDAAKQCGAPVIELHTGHYADAMGDEQKAE--FE 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           ++   A  A  + LQ+NAGH LT++N    I  +P I E+++GH+  A A+  G++ A
Sbjct: 172 RIKAMATYAHSIGLQVNAGHGLTMENTAE-IAKLPEIVELNIGHSIIARAVFVGLENA 228


>gi|260598947|ref|YP_003211518.1| pyridoxine 5'-phosphate synthase [Cronobacter turicensis z3032]
 gi|260218124|emb|CBA32919.1| Pyridoxine 5'-phosphate synthase [Cronobacter turicensis z3032]
          Length = 245

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 123/240 (51%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R   
Sbjct: 8   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILR--- 64

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q     +N+E    E  L +    KP    LVP+   ++T++ G D       +    
Sbjct: 65  --QTLHTRMNLEMAVTEEMLAIACETKPHFCCLVPEKRQEVTTEGGLDVAGQLDKMRDAC 122

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +  + AA   GA  IE++TG Y    ++  + R  L ++A 
Sbjct: 123 QRLAAAGILVSLFIDADNAQ--IDAAVAVGAPYIEIHTGCYADAEDDATRVR-ELERIAK 179

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+KEAV   +R
Sbjct: 180 AATYAASKGLKVNAGHGLTYHNV-QAIAALPEMHELNIGHAIIGRAVMSGLKEAVSEMKR 238


>gi|58698153|ref|ZP_00373075.1| pyridoxal phosphate biosynthetic protein PdxJ [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225629918|ref|YP_002726709.1| pyridoxal phosphate biosynthetic protein [Wolbachia sp. wRi]
 gi|254781566|sp|C0R576|PDXJ_WOLWR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|58535303|gb|EAL59380.1| pyridoxal phosphate biosynthetic protein PdxJ [Wolbachia
           endosymbiont of Drosophila ananassae]
 gi|225591899|gb|ACN94918.1| pyridoxal phosphate biosynthetic protein [Wolbachia sp. wRi]
          Length = 235

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 132/239 (55%), Gaps = 11/239 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +   +IA+ +GA  +TVH R D+RHIR  D+  +++ I
Sbjct: 3   LGVNIDHVATLRNARGTSYPDPLKAAEIAIDAGADFITVHLREDRRHIRDEDVFNLKKSI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                  ELN+E    E  L + ++ KP  I++VP+   +LT++ G D +   + L+  +
Sbjct: 63  S-----TELNLEIAATEEMLEIAKKVKPYSISIVPEKREELTTEGGLDIVNMHSKLSSII 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             +H+   ++SLF D N ++        T  D IE++TG Y  C +NP ++++ L  +  
Sbjct: 118 EEMHSSSIKVSLFIDPNIDQLKYLEKLGTKPDIIEIHTGDY--C-DNPSEKKLQL--ITN 172

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A+   K+ ++ +AGH +T ++   +   IP+IS +++GH   + A+  G+   V   +
Sbjct: 173 AAEYVNKLGIECHAGHGITYEHAKKM-TRIPHISALNIGHYLISEAVFYGLHSVVKTMK 230


>gi|148549491|ref|YP_001269593.1| pyridoxine 5'-phosphate synthase [Pseudomonas putida F1]
 gi|166219110|sp|A5W8E9|PDXJ_PSEP1 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|148513549|gb|ABQ80409.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas putida
           F1]
          Length = 240

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 122/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 3   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVVLLKDVL 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 63  -----QTRMNFEMGVTEEMMAFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D   +E  ++A++  GA  IEL+TG Y A    P +    L ++  
Sbjct: 118 ERLARTGAEVSLFID--ADERQIEASRRVGAPAIELHTGRY-ADAETPTEVAEELQRIVE 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 175 GVAFGVGHGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 228


>gi|297250773|ref|ZP_06865025.2| pyridoxine 5'-phosphate synthase [Neisseria polysaccharea ATCC
           43768]
 gi|296837988|gb|EFH21926.1| pyridoxine 5'-phosphate synthase [Neisseria polysaccharea ATCC
           43768]
          Length = 255

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 16  LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 75

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  P+ + +VP+   ++T++ G D L  Q  + +  
Sbjct: 76  -----RTRLNLEMALTEEMLENALKVMPQDVCIVPEKRQEITTEGGLDVLAQQDKIAEFT 130

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA+  GA  IEL+TG Y    ++ +Q + F  +L  
Sbjct: 131 KILTDAGIRVSLFID--ADDRQIQAARDVGAPVIELHTGAYADARSHAEQLKQF-ERLQN 187

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV
Sbjct: 188 GAHFASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAV 241


>gi|90580328|ref|ZP_01236135.1| pyridoxal phosphate biosynthetic protein [Vibrio angustum S14]
 gi|90438630|gb|EAS63814.1| pyridoxal phosphate biosynthetic protein [Vibrio angustum S14]
          Length = 243

 Score =  124 bits (311), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 125/239 (52%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATLRNARGTRYPDPVHAAEVAERAGADGITIHLREDRRHINDRDVRILRETI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    KPE + LVP+   +LT++ G D       +    
Sbjct: 66  -----QTRMNLEMAVTDEMVAIALDVKPEYVCLVPEKREELTTEGGLDVAGQLEKVKAAT 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G ++SLF D   +   + AA   GA  IEL+TG Y        Q    L K+A 
Sbjct: 121 EKLTAAGIKVSLFID--ADRAQIDAAHACGAPFIELHTGQYAEATTEEAQSD-ELKKVAA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A  A  + +++NAGH LT  N+   I A+P + E+++GH+    A+  G++++V   R
Sbjct: 178 GASYAHNLGIKVNAGHGLTYHNVKP-IAALPELYELNIGHSIMGRAMFDGLEKSVADMR 235


>gi|330446944|ref|ZP_08310595.1| pyridoxal phosphate biosynthetic protein PdxJ [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
 gi|328491135|dbj|GAA05092.1| pyridoxal phosphate biosynthetic protein PdxJ [Photobacterium
           leiognathi subsp. mandapamensis svers.1.1.]
          Length = 243

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 125/239 (52%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ VH  ++A ++GA G+T+H R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATLRNARGTRYPDPVHAAEVAERAGADGITIHLREDRRHINDRDVRILRETI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    KPE + LVP+   +LT++ G D       +    
Sbjct: 66  -----QTRMNLEMAVTDEMIAIALEVKPEYVCLVPEKREELTTEGGLDVAGQLEKVKAAT 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G ++SLF D   +   + AA   GA  IEL+TG Y        Q    L K++ 
Sbjct: 121 EKLTAAGIKVSLFID--ADRAQIDAAHACGAPFIELHTGQYAEATTEEAQLD-ELKKISA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A  A  + +++NAGH LT  N+   I A+P + E+++GH+    A+  G+++AV   R
Sbjct: 178 GASYAHDLGIKVNAGHGLTYHNVKP-IAALPELYELNIGHSIMGRAMFDGLEKAVADMR 235


>gi|225075847|ref|ZP_03719046.1| hypothetical protein NEIFLAOT_00863 [Neisseria flavescens
           NRL30031/H210]
 gi|224952793|gb|EEG34002.1| hypothetical protein NEIFLAOT_00863 [Neisseria flavescens
           NRL30031/H210]
          Length = 242

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTIYPSPVEAALIAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L       PE + LVP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALNVMPEDVCLVPEKRQEVTTEGGLDVLAQQDKVAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +  +QAA   GA  IEL+TG Y   +++ +Q + F  ++  
Sbjct: 118 KILTDAGIRVSLFIDADNAQ--IQAAYDVGAPVIELHTGAYADAHSHAEQMKQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHYASDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|42519977|ref|NP_965892.1| pyridoxal phosphate biosynthetic protein PdxJ [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|225677272|ref|ZP_03788255.1| pyridoxal phosphate biosynthetic protein [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
 gi|91207575|sp|Q3V8B3|PDXJ_WOLPM RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|42409714|gb|AAS13826.1| pyridoxal phosphate biosynthetic protein PdxJ [Wolbachia
           endosymbiont of Drosophila melanogaster]
 gi|225590692|gb|EEH11936.1| pyridoxal phosphate biosynthetic protein [Wolbachia endosymbiont of
           Muscidifurax uniraptor]
          Length = 235

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 132/239 (55%), Gaps = 11/239 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +   +IA+ +GA  +TVH R D+RHIR  D+  +++ I
Sbjct: 3   LGVNIDHVATLRNARGTSYPDPLKAAEIAIDAGADFITVHLREDRRHIRDEDVFNLKKSI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                  ELN+E    E  L + ++ KP  I++VP+   +LT++ G D +   + L+  +
Sbjct: 63  S-----TELNLEIAATEEMLEIAKKVKPYSISIVPEKREELTTEGGLDIVNMHSKLSSII 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             +H+   ++SLF D N ++        T  D IE++TG Y  C +NP ++++ L  +  
Sbjct: 118 EEMHSSSIKVSLFIDPNIDQLKYLEKLGTKPDIIEIHTGDY--C-DNPSEKKLQL--ITN 172

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A+   K+ ++ +AGH +T ++   +   IP+IS +++GH   + A+  G+   V   +
Sbjct: 173 AAEYVNKLGIECHAGHGITYKHAKKM-TRIPHISALNIGHYLISEAVFYGLHSVVKTMK 230


>gi|313500336|gb|ADR61702.1| PdxJ [Pseudomonas putida BIRD-1]
          Length = 246

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVVLLKDVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 69  -----QTRMNFEMGVTEEMMAFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D   +E  ++A++  GA  IEL+TG Y A    P      L ++  
Sbjct: 124 ERLARTGAEVSLFID--ADERQIEASRRVGAPAIELHTGRY-ADAETPTDVAEELKRIVE 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 181 GVAFGVGQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 234


>gi|68171139|ref|ZP_00544548.1| Pyridoxal phosphate biosynthetic protein PdxJ [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88657971|ref|YP_507603.1| pyridoxal phosphate biosynthetic protein PdxJ [Ehrlichia
           chaffeensis str. Arkansas]
 gi|123493052|sp|Q2GG30|PDXJ_EHRCR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|67999464|gb|EAM86104.1| Pyridoxal phosphate biosynthetic protein PdxJ [Ehrlichia
           chaffeensis str. Sapulpa]
 gi|88599428|gb|ABD44897.1| pyridoxal phosphate biosynthesis protein PdxJ [Ehrlichia
           chaffeensis str. Arkansas]
          Length = 239

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 136/243 (55%), Gaps = 13/243 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
            ++ VN++ VA LRN RN+ +P++V +  IA+ +GA  +TVH R D+RHI+  D+  ++ 
Sbjct: 4   VALGVNIDHVATLRNARNVDYPDIVEVANIAVSNGADFITVHLREDRRHIKDDDVFRLKN 63

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +     K  LN+E  P +  L++  + +P+ + LVP+   +LT++ G D  +  + L  
Sbjct: 64  SL-----KVPLNLEIAPTDEMLSIAIKVRPKCVCLVPEKRQELTTEGGLDVKRAFSYLIS 118

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            + +LH     ++LF + + ++  +  AK   AD +EL+TG Y  C N  Q E   L+++
Sbjct: 119 FIEKLHTYNIDVTLFIEPDVDQ--IDQAKKLSADNVELHTGKY--CNNTTQSE---LSQV 171

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+   + ++  +AGH L  Q+   +I  +PYIS +++GH     ++  G+  +V   
Sbjct: 172 IKAAEYCYQRNIGCHAGHGLNYQSAA-IIAKVPYISALNIGHFLICESVLHGIGTSVHKM 230

Query: 243 RRA 245
           ++A
Sbjct: 231 KKA 233


>gi|121635409|ref|YP_975654.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis FAM18]
 gi|12644548|sp|Q9RML6|PDXJ_NEIMC RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|166219099|sp|A1KVH8|PDXJ_NEIMF RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|6449093|gb|AAF08822.1|AF194079_9 PdxJ [Neisseria meningitidis]
 gi|120867115|emb|CAM10882.1| pyridoxal phophate biosynthetic protein [Neisseria meningitidis
           FAM18]
 gi|254671053|emb|CBA07917.1| pyridoxine biosynthesis [Neisseria meningitidis alpha153]
 gi|319411026|emb|CBY91425.1| pyridoxal phosphate biosynthetic protein PdxJ (PNP synthase)
           [Neisseria meningitidis WUE 2594]
 gi|325128808|gb|EGC51668.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis N1568]
 gi|325132872|gb|EGC55550.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M6190]
 gi|325138817|gb|EGC61368.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis ES14902]
 gi|325202742|gb|ADY98196.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M01-240149]
 gi|325203554|gb|ADY99007.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis M01-240355]
 gi|325208738|gb|ADZ04190.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           meningitidis NZ-05/33]
          Length = 242

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/242 (32%), Positives = 126/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  +    
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAGFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  +EL+TG Y    ++ +Q + F  +L  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVVELHTGAYADARSHAEQLKQF-ERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|109900010|ref|YP_663265.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudoalteromonas
           atlantica T6c]
 gi|109702291|gb|ABG42211.1| pyridoxine 5'-phosphate synthase [Pseudoalteromonas atlantica T6c]
          Length = 245

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 126/239 (52%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ VH   IA ++GA G+T+H R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTSYPDPVHAADIAERAGADGITIHLREDRRHIMDRDVALLRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           + +     LN+E    +  + +    +PE   LVP+   +LT++ G D + NQ  +    
Sbjct: 66  NTR-----LNLEMAVTDEMVEIALNTQPEFCCLVPEKREELTTEGGLDVVGNQQKIADAC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L + G  +SLF D +  +  + AA    A  IE++TG Y    N  +QE   L KL  
Sbjct: 121 KQLSDAGILVSLFIDADFAQ--IDAAVACNAPYIEIHTGQYAEAKNEAEQEA-ELAKLVA 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             + A    L++NAGH L   N+   I AI  I E+++GHA  A A   G+ +AV   R
Sbjct: 178 GIEYADAKGLKVNAGHGLHYHNVKP-IAAIKQIIELNIGHAIIARAAFDGLDKAVSDMR 235


>gi|40062548|gb|AAR37493.1| pyridoxal phosphate biosynthetic protein PdxJ [uncultured marine
           bacterium 106]
          Length = 241

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 71/240 (29%), Positives = 132/240 (55%), Gaps = 9/240 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ +N++ VA +R  R +  P+ V    +   +GA G+T+H R D+RHI   D+  +R  
Sbjct: 3   ALHINIDHVATVRQARQISEPDPVTAAGLVELAGADGITIHLREDRRHIIDRDVRILRET 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I     +  +N+E        ++    +P+ +TLVP+   ++T++ G D      ++ K 
Sbjct: 63  I-----QTRMNLEMAATAEMFSIALDIRPDIVTLVPEKREEVTTEGGLDIAGAAEIMHKG 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +A+L   G R+SLF D +  +  ++A++  GA+ +EL+TG Y    N+ + +R +  +L 
Sbjct: 118 IAQLRGAGIRVSLFIDPDAEQ--IKASQKAGAEDVELHTGCYANAENSEELDREY-QRLV 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A+LA +  LQ+NAGH L   N    I  +P++ E+++GH+  + A+  G+ +AV   R
Sbjct: 175 SAAELAHQEKLQVNAGHGLNYINTQR-ICGLPHLRELNIGHSIVSRAIFVGISQAVQEMR 233


>gi|148239707|ref|YP_001225094.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp. WH
           7803]
 gi|166219115|sp|A5GLI2|PDXJ_SYNPW RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|147848246|emb|CAK23797.1| Pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp. WH
           7803]
          Length = 247

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 128/236 (54%), Gaps = 10/236 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R  
Sbjct: 3   SLGVNIDHIANVRQARRTVEPDPVPMALLAELGGADGITVHLREDRRHIQDRDVDLLR-- 60

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              Q  ++ LN+E    E  + +  R +P+ +TLVP+   ++T++ G D    +  LT  
Sbjct: 61  ---QTVRSRLNLEMAATEDMVLIALRVQPDMVTLVPERREEVTTEGGLDVSSQRVDLTSK 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           ++RL + G  +SLF D    +  L+A +   A  +EL+TG Y       Q     L +L 
Sbjct: 118 ISRLQDAGIPVSLFVDPERGQ--LEACRDCRARWVELHTGTYAEAKWTDQPSE--LARLT 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               LA+ M L++NAGH LT QN+   + AI  + E+++GH   A A+  G+++AV
Sbjct: 174 EATALARAMGLRVNAGHGLTYQNVEP-VAAIEGMEELNIGHTIVARAVAVGLQQAV 228


>gi|157371901|ref|YP_001479890.1| pyridoxine 5'-phosphate synthase [Serratia proteamaculans 568]
 gi|157323665|gb|ABV42762.1| pyridoxal phosphate biosynthetic protein PdxJ [Serratia
           proteamaculans 568]
          Length = 243

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 125/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  L++    KP    LVP+   ++T++ G D    Q  +   V
Sbjct: 66  -----QTRMNLEMAVTDEMLDIAIELKPHFCCLVPEKREEVTTEGGLDVAGQQDKMAVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +SLF D +  +  + AA   GA  IE++TG Y A        +  L ++A+
Sbjct: 121 EQLAKAGILVSLFIDPDHRQ--IDAAVAVGAPYIEIHTGAY-AEAEGELAVKAELRRIAV 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A +  L++NAGH LT  N+   I A+P + E+++GHA    A+ CG+  AV
Sbjct: 178 AATYAAEKGLKVNAGHGLTYHNV-QPIAALPEMHELNIGHAIIGQAVMCGLPAAV 231


>gi|261391961|emb|CAX49425.1| pyridoxal phosphate biosynthetic protein PdxJ (PNP synthase)
           [Neisseria meningitidis 8013]
          Length = 242

 Score =  124 bits (310), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/242 (32%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  +EL+TG Y    ++ +Q + F  +L  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVVELHTGAYADARSHAEQLKQF-ERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|146281618|ref|YP_001171771.1| pyridoxine 5'-phosphate synthase [Pseudomonas stutzeri A1501]
 gi|166219111|sp|A4VIX8|PDXJ_PSEU5 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|145569823|gb|ABP78929.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas stutzeri
           A1501]
 gi|327479797|gb|AEA83107.1| pyridoxine 5'-phosphate synthase [Pseudomonas stutzeri DSM 4166]
          Length = 248

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 125/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 9   LGVNVDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LM 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  L   E+ +PE + LVP+   +LT++ G D    +A + + V
Sbjct: 64  MKDALQTRMNFEMGVTEAMLAFAEQLRPEHVCLVPETRQELTTEGGLDVAGQEARIREAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D +  +  ++AA   GA  IEL+TG Y   ++  ++    L ++  
Sbjct: 124 ERLRGCGAEVSLFIDADPRQ--IEAAARVGAPAIELHTGRYADAHSVAERA-CELARIRD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             ++     L +NAGH L   N    I AI  ++E+++GHA  A AL  G K+AV
Sbjct: 181 GVEVGLSHGLIVNAGHGLHYHN-AEAIAAIRGVNELNIGHAIVAHALFVGFKQAV 234


>gi|193213343|ref|YP_001999296.1| pyridoxine 5'-phosphate synthase [Chlorobaculum parvum NCIB 8327]
 gi|238692660|sp|B3QQ93|PDXJ_CHLP8 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|193086820|gb|ACF12096.1| pyridoxal phosphate biosynthetic protein PdxJ [Chlorobaculum parvum
           NCIB 8327]
          Length = 237

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 130/235 (55%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           ++VN++ +A LRN RN   P+ V    +A QSGA+G+  H R D+RHI+  DL  +R  I
Sbjct: 3   LAVNIDHIATLRNARNEGHPDPVEAAILAEQSGAAGIVCHLREDRRHIKDDDLERLREAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D +     L++E        ++  R KPE +TLVP+   +LT++ G+    +   LT+ +
Sbjct: 63  DTK-----LDLEMAMTSEMQSIALRVKPELVTLVPEKREELTTEGGFAIHTHFKRLTEFI 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G  +S+F +   +  +++ A   GA+ +EL+TGPY     + +Q    L ++  
Sbjct: 118 KPLRDHGVEVSIFIEPEDD--AIELAAEAGANLVELHTGPYSLATGD-KQIAYELERIRT 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A++A++  L + AGH L++ NI      +  I E+S+GHA  A A+  G+  A+
Sbjct: 175 AARIAREAGLAVVAGHGLSVHNIAPF-RELHDIEEVSIGHALIARAVLVGLPVAI 228


>gi|94676621|ref|YP_588729.1| pyridoxal phosphate biosynthetic protein PdxJ [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
 gi|94219771|gb|ABF13930.1| pyridoxal phosphate biosynthetic protein PdxJ [Baumannia
           cicadellinicola str. Hc (Homalodisca coagulata)]
          Length = 243

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 127/236 (53%), Gaps = 9/236 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           ++VN++ +A LRN R   WP+ V    IA  +GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LNVNIDHIATLRNARGTTWPDPVQAAFIAEDAGADGITVHLREDRRHINDRDVTMLRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E    +  + +    +P+   LVP+   +LT++ G D  Q +  ++  +
Sbjct: 66  -----KTRMNLEMAITDDMIAIACSVRPDLCCLVPEKRQELTTEGGLDVAQQKKKISNAI 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G  +SLF D   ++  ++AA   G+  IE++TG Y    NN +     L ++  
Sbjct: 121 YLLSEAGIMVSLFID--ADKQQIEAAAEIGSPYIEIHTGCYANARNNTECIA-ELERIRQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            A  A  + L++NAGH LT  N+ + I  + +I E+++GH+  + A+  G+ +A+ 
Sbjct: 178 AADYATSLGLKVNAGHGLTYHNVQD-IAMLSFIHELNIGHSIISRAIISGLNQAII 232


>gi|197285740|ref|YP_002151612.1| pyridoxine 5'-phosphate synthase [Proteus mirabilis HI4320]
 gi|227356254|ref|ZP_03840643.1| pyridoxal phosphate biosynthetic protein [Proteus mirabilis ATCC
           29906]
 gi|194683227|emb|CAR43908.1| pyridoxal phosphate biosynthetic protein [Proteus mirabilis HI4320]
 gi|227163718|gb|EEI48634.1| pyridoxal phosphate biosynthetic protein [Proteus mirabilis ATCC
           29906]
          Length = 243

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 127/240 (52%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+T+H R D+RHI   DL     ++
Sbjct: 6   LGVNIDHIATLRNARGTTYPDPVQAAFIAEQAGADGITIHLREDRRHITDRDL-----ML 60

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  LN+E    E  + +  + +P+   LVP+   ++T++ G D + N+  +   +
Sbjct: 61  ISQTVQTRLNLEMAVTEEMIEIACQTQPDFCCLVPEKRQEVTTEGGLDVVGNEEKVADAI 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G ++SLF D +  +  + AA   GA  IE++TG Y    +   QE+ F+ ++  
Sbjct: 121 KRLSLAGIKVSLFIDPDHEQ--INAADRVGAPFIEIHTGAYADAEDEQAQEKEFV-RIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
               A    L++NAGH L   N+   I A+P + E+++GHA    A+  G+  AV   +R
Sbjct: 178 AVTYAASKGLKVNAGHGLHYHNVQR-IAALPELYELNIGHAIIGRAVFSGLAPAVEEMKR 236


>gi|292492475|ref|YP_003527914.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus
           halophilus Nc4]
 gi|291581070|gb|ADE15527.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosococcus
           halophilus Nc4]
          Length = 246

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 131/240 (54%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ +     A Q+GA G+T+H R D+RHI+  D+  +  ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPIQAAIEAEQAGAEGITLHLREDRRHIQERDVALLSNIL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                 +++N+E    E  L + E+Y P+   LVP+   +LT++ G +       +T+  
Sbjct: 69  -----LSKMNLEMAVTEEMLAIAEKYGPKDCCLVPERREELTTEGGLEVAGQLGRITEAC 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL   G R+SLF D   + + ++AA    A  IE++TG +    +   +++ F  ++  
Sbjct: 124 ARLKEAGIRVSLFID--ADPYQVEAAAQAAAPVIEIHTGHFADAEDERSRQKEF-QRIVE 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             +  ++  LQ+NAGH L  QN+   I AIP I E+++GHA  A AL  G++ AV   +R
Sbjct: 181 AVRQGREAGLQVNAGHGLNYQNVAA-IAAIPEIVELNIGHAIIARALFTGMQAAVREMKR 239


>gi|104783260|ref|YP_609758.1| pyridoxine 5'-phosphate synthase [Pseudomonas entomophila L48]
 gi|122402121|sp|Q1I5W1|PDXJ_PSEE4 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|95112247|emb|CAK16974.1| Pyridoxine 5'-phosphate (PNP) synthase; homooctomer [Pseudomonas
           entomophila L48]
          Length = 240

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     L+
Sbjct: 3   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV-----LL 57

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N E    E  +   E+ +P  I LVP+   +LT++ G D    +A +   V
Sbjct: 58  LKDVLQTRMNFEMGVTEEMMLFAEKIRPAHICLVPETRQELTTEGGLDVAGQEARIKAAV 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G+ +SLF D   +E  ++A++  GA  IEL+TG Y A    P      L ++  
Sbjct: 118 ERLSRTGAEVSLFID--ADERQIEASRRVGAPAIELHTGRY-ADAETPTDVAEELKRIVD 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N+   + AI  I+E+++GHA  A AL  G K AV
Sbjct: 175 GVAFGVGQGLIVNAGHGLHYHNV-EAVAAIKGINELNIGHALVAHALFVGFKAAV 228


>gi|196230034|ref|ZP_03128897.1| pyridoxal phosphate biosynthetic protein PdxJ [Chthoniobacter
           flavus Ellin428]
 gi|196225631|gb|EDY20138.1| pyridoxal phosphate biosynthetic protein PdxJ [Chthoniobacter
           flavus Ellin428]
          Length = 244

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 79/251 (31%), Positives = 134/251 (53%), Gaps = 17/251 (6%)

Query: 4   SVSVNLNAVAVLRNRR-------NLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTD 56
            + VN++ VA LR  R       +   P+L+       + GA G+T+H R D+RHI+  D
Sbjct: 2   KLGVNIDHVATLRQARYAFSLDAHKVEPDLLAAASACERVGAHGITIHLRADRRHIQDRD 61

Query: 57  LPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQN 116
           +  +R  I+ +     LN+E       L++  R  PE++ LVP++  ++T++ G D    
Sbjct: 62  VVRLRASINTK-----LNLEMGNTPEILDVALRVLPEEVCLVPENRAEVTTEGGLDAAGQ 116

Query: 117 QALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER 176
              LT TV RL   G R+SLF + +  +  LQAA+  GA+ +EL+TG +       +   
Sbjct: 117 IKFLTPTVDRLQKAGIRVSLFIEPDPAQ--LQAARQLGAEMVELHTGAFANATGEARHRE 174

Query: 177 IFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVK 236
           +   +L   A+ A ++ +Q+NAGH +  QNI  LI  IP+++E+++GH+  + A+  G++
Sbjct: 175 V--ERLITAAEQAHQLGIQVNAGHGINYQNIA-LIRTIPHLAELNIGHSIISRAIFVGLE 231

Query: 237 EAVFCFRRACG 247
            A      A G
Sbjct: 232 RATAEMLAAMG 242


>gi|254431339|ref|ZP_05045042.1| pyridoxal phosphate biosynthetic protein PdxJ [Cyanobium sp. PCC
           7001]
 gi|197625792|gb|EDY38351.1| pyridoxal phosphate biosynthetic protein PdxJ [Cyanobium sp. PCC
           7001]
          Length = 249

 Score =  123 bits (309), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 127/236 (53%), Gaps = 10/236 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R  
Sbjct: 3   SLGVNIDHIANVRQARRTVEPDPVTYALLAELGGADGITVHLREDRRHIQERDVELLR-- 60

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              Q  ++ LN+E         +  R +P+ +TLVP+   ++T++ G D       LT  
Sbjct: 61  ---QTVRSRLNLEMAATAEMEAIALRLRPDMVTLVPEKREEVTTEGGLDVAAQTGPLTAM 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL   G  +SLF D    +  L+A +  GA  +EL+TG Y     + Q++   L +L 
Sbjct: 118 VTRLQQAGIGVSLFVDPAAAQ--LEACRAIGARWVELHTGAYAEA--DWQRQSDELARLT 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             + +A+ + L++NAGH LT QN+   + AI  + E+++GH   A AL  G+++AV
Sbjct: 174 EGSFIARSLGLRVNAGHGLTYQNVEP-VAAIEGMEELNIGHTIVARALAVGLEQAV 228


>gi|240124108|ref|ZP_04737064.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID332]
 gi|240126275|ref|ZP_04739161.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae SK-92-679]
 gi|268682732|ref|ZP_06149594.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID332]
 gi|268684858|ref|ZP_06151720.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae SK-92-679]
 gi|268623016|gb|EEZ55416.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae PID332]
 gi|268625142|gb|EEZ57542.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae SK-92-679]
          Length = 242

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/242 (31%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  +EL+TG Y    ++ +Q + F  +L  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVVELHTGAYADAQSHAEQLKQF-ERLQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  + AL  G+ EAV   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLISQALFLGLPEAVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|189485214|ref|YP_001956155.1| pyridoxine 5'-phosphate synthase [uncultured Termite group 1
           bacterium phylotype Rs-D17]
 gi|170287173|dbj|BAG13694.1| pyridoxine 5'-phosphate synthase [uncultured Termite group 1
           bacterium phylotype Rs-D17]
          Length = 244

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 73/241 (30%), Positives = 133/241 (55%), Gaps = 12/241 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A +R  R   +P+++    I  +SGA G+TVH R D+RHI+  D+ ++R+
Sbjct: 2   VKLGVNIDHIATIRQARKEDFPSVIKAAAICEKSGADGITVHLREDRRHIQDEDVYDLRK 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +     K +LN+E   +E  + +    KP+ + +VP+   +LT++ G D   +++ L  
Sbjct: 62  SL-----KIKLNLEMAASEEIVKIALDVKPDFVCMVPEKRQELTTEGGLDVKAHKSKLAS 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYN----NPQQERIF 178
            VARL   G  +S+F D N  E  L  +++  AD IEL+TG Y   +     +  + +  
Sbjct: 117 IVARLQKAGIIVSVFIDAN-TEQVLACSEIK-ADSIELHTGKYAKFFKENGTDSSEFKEE 174

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           + +L+  ++ A K  L +NAGH L   N+  + N IP ++E ++G +  A ++  G++ A
Sbjct: 175 MERLSEASRKAVKKGLILNAGHGLDYDNVERICN-IPGMNEFNIGFSIIAESVFAGLETA 233

Query: 239 V 239
           V
Sbjct: 234 V 234


>gi|242240200|ref|YP_002988381.1| pyridoxal phosphate biosynthetic protein PdxJ [Dickeya dadantii
           Ech703]
 gi|242132257|gb|ACS86559.1| pyridoxal phosphate biosynthetic protein PdxJ [Dickeya dadantii
           Ech703]
          Length = 243

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 125/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHVATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRLLRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  L +    KP    LVP+   ++T++ G D       +  +V
Sbjct: 66  -----QTRMNLEMAVTDEMLAIACELKPHFCCLVPEKRQEVTTEGGLDVAGQLERMKISV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL + G ++SLF D N  +  + AA   GA  IE++TG Y    +   ++  F  ++  
Sbjct: 121 ARLRDAGIQVSLFIDANHAQ--IDAAAACGAPYIEIHTGAYADAVDEHTRQLEF-ARIRE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + + +NAGH LT  N+   I A+P + E+++GHA    A+  G+ +AV
Sbjct: 178 AASYAAGLGINVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGRAVMSGLADAV 231


>gi|32468418|emb|CAD88339.1| GdpxJ protein [Porphyromonas gingivalis]
          Length = 126

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 85/132 (64%), Gaps = 7/132 (5%)

Query: 40  GLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVP 99
           G+TVHPRPD+RHIR +D+ ++++ +  +F     NIEG P+E F+ L E  +PEQ+T+VP
Sbjct: 1   GITVHPRPDERHIRRSDVYDLKKALTTEF-----NIEGNPDERFIRLIEEIRPEQVTMVP 55

Query: 100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE 159
           D P  LTS+ GWD  +N   L + V R H  G R S+F D + +  ++  A  TG D IE
Sbjct: 56  DAPDVLTSNAGWDVARNYDHLCRLVERFHAWGIRTSIFIDTDLD--NISWAAKTGTDRIE 113

Query: 160 LYTGPYGACYNN 171
           LYT PY A Y+N
Sbjct: 114 LYTEPYAAAYHN 125


>gi|71064912|ref|YP_263639.1| pyridoxine 5'-phosphate synthase [Psychrobacter arcticus 273-4]
 gi|91207561|sp|Q4FUV3|PDXJ_PSYA2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|71037897|gb|AAZ18205.1| putative pyridoxal phosphate biosynthetic protein [Psychrobacter
           arcticus 273-4]
          Length = 264

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 80/245 (32%), Positives = 130/245 (53%), Gaps = 12/245 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R + +P+ +    +  ++GA G+T+H R D+RHI+  D+ E+   +
Sbjct: 25  LGVNVDHVATLRQARGVSYPSPLAAALLCEKAGADGITIHLREDRRHIQDADVYEMAGQL 84

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +     +N+E       L +  R KP  + LVP+   +LT++ G D      LL   V
Sbjct: 85  TTR-----MNLEMAATTEMLEIACRVKPYWVCLVPEKRAELTTEGGLDVAGQLDLLKDYV 139

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFLNKL 182
           A+L   G ++SLF D    +  + AA   GAD IEL+TG Y       + ++  + L ++
Sbjct: 140 AKLQAAGIKVSLFID--PEDKQINAAVTCGADAIELHTGSYAEAGLAGDIEKGSVELERI 197

Query: 183 AITAQLAQKMD--LQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
                 A+++D  L +NAGH LT  N+ N I  I  I E+++GHA  A AL  G+++AV 
Sbjct: 198 KTAVITAKRIDSKLLVNAGHGLTHDNV-NAIAQIDGIYELNIGHALIADALFVGIEQAVI 256

Query: 241 CFRRA 245
             + A
Sbjct: 257 MMKIA 261


>gi|194477271|ref|YP_002049450.1| pyridoxal phosphate biosynthetic protein [Paulinella chromatophora]
 gi|171192278|gb|ACB43240.1| pyridoxal phosphate biosynthetic protein [Paulinella chromatophora]
          Length = 247

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 132/237 (55%), Gaps = 10/237 (4%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ +A +R  R+   P+ V I  +A   GA  +TVH R D+RHI+  D+  +R 
Sbjct: 2   VGLGVNIDHIANVRQARSTLEPDPVPISLLAEIGGADTITVHLREDRRHIQDRDVALLRA 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           +I     ++ LN+E       +++  + KP+ +T VP+   ++T++ G D +  +  L K
Sbjct: 62  VI-----RSRLNLEMAATNEMIDIALQIKPDMVTFVPERREEITTEGGLDVVSQKLALCK 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V  LH+ G  +S F D    +  L+  K+ GA  +EL+TG Y       +Q+ + L +L
Sbjct: 117 AVEILHSKGIPVSFFVDPVIQQ--LETCKMIGAHWVELHTGTYAEA--GSKQQALELARL 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           + +  +A+++ L++NAGH L  QN+   +  I  + E+++GH+  A AL  G++EAV
Sbjct: 173 SKSTAIARQLGLRVNAGHGLNYQNVEP-VAIIKGMEELNIGHSIVARALVVGIEEAV 228


>gi|262375522|ref|ZP_06068755.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter
           lwoffii SH145]
 gi|262309776|gb|EEY90906.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter
           lwoffii SH145]
          Length = 241

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 128/239 (53%), Gaps = 9/239 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V+   I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTTYPDPVNAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R ++     K  +N+E    +  +   +  KP+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RPVL-----KTRMNLELAITDEMIAFAKEIKPQHVCFVPEKRQEVTTEGGLDVVGNFDAV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +  + AA   GA  IE++TG Y A    P+ ++  L 
Sbjct: 116 KAATQELAAIGCDVSLFIDADFAQ--IDAAVACGAPTIEIHTGAY-ADAETPEAQQAELE 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           ++   A+ A    L +NAGH L + N+   I AIP I E+++GH+  A A+  G+ +AV
Sbjct: 173 RIIKGAEYAVSKGLVVNAGHGLNLDNV-TPIAAIPQIHELNIGHSLIADAVFVGLAQAV 230


>gi|288958020|ref|YP_003448361.1| pyridoxine 5-phosphate synthase [Azospirillum sp. B510]
 gi|288910328|dbj|BAI71817.1| pyridoxine 5-phosphate synthase [Azospirillum sp. B510]
          Length = 258

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 79/244 (32%), Positives = 126/244 (51%), Gaps = 11/244 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R    P+ V   ++A+++GA G+T H R D+RHI   D+  +   I
Sbjct: 7   LGVNIDHVATVRNARGGAHPDPVRAARLAIEAGADGITAHLREDRRHIVDRDIERLMAEI 66

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D       LN E    +  L +  R+KP    LVP+   ++T++ G D +     L + V
Sbjct: 67  DRP-----LNFEMAATDEMLAIALRHKPHAACLVPEKRTEVTTEGGLDVVGQYDQLVRRV 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ---QERIFLNK 181
             L   G R+SLF D    +  L AAK  GA  +EL+TG Y   + NPQ   +    L +
Sbjct: 122 GDLGAAGIRVSLFIDPEPAQ--LDAAKRLGAPVVELHTGAYCDAHTNPQGAAEREAELAR 179

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A  A+ + L+ +AGH L+  ++   + AIP I E+++GH     A+  G+  A+  
Sbjct: 180 IVRAAAHAEAIGLECHAGHGLSYDSV-GPVAAIPTIVELNIGHFLIGEAIFVGLTNAIAR 238

Query: 242 FRRA 245
            R+A
Sbjct: 239 MRKA 242


>gi|212710659|ref|ZP_03318787.1| hypothetical protein PROVALCAL_01725 [Providencia alcalifaciens DSM
           30120]
 gi|212686740|gb|EEB46268.1| hypothetical protein PROVALCAL_01725 [Providencia alcalifaciens DSM
           30120]
          Length = 243

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 124/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+T+H R D+RHI   D+  + + I
Sbjct: 6   LGVNIDHIATVRNARGTQYPDPVQAAFVAEQAGADGITIHLREDRRHITDRDVELLNKTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  +++  R KP    LVP+   ++T++ G D    +  +   V
Sbjct: 66  -----QTRMNLEMAVTEEMIDIACRIKPTYCCLVPEKREEVTTEGGLDVAGQKQKVAFAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL + G  +SLF D +  +  + AA+  GA  IE++TG Y       +QE  F  ++  
Sbjct: 121 KRLTDAGILVSLFIDADHKQ--IDAAQECGAPFIEIHTGAYADAKTEQEQELEF-RRIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               A    +++NAGH LT  N+   I A+P I E+++GHA    AL  G+ +AV
Sbjct: 178 GVSYAAGKGIKVNAGHGLTYHNVQR-IAALPEIYELNIGHAIIGRALFSGLSQAV 231


>gi|257453599|ref|ZP_05618889.1| pyridoxine 5'-phosphate synthase [Enhydrobacter aerosaccus SK60]
 gi|257449057|gb|EEV24010.1| pyridoxine 5'-phosphate synthase [Enhydrobacter aerosaccus SK60]
          Length = 249

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 129/245 (52%), Gaps = 12/245 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R + +P+ V    I  Q+GA G+T+H R D+RHI+  D+  + ++I
Sbjct: 8   LGVNIDHIATLRQARGVAYPDPVAGALICEQAGADGITLHLREDRRHIQDDDVYRLAKVI 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   +N+E    +  + +    KP  +  VP+   +LT++ G D + NQ  +   +
Sbjct: 68  -----TTRMNLEMAVTDEMVAIACDVKPAWVCFVPEKRQELTTEGGLDVIGNQDKIANAI 122

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGA-CYNNPQ---QERIFLN 180
            +LH +G+++SLF D    +  +  +   GAD IEL+TG Y   C  + Q      I   
Sbjct: 123 QQLHQVGTQVSLFIDPELAQ--IDKSIALGADAIELHTGAYADYCLQHDQVKISHEITRI 180

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           K A+T     K  L +NAGH LT  N+  + + I  I E+++GHA  A ++  G+ EAV 
Sbjct: 181 KTAVTHAHEAKASLLVNAGHGLTRDNVAPIAD-IGGIHELNIGHAIIADSVFMGLSEAVS 239

Query: 241 CFRRA 245
             R+A
Sbjct: 240 AMRKA 244


>gi|313667835|ref|YP_004048119.1| pyridoxal phophate biosynthetic protein [Neisseria lactamica
           ST-640]
 gi|309378287|emb|CBX23075.1| unnamed protein product [Neisseria lactamica Y92-1009]
 gi|313005297|emb|CBN86730.1| pyridoxal phophate biosynthetic protein [Neisseria lactamica
           020-06]
          Length = 242

 Score =  123 bits (308), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 124/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVSAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  +    
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQDKIAGFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  +EL+TG Y    ++ +Q R F  ++  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVVELHTGAYADARSHAEQIRQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAV 228


>gi|240128775|ref|ZP_04741436.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae SK-93-1035]
 gi|268687159|ref|ZP_06154021.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae SK-93-1035]
 gi|268627443|gb|EEZ59843.1| pyridoxine 5'-phosphate synthase [Neisseria gonorrhoeae SK-93-1035]
          Length = 242

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/242 (31%), Positives = 126/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPEDVCIVPEKRQEITTEGGLDVLAQQEKIAEFA 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  +EL+TG Y    ++ +Q R F  ++  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVVELHTGAYADAQSHAEQIRQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L +NAGH LTI N+   +  I  I E+++GH+  A AL  G+ E V   + 
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-VAQILAIRELNIGHSLIAQALFLGLPETVRQMKE 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|120555157|ref|YP_959508.1| pyridoxine 5'-phosphate synthase [Marinobacter aquaeolei VT8]
 gi|120325006|gb|ABM19321.1| pyridoxine 5'-phosphate synthase [Marinobacter aquaeolei VT8]
          Length = 244

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 132/241 (54%), Gaps = 11/241 (4%)

Query: 1   MSTSV--SVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLP 58
           M+T V   VN++ VA LR  R   +P+ V    +A ++GA G+T+HPR D+RHI+  D+ 
Sbjct: 1   MNTRVLLGVNIDHVATLRQARGTRYPDPVQAALLAEEAGADGITIHPREDRRHIQDRDVL 60

Query: 59  EIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQA 118
            +R ++     + ++N+E    +  L   E+ +PE + LVP+   +LT++ G D    + 
Sbjct: 61  LLREVL-----QTKMNLEMAVTDAMLAFAEQVRPECVCLVPEKREELTTEGGLDVDGQEE 115

Query: 119 LLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF 178
            + K   RL  +G+ +SLF D +  +  + AA   GA  +EL+TG Y A    P+     
Sbjct: 116 RVAKACDRLAKIGAEVSLFIDPDPVQ--IDAAVRCGAPVVELHTGEY-AEAGEPEAVEAS 172

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
              LA     A+K  L +NAGH L   N    + AIP I+E+++GHA  A A+  G+K+A
Sbjct: 173 FKVLADAVAYARKKGLIVNAGHGLHYHNTER-VAAIPGINELNIGHAIIARAVFTGLKDA 231

Query: 239 V 239
           V
Sbjct: 232 V 232


>gi|87302324|ref|ZP_01085149.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. WH
           5701]
 gi|87283249|gb|EAQ75205.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. WH
           5701]
          Length = 249

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 81/240 (33%), Positives = 131/240 (54%), Gaps = 10/240 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R  
Sbjct: 3   SLGVNIDHIANVRQARRALEPDPVTLALLAELGGADGITVHLREDRRHIQERDVELLRAT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     ++ LN+E         +  R +P+ +TLVP+   ++T++ G D +     L   
Sbjct: 63  V-----RSRLNLEMAATPEMEAIALRIRPDMVTLVPEHRQEVTTEGGLDVVSQLGTLQAL 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL   G  +SLF D    +  L+A++ +GA  +EL+TG Y A  +  +Q R  L +L 
Sbjct: 118 VGRLQGSGIPVSLFVDPEVTQ--LEASRASGARWVELHTGAY-AEADWAEQPR-ELARLE 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             + +A+ + L++NAGH LT QN+   I AI  I E+++GH   A AL  G++ AV   R
Sbjct: 174 EGSFVARSLGLRVNAGHGLTYQNVEP-IAAIEGIEELNIGHTIVARALAVGLQSAVREMR 232


>gi|261401394|ref|ZP_05987519.1| pyridoxine 5'-phosphate synthase [Neisseria lactamica ATCC 23970]
 gi|269208615|gb|EEZ75070.1| pyridoxine 5'-phosphate synthase [Neisseria lactamica ATCC 23970]
          Length = 242

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 124/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTTYPSPVEAALVAETHGADLITMHLREDRRHIKDADVSAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L    +  P+ + +VP+   ++T++ G D L  Q  +    
Sbjct: 63  -----RTRLNLEMALTEEMLENALKVMPQDVCIVPEKRQEITTEGGLDVLAQQDKIAGFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D   ++  +QAA   GA  +EL+TG Y    ++ +Q R F  ++  
Sbjct: 118 KILTDAGIRVSLFID--ADDRQIQAAYDVGAPVVELHTGAYADARSHAEQIRQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  A AL  G+ EAV
Sbjct: 175 GAHFAGDLGLVVNAGHGLTIHNVTP-IAQILAIRELNIGHSLIAQALFLGLPEAV 228


>gi|194334495|ref|YP_002016355.1| pyridoxine 5'-phosphate synthase [Prosthecochloris aestuarii DSM
           271]
 gi|238693297|sp|B4S3G9|PDXJ_PROA2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|194312313|gb|ACF46708.1| pyridoxal phosphate biosynthetic protein PdxJ [Prosthecochloris
           aestuarii DSM 271]
          Length = 236

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           ++VN++ +A LRN RN   P+ V    IA  +GASG+  H R D+RHI+  DL  +R  +
Sbjct: 3   LAVNVDHIATLRNARNASLPDPVTAAVIAELNGASGIVCHLREDRRHIKDRDLERLREAV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +     L++E        ++  R KPE ITLVP+   +LT++ G+D +++   L + +
Sbjct: 63  TTR-----LDLEMAMTTEMQHIAIRTKPELITLVPEKREELTTEGGFDIIRHYDTLCRYI 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             + + G  +S+F +    E +++ A   GA+ +EL+TGPY +    P +    L ++  
Sbjct: 118 KPVQDAGIEVSIFIE--PEEEAIERAASAGAEIVELHTGPY-SLKKTPAELETELMRIRK 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A+   L++ AGH L   NI      I  I E+S+GHA  A A   G++ AV
Sbjct: 175 AATFARSRGLRVVAGHGLDYFNIVPF-RTIEEIEEVSIGHALIARAALVGMETAV 228


>gi|78485082|ref|YP_391007.1| pyridoxal phosphate biosynthetic protein PdxJ [Thiomicrospira
           crunogena XCL-2]
 gi|91207572|sp|Q31HP0|PDXJ_THICR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|78363368|gb|ABB41333.1| pyridoxal phosphate biosynthetic protein PdxJ [Thiomicrospira
           crunogena XCL-2]
          Length = 248

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 128/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ VA LR  R   +P+ V     A  +GA  +T+H R D+RHI+  D   + RL 
Sbjct: 6   LGLNIDHVATLRQARGTRYPDPVKAALDAEMAGADSITLHLREDRRHIQDAD---VYRL- 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +  + ++N+E    +  L +  + +PE + LVP+   +LT++ G D    +A LT   
Sbjct: 62  -SELRQTKINLEMAATQEMLEIALKCQPEDVCLVPEKREELTTEGGLDVASQKAWLTDYC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           A+L    +R+SLF D   ++  + AAK  GA  IE++TG Y A   +P   +  L ++  
Sbjct: 121 AQLAENKTRVSLFID--ADDAQIHAAKEVGAPVIEIHTGTY-AELTDPAAIKTELERIRK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
              LA  + L +NAGH L   N+   I AI  I E+++GHA  A A+  G+ +AV   +R
Sbjct: 178 ATDLAVSLGLTVNAGHGLHYHNV-QAIAAIKEIEELNIGHAIIAQAIFSGLPDAVSEMKR 236


>gi|184159112|ref|YP_001847451.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii ACICU]
 gi|332875941|ref|ZP_08443727.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii 6014059]
 gi|183210706|gb|ACC58104.1| Pyridoxal phosphate biosynthesis protein [Acinetobacter baumannii
           ACICU]
 gi|322509026|gb|ADX04480.1| pdxJ [Acinetobacter baumannii 1656-2]
 gi|323519008|gb|ADX93389.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii
           TCDC-AB0715]
 gi|332735807|gb|EGJ66848.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii 6014059]
          Length = 241

 Score =  122 bits (307), Expect = 3e-26,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 129/246 (52%), Gaps = 11/246 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTAYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RPLL-----KTRMNLEMAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFL 179
                 L  +G  +SLF D +  +  + AA   GA  IEL+TG Y  A  +  QQE   L
Sbjct: 116 KAATQALAAIGCDVSLFIDADFAQ--IDAAIACGAPTIELHTGAYADATTDQEQQEE--L 171

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++    + A    L +NAGH L ++NI   I AIP I E+++GH+  A ++  G+ +AV
Sbjct: 172 ARIVKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHELNIGHSIIAESVFVGLAQAV 230

Query: 240 FCFRRA 245
              + A
Sbjct: 231 KDMKTA 236


>gi|330991240|ref|ZP_08315192.1| Pyridoxine 5'-phosphate synthase [Gluconacetobacter sp. SXCC-1]
 gi|329761733|gb|EGG78225.1| Pyridoxine 5'-phosphate synthase [Gluconacetobacter sp. SXCC-1]
          Length = 249

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 72/220 (32%), Positives = 121/220 (55%), Gaps = 9/220 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R    P+ V    +A +SGA G+T H R D+RHIR  DL  +R  +
Sbjct: 11  LGVNIDHVATVRNARGGTHPDPVLAALLAQESGADGITAHLREDRRHIRDADLERLRAAL 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
               P   LN+E    E    +  R +P    LVP+   ++T++ G D     A L   +
Sbjct: 71  --AIP---LNMEMAATEEMTTIATRLRPHACCLVPERRQEVTTEGGLDVRGQAASLAPRI 125

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            R+ + G R+SLF D +  +  ++AA   GA  +EL+TG Y    +   +  + L +LA+
Sbjct: 126 TRMRDAGIRVSLFIDPDAAQ--IEAAAQLGAAVVELHTGAYADAVDEAARA-VELGRLAM 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGH 224
            A+ A +  L+++AGH L+ +N+ + + A+P + E+++GH
Sbjct: 183 GAEHAARCGLEVHAGHGLSYENV-SPVAALPQVMELNIGH 221


>gi|114570123|ref|YP_756803.1| pyridoxine 5'-phosphate synthase [Maricaulis maris MCS10]
 gi|114340585|gb|ABI65865.1| pyridoxine 5'-phosphate synthase [Maricaulis maris MCS10]
          Length = 247

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 128/245 (52%), Gaps = 10/245 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MS  + VN++ VA +RN R    P+ V   + A ++GA G+T H R D+RHI  TD+  +
Sbjct: 1   MSIRLGVNIDHVATIRNARGGEHPDPVRAARQASEAGADGITAHLREDRRHITDTDIDRL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
              ID   P   LN+E       L++  R+KP  + LVP+   + T++ G D       +
Sbjct: 61  MAEID--LP---LNLEMAATPEMLDIALRHKPHAVCLVPEKREERTTEGGLDVAAGHNTI 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI--F 178
              V +L   GSR+SLF + +  +  +  A+  GA  +EL+TG Y   +    + ++   
Sbjct: 116 APYVRQLREAGSRVSLFIEPDPVQ--IAVAEAMGAAVVELHTGAYCEAFLAGDKAKLDHH 173

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           L +L   + +A +  L+++AGH LT   +   I AIP + E+++GH     A+  G++EA
Sbjct: 174 LKRLQAASTVAHERGLEVHAGHGLTYDTV-KPIAAIPEVIELNIGHFLIGEAIFRGLREA 232

Query: 239 VFCFR 243
           V   R
Sbjct: 233 VGTMR 237


>gi|152986759|ref|YP_001350088.1| pyridoxine 5'-phosphate synthase [Pseudomonas aeruginosa PA7]
 gi|166219108|sp|A6VAK3|PDXJ_PSEA7 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|150961917|gb|ABR83942.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa PA7]
          Length = 248

 Score =  122 bits (307), Expect = 4e-26,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 125/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+    R++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDV----RML 64

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            E   +  +N E    E  L   E  +P    LVP+   +LT++ G D    +  +   V
Sbjct: 65  KEVL-QTRMNFEMGVTEEMLAFAEEIRPAHSCLVPERREELTTEGGLDVAGQEQRIRDAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D +  +  ++A+   GA  IEL+TG Y A   NP ++   L ++  
Sbjct: 124 RRLAAVGSEVSLFIDPDPRQ--IEASARVGAPAIELHTGRY-ADAENPGEQARELQRVRE 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              L + + L +NAGH L   N+   + AI  I+E+++GHA  A AL  G ++AV
Sbjct: 181 GVALGRSLGLIVNAGHGLHYHNVEP-VAAIEGINELNIGHAIVAHALFVGFRQAV 234


>gi|307545607|ref|YP_003898086.1| pyridoxal phosphate biosynthetic protein PdxJ [Halomonas elongata
           DSM 2581]
 gi|307217631|emb|CBV42901.1| pyridoxal phosphate biosynthetic protein PdxJ [Halomonas elongata
           DSM 2581]
          Length = 274

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 128/241 (53%), Gaps = 12/241 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V    +A ++GA G+TVH R D+RHI+  D+    RL+
Sbjct: 8   LGVNIDHVATLRQARGTRYPDPVQAALLAEEAGADGITVHLREDRRHIQERDV----RLL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            E      +N+E    E  +   E  +P  + LVP+   +LT++ G D       ++   
Sbjct: 64  AEVL-NTRMNLEMAVTEAMVAFAEEVRPAHVCLVPEKREELTTEGGLDVAGGLDGVSDAC 122

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLNKLA 183
            RL  +G  +SLF D    +  ++AA   GA  IEL+TG Y  A     +QE     +L 
Sbjct: 123 RRLAAVGCEVSLFIDPTPEQ--VEAAAKAGAPTIELHTGAYAEASGEAARQEH---ARLV 177

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             A++A ++ L +NAGH L   N+   I AIP I E+++GHA  A AL  G+KEAV   +
Sbjct: 178 AAAEMAAELGLIVNAGHGLNYHNV-EAIAAIPGIHELNIGHALIARALFVGLKEAVAEMK 236

Query: 244 R 244
           R
Sbjct: 237 R 237


>gi|220934269|ref|YP_002513168.1| pyridoxal phosphate biosynthetic protein PdxJ [Thioalkalivibrio sp.
           HL-EbGR7]
 gi|254781565|sp|B8GPL4|PDXJ_THISH RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|219995579|gb|ACL72181.1| pyridoxal phosphate biosynthetic protein PdxJ [Thioalkalivibrio sp.
           HL-EbGR7]
          Length = 246

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 80/241 (33%), Positives = 124/241 (51%), Gaps = 9/241 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R  P+P+LV   +I  ++GA  +T+H R D+RHI+  D+  +R  I
Sbjct: 9   LGVNIDHIATIRQARGTPYPDLVEAVRIVEEAGADIITLHLREDRRHIQDRDVEMLRERI 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   +N+E    E    +  R +P+   +VP+   +LT++ G D L  +A L    
Sbjct: 69  -----TTGMNLEMAATEEMQAIALRIRPQACCIVPERREELTTEGGLDVLGQEARLKAFC 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           A L   G  +SLF + +     L AA   GA  +EL+TG Y +    P +E   L ++  
Sbjct: 124 APLLAAGIEVSLFVEPDLAH--LDAALRIGAPVVELHTGAYASAAPGPDRE-AHLERIVA 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A       L +NAGH L  +N+   I AIP + E+++GHA  A AL  G+ EAV   R 
Sbjct: 181 AAAHGHARGLVVNAGHGLDYENVLP-IAAIPVMHELNIGHAIVARALFTGIGEAVRAMRA 239

Query: 245 A 245
           A
Sbjct: 240 A 240


>gi|159903621|ref|YP_001550965.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str. MIT
           9211]
 gi|238687109|sp|A9BAZ9|PDXJ_PROM4 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|159888797|gb|ABX09011.1| Pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9211]
          Length = 243

 Score =  122 bits (306), Expect = 5e-26,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 130/238 (54%), Gaps = 14/238 (5%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P  V +  +A   GA G+TVH R D+RHI+  DL  +R  
Sbjct: 3   SLGVNIDHIANVRQARLASEPEPVQMAFLAELGGADGITVHLREDRRHIQDKDLKLLRAT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I+ +     LN+E    +  + +  + KP+ +T+VP+   ++T++ G + + N+  L + 
Sbjct: 63  INTR-----LNLEMAATKEMVEIALQVKPDMVTIVPESREEITTEGGLEVVNNKEKLREI 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER--IFLNK 181
           +  LH+   + S+F D    E  ++A+K  GA  +E++TG    CY N   E+  I L K
Sbjct: 118 INNLHSAKIQTSIFID--PIEAQIKASKEIGAGWVEIHTG----CYANASWEKQEIELAK 171

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +  +   A+ M L +NAGH LT  N+   I AI  I E+++GH   A AL  G++ AV
Sbjct: 172 IKASCAQARSMGLHVNAGHGLTYLNVEP-IAAIEGIEELNIGHTIVARALAVGLQNAV 228


>gi|313105595|ref|ZP_07791861.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa 39016]
 gi|310878363|gb|EFQ36957.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa 39016]
          Length = 248

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVRVLKEVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  L   E  +P    LVP+   +LT++ G D    +  +   V
Sbjct: 69  -----QTRMNFEMGGTEEMLAFAEEIRPAHSCLVPERREELTTEGGLDVAGQEQRIRDAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D +  +  ++A+   GA  IEL+TG Y A   +P+++   L ++  
Sbjct: 124 RRLAAVGSEVSLFIDPDPRQ--IEASARVGAPAIELHTGRY-ADAEDPEEQARELQRVRE 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              L + + L +NAGH L   N+   + AI  I+E+++GHA  A AL  G ++AV
Sbjct: 181 GVALGRSLGLIVNAGHGLHYHNVEP-VAAIDGINELNIGHAIVAHALFVGFRQAV 234


>gi|51245457|ref|YP_065341.1| pyridoxal phosphate biosynthetic protein [Desulfotalea psychrophila
           LSv54]
 gi|50876494|emb|CAG36334.1| probable pyridoxal phosphate biosynthetic protein [Desulfotalea
           psychrophila LSv54]
          Length = 393

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 76/237 (32%), Positives = 125/237 (52%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T +++N++ VA +R  R +  P+ V    I   +GA+G+ VH R D+RH++  D+  +R+
Sbjct: 155 TQLAINIDHVATIRQARGITEPDPVAAAAICEMAGAAGIVVHLREDRRHMQDRDIILLRQ 214

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            I     K ++N E   N+  + +    +P+ ITLVP+   +LT++ G D    +  L +
Sbjct: 215 TI-----KTKMNFEMGANKEIIKIALNTRPDMITLVPEKRQELTTEGGLDVAGQKKKLAR 269

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
           T+ R+      +SLF D    E  ++AA   GA  +EL+TG Y        QE+ +   L
Sbjct: 270 TIERMTAKNIPVSLFID--PVEEQIEAAYEIGAQFVELHTGKYSDAIGEAAQEKEY-QLL 326

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            + AQ A +  L++NAGH L   N    I AI  + E+S+GH+    A+  G+  AV
Sbjct: 327 VVAAQEAAQRGLRVNAGHGLGYHNAAR-IAAIDAVEELSIGHSIIGRAVFSGLDLAV 382


>gi|218893284|ref|YP_002442153.1| pyridoxine 5'-phosphate synthase [Pseudomonas aeruginosa LESB58]
 gi|226694870|sp|B7UYW9|PDXJ_PSEA8 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|218773512|emb|CAW29324.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa LESB58]
          Length = 248

 Score =  122 bits (305), Expect = 6e-26,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVRVLKEVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  L   E  +P    LVP+   +LT++ G D    +  +   V
Sbjct: 69  -----QTRMNFEMGVTEEMLAFAEEIRPAHSCLVPERREELTTEGGLDVAGQEQRIRDAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D +  +  ++A+   GA  IEL+TG Y A   +P+++   L ++  
Sbjct: 124 RRLAAVGSEVSLFIDPDPRQ--IEASARVGAPAIELHTGRY-ADAEDPEEQTRELQRVRE 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              L + + L +NAGH L   N+   + AI  I+E+++GHA  A AL  G ++AV
Sbjct: 181 GVALGRSLGLIVNAGHGLHYHNVEP-VAAIDGINELNIGHAIVAHALFVGFRQAV 234


>gi|15595970|ref|NP_249464.1| pyridoxine 5'-phosphate synthase [Pseudomonas aeruginosa PAO1]
 gi|116048689|ref|YP_792511.1| pyridoxine 5'-phosphate synthase [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|254239135|ref|ZP_04932458.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa C3719]
 gi|254245028|ref|ZP_04938350.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa 2192]
 gi|296390877|ref|ZP_06880352.1| pyridoxine 5'-phosphate synthase [Pseudomonas aeruginosa PAb1]
 gi|20139189|sp|Q9I5G5|PDXJ_PSEAE RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|122257795|sp|Q02HS5|PDXJ_PSEAB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|9946662|gb|AAG04162.1|AE004512_5 pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa PAO1]
 gi|115583910|gb|ABJ09925.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa UCBPP-PA14]
 gi|126171066|gb|EAZ56577.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa C3719]
 gi|126198406|gb|EAZ62469.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           aeruginosa 2192]
          Length = 248

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVRVLKEVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  L   E  +P    LVP+   +LT++ G D    +  +   V
Sbjct: 69  -----QTRMNFEMGVTEEMLAFAEEIRPAHSCLVPERREELTTEGGLDVAGQEQRIRDAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +GS +SLF D +  +  ++A+   GA  IEL+TG Y A   +P+++   L ++  
Sbjct: 124 RRLAAVGSEVSLFIDPDPRQ--IEASARVGAPAIELHTGRY-ADAEDPEEQARELQRVRE 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              L + + L +NAGH L   N+   + AI  I+E+++GHA  A AL  G ++AV
Sbjct: 181 GVALGRSLGLIVNAGHGLHYHNVEP-VAAIDGINELNIGHAIVAHALFVGFRQAV 234


>gi|270265297|ref|ZP_06193558.1| pyridoxine 5'-phosphate synthase [Serratia odorifera 4Rx13]
 gi|270040701|gb|EFA13804.1| pyridoxine 5'-phosphate synthase [Serratia odorifera 4Rx13]
          Length = 243

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 124/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  L++    KP+   LVP+   ++T++ G D    Q  +   V
Sbjct: 66  -----QTRMNLEMAVTDEMLDIAIELKPQFCCLVPEKREEVTTEGGLDVAGQQDKMAVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D   +   + AA   GA  IE++TG Y A        +  L+++A+
Sbjct: 121 ERLAQAGILVSLFID--PDHRQIDAAVAVGAPYIEIHTGAY-AEATGELAVKAELHRIAV 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNV-QPIAALPEMYELNIGHAIIGQAVMSGLPAAV 231


>gi|74318101|ref|YP_315841.1| pyridoxine 5'-phosphate synthase [Thiobacillus denitrificans ATCC
           25259]
 gi|91207573|sp|Q3SH53|PDXJ_THIDA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|74057596|gb|AAZ98036.1| Pyridoxal phosphate biosynthetic protein PdxJ [Thiobacillus
           denitrificans ATCC 25259]
          Length = 246

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 82/244 (33%), Positives = 127/244 (52%), Gaps = 9/244 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MS  + VN++ +A LR  R   +P+ V     A  +GA  +T+H R D+RHI+  D+  +
Sbjct: 5   MSIYLGVNIDHIATLRQARKTRYPSPVEAALAAETAGADSITLHLREDRRHIQDADVTIL 64

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R     Q  K ++N+E    E  L +    +P  + LVP+   +LT++ G D    QA +
Sbjct: 65  R-----QTLKTKMNLEMAVTEEMLGIALETRPSDVCLVPEKREELTTEGGLDVAGQQAKM 119

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
               ARL + G R+SLF D +  +  L AA   GA  +E++TG Y    ++  +   F  
Sbjct: 120 RDACARLGDAGIRVSLFIDADFAQ--LDAAHAAGAPVVEIHTGHYADAASDAARAAEF-E 176

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++       + + L +NAGH LT  N+   I A+P I E+++GHA  A AL  G KEAV 
Sbjct: 177 RIRRAVAYGRSLGLTVNAGHGLTYHNVQP-IAALPGIHELNIGHAIVAQALFVGWKEAVA 235

Query: 241 CFRR 244
             +R
Sbjct: 236 EMKR 239


>gi|329114064|ref|ZP_08242828.1| Pyridoxine 5'-phosphate synthase [Acetobacter pomorum DM001]
 gi|326696603|gb|EGE48280.1| Pyridoxine 5'-phosphate synthase [Acetobacter pomorum DM001]
          Length = 240

 Score =  122 bits (305), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 78/240 (32%), Positives = 123/240 (51%), Gaps = 14/240 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ V    +A+Q+GA G+T H R D+RHIR  DL  +R  I
Sbjct: 7   LGVNIDHVATIRNARGGTYPDPVAAALLAIQAGADGITAHLREDRRHIRDKDLERLRAEI 66

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                 A LN+E    E  + +    +P    LVP+   +LT++ G +       LT  V
Sbjct: 67  -----AAPLNMEMAATEEMVGIALGLRPHACCLVPERREELTTEGGLNIAGQLETLTPKV 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G R+SLF D +  +  ++AA  TGA  +EL+TG Y             L +L  
Sbjct: 122 QKLAQAGIRVSLFIDPSPAQ--IEAAAKTGAQVVELHTGAYAEGKAGE------LERLRA 173

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A  + L+++AGH LT +N+   I ++P + E+++GH     A+  G+   V   +R
Sbjct: 174 AAMQAASLGLEVHAGHGLTFENV-GPIASLPELRELNIGHFLIGQAIFDGLAAVVQSMKR 232


>gi|239996015|ref|ZP_04716539.1| pyridoxine 5'-phosphate synthase [Alteromonas macleodii ATCC 27126]
          Length = 245

 Score =  121 bits (304), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 128/245 (52%), Gaps = 10/245 (4%)

Query: 1   MSTSV-SVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPE 59
           MST +  VN++ +A LRN R   +P+ VH   IA ++GA G+TVH R D+RHI+  D+  
Sbjct: 1   MSTILLGVNIDHIATLRNARGTHYPDPVHAADIAERAGADGITVHLREDRRHIKDRDVRI 60

Query: 60  IRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQAL 119
           + + I+ +     LN+E    E  L + E  KP    LVP+   +LT++ G D   N   
Sbjct: 61  LAQTINTR-----LNLEMAVTEEMLAIAEEVKPVFCCLVPEKREELTTEGGLDVAGNFEN 115

Query: 120 LTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFL 179
           +     RL N    +SLF D +  +  + AA    A  IE++TG Y    +  +Q +  L
Sbjct: 116 IKAACERLANANILVSLFIDADKAQ--IDAAAACNAPYIEIHTGQYAEATSEEEQHK-EL 172

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            +L    + A  + L++NAGH L   N+   I AIP + E+++GHA  A A   G+  AV
Sbjct: 173 ARLVEGIEYADSLGLKVNAGHGLHYHNVKP-IAAIPQLIELNIGHAIIARAAFDGLHTAV 231

Query: 240 FCFRR 244
              R+
Sbjct: 232 ADMRK 236


>gi|58617019|ref|YP_196218.1| pyridoxal phosphate biosynthetic protein PdxJ [Ehrlichia
           ruminantium str. Gardel]
 gi|75432805|sp|Q5FHH4|PDXJ_EHRRG RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|58416631|emb|CAI27744.1| Pyridoxal phosphate biosynthetic protein pdxJ [Ehrlichia
           ruminantium str. Gardel]
          Length = 238

 Score =  121 bits (304), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 131/244 (53%), Gaps = 13/244 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S ++ VN++ +A LRN RN  +P+LV I  IA+ +GA  +TVH R D+RHIR +D   + 
Sbjct: 3   SIALGVNIDHIATLRNARNTEYPDLVEIANIAVNNGADFITVHLREDRRHIRDSD---VF 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           RL D       LN+E    +  L +    +PE + LVP+   +LT++ G D       L 
Sbjct: 60  RLKDNL--NVPLNLEIAAIDEMLAIAIAVQPECVCLVPEKRQELTTEGGLDVKNMFTYLM 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V +LHN   +++LF + + N+  +  AK    D IEL+TG Y  C +N Q E   LN+
Sbjct: 118 PFVTQLHNHNIKVTLFVEPDINQ--INYAKKLSVDNIELHTGVY--CNHNTQNE---LNR 170

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A+      ++ +AGH L  Q+    I  +PYIS +++GH     A+  G+  +++ 
Sbjct: 171 ILEAAKHCYTNKIECHAGHGLDYQSAAT-IARVPYISALNIGHFLICEAVLHGIGTSIYK 229

Query: 242 FRRA 245
            ++ 
Sbjct: 230 MKKV 233


>gi|32468402|emb|CAD88331.1| GdpxJ protein [Porphyromonas gingivalis]
 gi|32468414|emb|CAD88337.1| GdpxJ protein [Porphyromonas gingivalis]
 gi|32468422|emb|CAD88341.1| GdpxJ protein [Porphyromonas gingivalis]
 gi|32468436|emb|CAD88348.1| GdpxJ protein [Porphyromonas gingivalis]
 gi|32468440|emb|CAD88350.1| GdpxJ protein [Porphyromonas gingivalis]
          Length = 126

 Score =  121 bits (304), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 84/132 (63%), Gaps = 7/132 (5%)

Query: 40  GLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVP 99
           G+TVHPRPD+RHIR +D+ ++++ +      +E NIEG P+E F+ L E  +PEQ+T+VP
Sbjct: 1   GITVHPRPDERHIRRSDVYDLKKAL-----TSEFNIEGNPDERFIRLIEEIRPEQVTMVP 55

Query: 100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE 159
           D P  LTS+ GWD  +N   L + V R H  G R S+F D + +  ++  A  TG D IE
Sbjct: 56  DAPDVLTSNAGWDVARNYDHLCRLVERFHAWGIRTSIFIDTDLD--NISWAAKTGTDRIE 113

Query: 160 LYTGPYGACYNN 171
           LYT PY A Y+ 
Sbjct: 114 LYTEPYAAAYHK 125


>gi|169795100|ref|YP_001712893.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii AYE]
 gi|215482649|ref|YP_002324843.1| pyridoxal phosphate biosynthetic protein PdxJ [Acinetobacter
           baumannii AB307-0294]
 gi|239501070|ref|ZP_04660380.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii AB900]
 gi|301511103|ref|ZP_07236340.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii AB058]
 gi|332851051|ref|ZP_08433160.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii 6013150]
 gi|332869700|ref|ZP_08438888.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii 6013113]
 gi|169148027|emb|CAM85890.1| pyridoxal phosphate biosynthetic protein [Acinetobacter baumannii
           AYE]
 gi|193078012|gb|ABO12933.2| pyridoxal phosphate biosynthetic protein [Acinetobacter baumannii
           ATCC 17978]
 gi|213988826|gb|ACJ59125.1| pyridoxal phosphate biosynthetic protein PdxJ [Acinetobacter
           baumannii AB307-0294]
 gi|332730215|gb|EGJ61540.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii 6013150]
 gi|332732602|gb|EGJ63835.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii 6013113]
          Length = 241

 Score =  121 bits (304), Expect = 8e-26,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 128/246 (52%), Gaps = 11/246 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTAYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RPLL-----KTRMNLEMAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFL 179
                 L  +G  +SLF D +  +  + AA   GA  IEL+TG Y  A     QQE   L
Sbjct: 116 KAATQALAAIGCDVSLFIDADFAQ--IDAAIACGAPTIELHTGAYADATTEQEQQEE--L 171

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++    + A    L +NAGH L ++NI   I AIP I E+++GH+  A ++  G+ +AV
Sbjct: 172 ARIVKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHELNIGHSIIAESVFVGLVQAV 230

Query: 240 FCFRRA 245
              + A
Sbjct: 231 KDMKTA 236


>gi|238762800|ref|ZP_04623769.1| Pyridoxal phosphate biosynthetic protein [Yersinia kristensenii
           ATCC 33638]
 gi|238699105|gb|EEP91853.1| Pyridoxal phosphate biosynthetic protein [Yersinia kristensenii
           ATCC 33638]
          Length = 243

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++    KP    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVDIACEIKPHFCCLVPEKRQEVTTEGGLDVAGQVDKMTIAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL + G  ISLF D +  +  + AA   GA  IE++TG Y    ++  ++   L ++A 
Sbjct: 121 SRLSDAGILISLFIDADMRQ--IDAAVAVGAPYIEIHTGAYADASSDLARQA-ELMRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV
Sbjct: 178 AATYAASKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMSGLAAAV 231


>gi|195953021|ref|YP_002121311.1| pyridoxine 5'-phosphate synthase [Hydrogenobaculum sp. Y04AAS1]
 gi|226694869|sp|B4U872|PDXJ_HYDS0 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|195932633|gb|ACG57333.1| pyridoxal phosphate biosynthetic protein PdxJ [Hydrogenobaculum sp.
           Y04AAS1]
          Length = 240

 Score =  121 bits (304), Expect = 9e-26,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 133/240 (55%), Gaps = 15/240 (6%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +R  R    P+++    IA ++GA  +T+H R D+RHI+  D+  +R  +
Sbjct: 3   LGVNIDHVATIREARKTFEPSVLEAAFIAKRAGAHQITMHLREDRRHIKDEDVRLVRTSV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             + P   LN+E  P +    +    KP+++TLVP+   ++T++ G D L N   L   +
Sbjct: 63  --EIP---LNLEMAPTQEIKTIALEIKPQRVTLVPEKRQEVTTEGGLDILSNADYLKNYI 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP-----QQERIFL 179
                    +S F D +  +  ++A+K TGAD IEL+TG +   ++       ++E+   
Sbjct: 118 KDFKENQIEVSFFIDPDLGQ--VEASKFTGADAIELHTGRFAESFHKRDFRLLEEEK--- 172

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           N+L   A LA+++ L + AGH +T QNI  +++    I E+++GH+  + A+  G+++A+
Sbjct: 173 NRLRKAATLARELGLNVYAGHGITYQNIHLILDLKGLIEELNIGHSIISNAVLFGLEKAI 232


>gi|77359686|ref|YP_339261.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudoalteromonas
           haloplanktis TAC125]
 gi|91207559|sp|Q3IDK9|PDXJ_PSEHT RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|76874597|emb|CAI85818.1| pyridoxine 5'-phosphate (PNP) synthase [Pseudoalteromonas
           haloplanktis TAC125]
          Length = 243

 Score =  121 bits (304), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 124/240 (51%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P+  H   +A  +GA G+T+H R D+RHI+  D+  + + I
Sbjct: 6   LGVNVDHIATLRQARGTSYPDPAHAASVAEHAGADGITIHLREDRRHIQDRDVYVMAKTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +N+    KPE + LVP+   +LT++ G D   N   +T   
Sbjct: 66  -----QTRMNLETAVTDEMINIALEVKPEYVCLVPEKREELTTEGGLDVAGNLEKITAAT 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G ++SLF D +  +  L AAK TGA  +E++TG Y     +    +  L  +  
Sbjct: 121 KTLSDAGIKVSLFIDADKAQ--LDAAKATGAPYVEIHTGAYADATTDEAISK-ELEHIRQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             + A  + L +NAGH L   N+   I A+  I E+++GHA  A A   G+ +AV   +R
Sbjct: 178 GVKYAASIGLIVNAGHGLHYHNVKP-IAAMEEIYELNIGHAIIARAAIDGLDKAVRDMKR 236


>gi|261380743|ref|ZP_05985316.1| pyridoxine 5'-phosphate synthase [Neisseria subflava NJ9703]
 gi|284796461|gb|EFC51808.1| pyridoxine 5'-phosphate synthase [Neisseria subflava NJ9703]
          Length = 242

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 124/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTIYPSPVEAALIAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L       PE + LVP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALNVMPEDVCLVPEKRQEVTTEGGLDVLAQQDKVAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +  +QAA   GA  IEL+TG Y   + + +Q + F  ++  
Sbjct: 118 KILTDAGIRVSLFIDADNAQ--IQAAYDVGAPVIELHTGAYADAHGHAEQMKQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV
Sbjct: 175 GAHYASDLGLIVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAV 228


>gi|119471908|ref|ZP_01614216.1| pyridoxal phosphate biosynthetic protein [Alteromonadales bacterium
           TW-7]
 gi|119445281|gb|EAW26571.1| pyridoxal phosphate biosynthetic protein [Alteromonadales bacterium
           TW-7]
          Length = 243

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 123/240 (51%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P+  H   +A  +GA G+T+H R D+RHI+  D+  + + I
Sbjct: 6   LGVNVDHIATLRQARGTTYPDPAHAASVAEHAGADGITIHLREDRRHIQDRDVYVMAKTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    KPE + LVP+   +LT++ G D   N   +    
Sbjct: 66  -----QTRMNLETAVTDEMIAIALEVKPEYVCLVPEKREELTTEGGLDVAGNIEKIKAAT 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G ++SLF D +  +  L AAK  GA  +E++TG Y    N+    +  L  +  
Sbjct: 121 KTLTDAGIKVSLFIDADTAQ--LDAAKACGAPYVEIHTGAYADATNDSDLSK-ELEHIRQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             Q A  + L +NAGH L   N+   I A+P I E+++GHA  A A   G+ +AV   +R
Sbjct: 178 GVQYAASLGLIVNAGHGLNYHNVKP-IAAMPEIYELNIGHAIIARAAIDGLDKAVRDMKR 236


>gi|307730524|ref|YP_003907748.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           CCGE1003]
 gi|307585059|gb|ADN58457.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           CCGE1003]
          Length = 254

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 125/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+  +R L+
Sbjct: 13  LGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADAITLHLREDRRHIVDADVRALRPLL 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E    +  L++    +P  + LVP+   +LT++ G D       +    
Sbjct: 73  -----KTRMNLECAVTQEMLDIACEVQPHDVCLVPEKRQELTTEGGLDVAGQFEAVRAAC 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L +  SR+SLF D   +E  ++AA   GA  +EL+TG Y   ++  QQ+R +  ++  
Sbjct: 128 RQLADANSRVSLFID--PDETQIRAAHEAGAPVVELHTGRYAEAHDPAQQQREY-ERVVR 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A+    + +++NAGH L   N+   I AI  I E+++GHA  A AL  G   AV
Sbjct: 185 AAEFGATLGIKVNAGHGLHYTNVQQ-IAAIDGIVELNIGHAIVAHALFAGWDNAV 238


>gi|32468406|emb|CAD88333.1| GdpxJ protein [Porphyromonas gingivalis]
 gi|32468430|emb|CAD88345.1| GdpxJ protein [Porphyromonas gingivalis]
          Length = 126

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 84/132 (63%), Gaps = 7/132 (5%)

Query: 40  GLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVP 99
           G+TVHPRPD+RHIR +D+ ++++ +  +F     NIEG P+E F+ L E  +PEQ+T+VP
Sbjct: 1   GITVHPRPDERHIRRSDVYDLKKALTTEF-----NIEGNPDERFIRLIEEIRPEQVTMVP 55

Query: 100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE 159
           D P  LTS+ GWD  +N   L + V R H  G R S+F D + +  ++  A  TG D IE
Sbjct: 56  DAPDVLTSNAGWDVARNYDHLCRLVERFHAWGIRTSIFIDTDLD--NISWAAKTGTDRIE 113

Query: 160 LYTGPYGACYNN 171
           LYT PY A Y+ 
Sbjct: 114 LYTEPYAAAYHK 125


>gi|57239021|ref|YP_180157.1| pyridoxine 5'-phosphate synthase [Ehrlichia ruminantium str.
           Welgevonden]
 gi|58578962|ref|YP_197174.1| pyridoxal phosphate biosynthetic protein PdxJ [Ehrlichia
           ruminantium str. Welgevonden]
 gi|81557331|sp|Q5HBN7|PDXJ_EHRRW RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|57161100|emb|CAH58009.1| pyridoxal phosphate biosynthetic protein PdxJ [Ehrlichia
           ruminantium str. Welgevonden]
 gi|58417588|emb|CAI26792.1| Pyridoxal phosphate biosynthetic protein pdxJ [Ehrlichia
           ruminantium str. Welgevonden]
          Length = 238

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/244 (32%), Positives = 131/244 (53%), Gaps = 13/244 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S ++ VN++ +A LRN RN  +P+LV I  IA+ +GA  +TVH R D+RHIR +D   + 
Sbjct: 3   SIALGVNIDHIATLRNARNTEYPDLVEIANIAVNNGADFITVHLREDRRHIRDSD---VF 59

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           RL D       LN+E    +  L +    +PE + LVP+   +LT++ G D       L 
Sbjct: 60  RLKDNL--NVPLNLEIAAIDEMLAIAIAVQPECVCLVPEKRQELTTEGGLDVKNMFTYLM 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             + +LHN   +++LF + + N+  +  AK    D IEL+TG Y  C +N Q E   LN+
Sbjct: 118 PFITQLHNHNIKVTLFVEPDINQ--INYAKKLSVDNIELHTGVY--CNHNTQNE---LNR 170

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A+      ++ +AGH L  Q+    I  +PYIS +++GH     A+  G+  +++ 
Sbjct: 171 ILEAAKHCYTNKIECHAGHGLDYQSAAT-IARVPYISALNIGHFLICEAVLHGIGTSIYK 229

Query: 242 FRRA 245
            ++ 
Sbjct: 230 MKKV 233


>gi|85707972|ref|ZP_01039038.1| pyridoxal phosphate biosynthesis protein [Erythrobacter sp. NAP1]
 gi|85689506|gb|EAQ29509.1| pyridoxal phosphate biosynthesis protein [Erythrobacter sp. NAP1]
          Length = 247

 Score =  121 bits (303), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 82/241 (34%), Positives = 120/241 (49%), Gaps = 10/241 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R    P+ V   +I    G  G+T H R D+RHIR  DL  I+   
Sbjct: 7   LGVNIDHVATIRNARGGDHPDPVRAAEIVAAVGGDGITAHLREDRRHIRDEDLARIQDAT 66

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D   P   LN+E    E  L +  R+KP    +VP+   + T++ G D       LT  V
Sbjct: 67  D--LP---LNLEMAATEEMLEIALRHKPHAACIVPEKREERTTEGGLDAAGLHNTLTPIV 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF--LNKL 182
            RL + G R+SLF +   +E  L AA   G   +E +TG Y     +   ER    L ++
Sbjct: 122 YRLKDHGIRVSLFIE--ADERQLDAALKLGVPVVEFHTGEYAHAILDGDSERTAKELRRI 179

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A LA K  ++ +AGH LT  N+   I AIP I+E+++GH     A+  G++ A+   
Sbjct: 180 TDIAALAAKNGIEPHAGHGLTFDNV-QPIAAIPQIAELNIGHYLIGEAIFAGLEPAIRRM 238

Query: 243 R 243
           R
Sbjct: 239 R 239


>gi|260556586|ref|ZP_05828804.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter
           baumannii ATCC 19606]
 gi|260409845|gb|EEX03145.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter
           baumannii ATCC 19606]
          Length = 241

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 128/246 (52%), Gaps = 11/246 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTAYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RPLL-----KTRMNLEMAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFL 179
                 L  +G  +SLF D +  +  + AA   GA  IEL+TG Y  A     QQE + L
Sbjct: 116 KAATQALAAIGCDVSLFIDADFAQ--IDAAIACGAPTIELHTGAYADATTEQEQQEELAL 173

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             +    + A    L +NAGH L ++NI   I AIP I E+++GH+  A ++  G+ +AV
Sbjct: 174 --IVKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHELNIGHSIIAESVFVGLVQAV 230

Query: 240 FCFRRA 245
              + A
Sbjct: 231 KDMKTA 236


>gi|153869555|ref|ZP_01999130.1| Pyridoxal phosphate biosynthetic protein pdxJ [Beggiatoa sp. PS]
 gi|152073964|gb|EDN70875.1| Pyridoxal phosphate biosynthetic protein pdxJ [Beggiatoa sp. PS]
          Length = 255

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 123/243 (50%), Gaps = 9/243 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA +R  R+  +P+ +    IA Q+GA  +T+H R D+RHI+  D+    
Sbjct: 12  SIRLGVNIDHVATIRQARDTRYPDPIQAAIIAEQAGADLITLHLREDRRHIQERDV---- 67

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+ +      +N+E    E  L   E+ +P  + LVP+   +LT++ G D    +  + 
Sbjct: 68  -LMLKDVLVTRMNLEMAVTEDMLAFAEQIRPHDVCLVPERREELTTEGGLDVAGQEERIR 126

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
           +   RL  +G R+SLF D    +  + AA   GA  IE++TG +    ++      +   
Sbjct: 127 EACQRLTAVGIRVSLFIDAQLKQ--IDAAVRVGAPVIEIHTGHFADAVDDNNCHIEYQRI 184

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A    K  LQ+NAGH L   NI + I  IP I E+++GHA  A AL  G  EAV  
Sbjct: 185 LTAVAH-GYKAGLQVNAGHGLNYHNIAD-IALIPEIRELNIGHAIVARALFSGFAEAVRE 242

Query: 242 FRR 244
            +R
Sbjct: 243 MKR 245


>gi|329119896|ref|ZP_08248570.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           bacilliformis ATCC BAA-1200]
 gi|327464052|gb|EGF10363.1| pyridoxal phosphate biosynthetic protein PdxJ [Neisseria
           bacilliformis ATCC BAA-1200]
          Length = 241

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/237 (33%), Positives = 124/237 (52%), Gaps = 14/237 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +     A   GA  +T+H R D+RHIR  D+  I R +
Sbjct: 3   LGVNIDHVATLRNARGTTYPSPLEAALTAETHGADYITLHLREDRRHIRDDDVAAIARTV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  L    R +P+ + +VP+   ++T++ G D +  Q  +    
Sbjct: 63  -----RTHINLEMALTEEMLEHALRVRPQDVCIVPEKRQEITTEGGLDVIALQQKIADYT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFLNKL 182
            +L   G R+SLF D   +E  +QAA  TGA  IEL+TG Y     +  P+Q    L K+
Sbjct: 118 HQLTAAGIRVSLFID--PDETQIQAALDTGAPAIELHTGAYADAPAHERPRQ----LAKI 171

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A  A +  L +NAGH L I N+  +   +P I+E+++GHA  A +L  G+  A+
Sbjct: 172 EEAAYFASERGLTVNAGHGLNIHNVAPVAKILP-IAELNIGHALIAQSLFLGLPAAI 227


>gi|170076728|ref|YP_001733366.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. PCC 7002]
 gi|169884397|gb|ACA98110.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           PCC 7002]
          Length = 246

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 79/248 (31%), Positives = 133/248 (53%), Gaps = 11/248 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ VA +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R+ 
Sbjct: 9   TLGVNIDHVATIRQARRTVEPDPVAAATLAELGGADGITVHLREDRRHIQDRDVKILRQT 68

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     ++ LN+E  P    + +    KP+ +TLVP+   ++T++ G D + N A   + 
Sbjct: 69  V-----QSHLNLEMAPTAEMVAIALDIKPDYVTLVPEKREEITTEGGIDIVGNFARFEEV 123

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V +L   G  +S F D    +  ++AA+ TGA  IEL+TG Y    ++ QQ+   L  L 
Sbjct: 124 VDQLQGAGIPVSWFIDAELEQ--IEAAQKTGAQFIELHTGKYAEAQDSDQQQ-AELATLK 180

Query: 184 ITAQLAQKMDLQINAGHDLTIQNI-PNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
             A+ A  + L++NAGH LT +N+ P  +  I  + E+++GH   + A+  G++ AV   
Sbjct: 181 TGAKQAIALGLRVNAGHGLTYRNVYP--VACIEGMEELNIGHTIISRAVLVGLERAVREM 238

Query: 243 RRACGQHL 250
           + A    L
Sbjct: 239 KLAMWGQL 246


>gi|291618443|ref|YP_003521185.1| PdxJ [Pantoea ananatis LMG 20103]
 gi|291153473|gb|ADD78057.1| PdxJ [Pantoea ananatis LMG 20103]
          Length = 243

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 125/239 (52%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATVRNARGTHYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRDTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           + +     +N+E    +  L +    KP    LVP+   ++T++ G D    Q  L   V
Sbjct: 66  ETR-----MNLEMAVTDEMLAIACEIKPHFCCLVPEKREEVTTEGGLDVAGQQEKLNAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +SLF D +  +  ++AA  +GA  IE++TG Y      P ++   L ++  
Sbjct: 121 KQLSEAGILVSLFIDPDHRQ--IEAAVTSGAPYIEIHTGAYAEAPEGPARD-AELARIRQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+ EAV   +
Sbjct: 178 AATFAASRGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLPEAVKAMK 235


>gi|313201511|ref|YP_004040169.1| pyridoxal phosphate biosynthetic protein pdxj [Methylovorus sp.
           MP688]
 gi|312440827|gb|ADQ84933.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylovorus sp.
           MP688]
          Length = 243

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 75/231 (32%), Positives = 127/231 (54%), Gaps = 9/231 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LR  R   +P++V     A ++GA  +T+H R D+RHI+  D+  +R L
Sbjct: 3   KLGVNIDHVATLRQARGTQYPSVVQAALRAEEAGADSITIHLREDRRHIQDADVFALRPL 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     + ++N+E    E  L +  + KP+ + LVP+   + T++ G +   N A ++  
Sbjct: 63  L-----QTKMNLEMAVTEEMLGIALQVKPQDVCLVPERREERTTEGGLEVAGNLAAVSHA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
              L + G R+SLF   +  +  + AAK  GA  IE++TG + A    P+++   L ++ 
Sbjct: 118 CQVLRDAGIRVSLFIAPDIAQ--IDAAKAAGAPVIEIHTGTF-ADAETPEEQAHELARVQ 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG 234
                 +K+ L +NAGH L I N+ +LI AIP I E+++GHA  A A+  G
Sbjct: 175 AAVAHGRKLGLVVNAGHGLNIHNV-HLIAAIPGIEELNIGHAIVAHAIFVG 224


>gi|323697778|ref|ZP_08109690.1| pyridoxal phosphate biosynthetic protein PdxJ [Desulfovibrio sp.
           ND132]
 gi|323457710|gb|EGB13575.1| pyridoxal phosphate biosynthetic protein PdxJ [Desulfovibrio
           desulfuricans ND132]
          Length = 241

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 127/235 (54%), Gaps = 13/235 (5%)

Query: 7   VNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDE 66
           VN++ VA LR  R    P  V    +A  +GA+G+ VH R D+RHI+  D+  I+     
Sbjct: 6   VNVDHVATLRQARRGIEPEPVTAAYMAEMAGATGIIVHLREDRRHIQDRDVELIK----- 60

Query: 67  QFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVAR 126
           Q     L++E    +    +  + +PE + LVP+   +LT++ G + +  +A L   +A 
Sbjct: 61  QTCNTRLHLEMAATDEMQGIALKIEPEMVCLVPEKRQELTTEGGLNCIGREAELKDFLAP 120

Query: 127 LHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC--YNNPQQERIFLNKLAI 184
           +H  G R SLF D +  +  ++AA  TG + IE++TG Y     Y+N    R+ L K+  
Sbjct: 121 IHEKGIRSSLFIDADPKQ--IEAAIATGTEFIEIHTGHYADAKEYDN---RRVELEKILK 175

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +  LA+ + L++N GH L  +NI N  + +P ISE S+GHA  A A+  G+  AV
Sbjct: 176 SISLAKDIGLKVNLGHGLNYRNILNFKD-VPGISEYSIGHAIMARAIYLGLDRAV 229


>gi|32468400|emb|CAD88330.1| GdpxJ protein [Porphyromonas gingivalis]
          Length = 126

 Score =  120 bits (302), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 60/132 (45%), Positives = 84/132 (63%), Gaps = 7/132 (5%)

Query: 40  GLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVP 99
           G+TVHPRPD+RHIR +D+ ++++ +  +F     NIEG P+E F+ L E  +PEQ+T+VP
Sbjct: 1   GITVHPRPDERHIRRSDVYDLKKALTTEF-----NIEGNPDERFIRLIEEIRPEQVTMVP 55

Query: 100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE 159
           D P  LTS+ GWD  +N   L + V R H  G R S+F D + +  ++  A  TG D IE
Sbjct: 56  DAPDVLTSNAGWDVARNYDHLCRLVERFHAWGIRTSIFIDTDLD--NISWAAKTGTDRIE 113

Query: 160 LYTGPYGACYNN 171
           LYT PY A Y+ 
Sbjct: 114 LYTEPYAATYHK 125


>gi|332140214|ref|YP_004425952.1| pyridoxine 5'-phosphate synthase [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327550236|gb|AEA96954.1| pyridoxine 5'-phosphate synthase [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 245

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 86/246 (34%), Positives = 129/246 (52%), Gaps = 12/246 (4%)

Query: 1   MSTSV-SVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPE 59
           MST +  VN++ +A LRN R   +P+ VH   IA ++GA G+TVH R D+RHI+  D+  
Sbjct: 1   MSTILLGVNIDHIATLRNARGTHYPDPVHAADIAERAGADGITVHLREDRRHIKDRDVRI 60

Query: 60  IRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQAL 119
           + + I+ +     LN+E    +  L + E  KP    LVP+   +LT++ G D   N   
Sbjct: 61  LAQTINTR-----LNLEMAVTDEMLAIAEEVKPVFCCLVPEKREELTTEGGLDVAGNVDN 115

Query: 120 LTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIF 178
           +     RL N    +SLF D   ++  + AA    A  IE++TG Y  A     QQE   
Sbjct: 116 IKAACDRLANANILVSLFID--ADKAQIDAAAACNAPYIEIHTGQYAEATSEEAQQEE-- 171

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           L +L    + A  + L++NAGH L   N+   I AIP + E+++GHA  A A   G+ +A
Sbjct: 172 LARLVEGIEYADSLGLKVNAGHGLHYHNVKP-IAAIPQLIELNIGHAIIARAAFDGLHKA 230

Query: 239 VFCFRR 244
           V   R+
Sbjct: 231 VADMRK 236


>gi|78186334|ref|YP_374377.1| pyridoxine 5'-phosphate synthase [Chlorobium luteolum DSM 273]
 gi|91207552|sp|Q3B5P7|PDXJ_PELLD RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|78166236|gb|ABB23334.1| pyridoxine 5'-phosphate synthase [Chlorobium luteolum DSM 273]
          Length = 235

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 125/235 (53%), Gaps = 10/235 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           ++VN++ +A LRN RN   P+ V    +A +SGA+G+  H R D+RHIR  DL  +RR +
Sbjct: 3   LAVNIDHIATLRNARNEGEPDPVAAALLAEESGAAGIVCHLREDRRHIRDNDLKGLRRSV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K +L++E    E    +     PE ITLVP+   +LT++ G+D  ++   L   +
Sbjct: 63  -----KTKLDLEMAMTEEMQRIAIETVPELITLVPEKREELTTEGGFDIERHFKRLALFI 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             +   G  +SLF + +    S+  A   G+D +EL+TG Y A  +  +Q   F  ++  
Sbjct: 118 EPIRAAGIEVSLFIEPDSR--SIDLAAEAGSDLVELHTGSY-ALKSGEEQTAEF-ERIRH 173

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A+ A    L++ AGH L  +NI      IP I E+S+GHA  A A   G+ EAV
Sbjct: 174 AAKYAVDRGLKVVAGHGLNYRNIQPF-RQIPEIEEVSIGHALIARAAFVGIPEAV 227


>gi|288941439|ref|YP_003443679.1| pyridoxal phosphate biosynthetic protein PdxJ [Allochromatium
           vinosum DSM 180]
 gi|288896811|gb|ADC62647.1| pyridoxal phosphate biosynthetic protein PdxJ [Allochromatium
           vinosum DSM 180]
          Length = 255

 Score =  120 bits (302), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 122/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +R  R   +P  +    +A Q+GA  +T+H R D+RHI+  D+  +R ++
Sbjct: 13  LGVNIDHVATVRQARGTRYPEPIQAALVAEQAGADAITLHLREDRRHIQDRDVEMLRDIL 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E         +  R +P    LVP+   +LT++ G D    Q  + +  
Sbjct: 73  -----QTRMNLEMAVTPEMAAIACRIRPADCCLVPERREELTTEGGLDVASRQDAMREFC 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL   G R+SLF D +  +  ++AA   GA  IE++TG Y A   +P +    L ++  
Sbjct: 128 ARLAEAGIRVSLFIDADPVQ--IEAAHAIGAPVIEIHTGHY-ADARDPVERAAQLERIRS 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              L   + LQ+NAGH L   N+   I AIP + E+++GH+  A AL  G+  AV
Sbjct: 185 AVALGLSLGLQVNAGHGLDYHNV-QAIAAIPGVRELNIGHSIIARALFSGLDRAV 238


>gi|213158238|ref|YP_002320289.1| pyridoxal phosphate biosynthetic protein PdxJ [Acinetobacter
           baumannii AB0057]
 gi|301345820|ref|ZP_07226561.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii AB056]
 gi|301594768|ref|ZP_07239776.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii AB059]
 gi|213057398|gb|ACJ42300.1| pyridoxal phosphate biosynthetic protein PdxJ [Acinetobacter
           baumannii AB0057]
          Length = 241

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 128/246 (52%), Gaps = 11/246 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGNAYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RPLL-----KTRMNLEMAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFL 179
                 L  +G  +SLF D +  +  + AA   GA  IEL+TG Y  A     QQE   L
Sbjct: 116 KAATQALAAIGCDVSLFIDADFAQ--IDAAIACGAPTIELHTGAYADATTEQEQQEE--L 171

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++    + A    L +NAGH L ++NI   I AIP I E+++GH+  A ++  G+ +AV
Sbjct: 172 ARIVKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHELNIGHSIIAESVFVGLVQAV 230

Query: 240 FCFRRA 245
              + A
Sbjct: 231 KDMKTA 236


>gi|189425583|ref|YP_001952760.1| pyridoxine 5'-phosphate synthase [Geobacter lovleyi SZ]
 gi|238692127|sp|B3E693|PDXJ_GEOLS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|189421842|gb|ACD96240.1| pyridoxal phosphate biosynthetic protein PdxJ [Geobacter lovleyi
           SZ]
          Length = 239

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/244 (31%), Positives = 128/244 (52%), Gaps = 13/244 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ +A +R  R    P+ V    I   +GA G+T+H R D+RHI+  DL  +RR +
Sbjct: 4   LGLNVDHIATVRQARGGSEPDPVTAAAIGELAGAEGITIHLREDRRHIQDRDLEILRRTV 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                + +LN+E    +  + +  R +PEQ TLVP+   +LT++ G D L N A +T+  
Sbjct: 64  -----QTKLNLEMAATDEMVGIACRIRPEQCTLVPEKRQELTTEGGLDVLGNLAGITRAT 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           + L   G  +SLF D    +  ++A+K +GAD IE++TG Y    +   +    L  +  
Sbjct: 119 SSLREAGIVVSLFVDPTVEQ--IRASKESGADAIEIHTGRYAEARSEKSRHH-ELAAIRE 175

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG----VKEAVF 240
             +L  ++ L ++AGH L   NI  L   +  I E ++GH+  + A+  G    V+E V 
Sbjct: 176 AIRLGNELGLTVHAGHGLNYVNILPL-TGLAGIEEFNIGHSIISRAMLVGLDRAVREMVT 234

Query: 241 CFRR 244
             RR
Sbjct: 235 LIRR 238


>gi|187924872|ref|YP_001896514.1| pyridoxine 5'-phosphate synthase [Burkholderia phytofirmans PsJN]
 gi|187716066|gb|ACD17290.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           phytofirmans PsJN]
          Length = 254

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+ ++R L+
Sbjct: 13  LGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADVITLHLREDRRHIVDADVRKLRPLL 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  L++    +P  + LVP+   +LT++ G D       +    
Sbjct: 73  -----QTRMNLECAVTQEMLDIASEVQPHDVCLVPEKRQELTTEGGLDVAGQFEAVRAAC 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L +  SR+SLF D   +E  ++AA   GA  IEL+TG Y   ++  +Q+R F  ++  
Sbjct: 128 KQLADANSRVSLFID--PDETQIRAAHEAGAPVIELHTGRYAEAHDPAEQQREF-ERVVR 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             +  + + +++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV
Sbjct: 185 AVEFGRTLGIKVNAGHGLHYTNVQQ-IAAIEGIDELNIGHAIVAHAIFAGWDNAV 238


>gi|261345438|ref|ZP_05973082.1| pyridoxine 5'-phosphate synthase [Providencia rustigianii DSM 4541]
 gi|282566485|gb|EFB72020.1| pyridoxine 5'-phosphate synthase [Providencia rustigianii DSM 4541]
          Length = 243

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 122/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+T+H R D+RHI   D+  + + I
Sbjct: 6   LGVNIDHIATVRNARGTQYPDPVQAAFVAEQAGADGITIHLREDRRHITDRDVELLNQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++  R KP    LVP+   ++T++ G D    +  +   V
Sbjct: 66  -----QTRMNLEMAVTDEMIDIACRIKPTYCCLVPEKREEVTTEGGLDVAGQKQKVAAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D   +   + AA+  GA  IE++TG Y        QE I   ++  
Sbjct: 121 KRLTESGILVSLFID--ADHEQIDAAQECGAPFIEIHTGAYADAKTEQAQE-IEFRRIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             + A    +++NAGH LT  N+   I A+P I E+++GHA    AL  G+ +AV
Sbjct: 178 GVKYAAGKGIKVNAGHGLTYHNVQR-IAALPEIYELNIGHAIIGRALFSGLAQAV 231


>gi|319638210|ref|ZP_07992973.1| pyridoxine 5'-phosphate synthase [Neisseria mucosa C102]
 gi|317400483|gb|EFV81141.1| pyridoxine 5'-phosphate synthase [Neisseria mucosa C102]
          Length = 242

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 124/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA   GA  +T+H R D+RHI+  D+  ++  I
Sbjct: 3   LGVNIDHIATVRNARGTIYPSPVEAALIAETHGADLITMHLREDRRHIKDADVFAVKNAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L       PE + +VP+   ++T++ G D L  Q  + +  
Sbjct: 63  -----RTRLNLEMALTEEMLENALNVMPEDVCIVPEKRQEVTTEGGLDVLAQQDKVAEFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G R+SLF D +  +  +QAA   GA  IEL+TG Y   + + +Q + F  ++  
Sbjct: 118 KILTDAGIRVSLFIDADNAQ--IQAAYDVGAPVIELHTGAYADAHGHAEQMKQF-ERIQN 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L +NAGH LTI N+   I  I  I E+++GH+  + AL  G+ EAV
Sbjct: 175 GAHYASDLGLIVNAGHGLTIHNVTP-IAQILAIRELNIGHSLISQALFLGLPEAV 228


>gi|304321230|ref|YP_003854873.1| pyridoxal phosphate biosynthetic protein [Parvularcula bermudensis
           HTCC2503]
 gi|303300132|gb|ADM09731.1| pyridoxal phosphate biosynthetic protein [Parvularcula bermudensis
           HTCC2503]
          Length = 266

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 125/242 (51%), Gaps = 10/242 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R    P+ V   ++A+ +GA G+T H R D+RHI+  D+  ++  I
Sbjct: 22  LGVNIDHVATLRNARGGTDPDPVRAAQLAIAAGADGITAHLREDRRHIQDADMIRLKDEI 81

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D       LN E    E    +C +  P    LVP+  ++ T++ G D +  Q  LT  +
Sbjct: 82  DRP-----LNFEMAATEEMAEICLQVSPHAACLVPEKRNERTTEGGLDVVGGQQTLTPII 136

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFLNKL 182
            RL   G R+SLF D    +  ++AA   G   +EL+TG Y   A    P +       +
Sbjct: 137 DRLKEAGIRVSLFID--PEDAQVRAAAALGVPVVELHTGAYHHAALSTTPSRIEAAWRAI 194

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A LA  + L+++AGH LT  N+PN I +IP + E+++GH     A+  G+ +AV   
Sbjct: 195 DEAATLADDLGLEVHAGHGLTFHNVPN-IASIPAMRELNIGHFLIGEAVFMGLDQAVREM 253

Query: 243 RR 244
           RR
Sbjct: 254 RR 255


>gi|296158231|ref|ZP_06841063.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           Ch1-1]
 gi|295891567|gb|EFG71353.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           Ch1-1]
          Length = 254

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 124/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+ ++R L+
Sbjct: 13  LGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADVITLHLREDRRHIVDADVRKLRPLL 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E    +  L++    +P  + LVP+   +LT++ G D       +    
Sbjct: 73  -----KTRMNLECAVTQEMLDIACEVQPHDVCLVPEKRQELTTEGGLDVAGQFEAVRAAC 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L    SR+SLF D   +E  ++AA    A  IEL+TG Y   ++  QQ+R F  ++  
Sbjct: 128 RQLAEANSRVSLFID--PDEAQIRAAHEAAAPVIELHTGRYAEAHDPAQQQREF-ERVVR 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             +   K+ +++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV
Sbjct: 185 AVEFGAKLGIKVNAGHGLHYTNVQQ-IAAIEGIDELNIGHAIVAHAIFAGWDNAV 238


>gi|327394838|dbj|BAK12260.1| pyridoxal phosphate biosynthetic protein PdxJ [Pantoea ananatis
           AJ13355]
          Length = 243

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 124/239 (51%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATVRNARGTHYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRDTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           + +     +N+E    E  L +    KP    LVP+   ++T+  G D    Q  L   V
Sbjct: 66  ETR-----MNLEMAVTEEMLAIACEIKPHFCCLVPEKREEVTTVGGLDVAGQQEKLNAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +SLF D +  +  ++AA  +GA  IE++TG Y      P ++   L ++  
Sbjct: 121 KQLSEAGILVSLFIDPDHRQ--IEAAVTSGAPYIEIHTGAYAEAPEGPARD-AELARIRQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+ EAV   +
Sbjct: 178 AATFAASRGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLPEAVKAMK 235


>gi|251788701|ref|YP_003003422.1| pyridoxal phosphate biosynthetic protein PdxJ [Dickeya zeae
           Ech1591]
 gi|247537322|gb|ACT05943.1| pyridoxal phosphate biosynthetic protein PdxJ [Dickeya zeae
           Ech1591]
          Length = 243

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 126/236 (53%), Gaps = 11/236 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ +    +A QSGA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPIQAAFVAEQSGADGITVHLREDRRHITDRDVRLLRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  L +    KP    LVP+   ++T++ G D     + +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMLAIACELKPHFCCLVPEKRQEVTTEGGLDVAGQLSRITAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G ++SLF D +  +  + AA  +GA  IE++TG Y    N+  ++  F  ++  
Sbjct: 121 TQLREAGIQVSLFIDADRAQ--IDAAVASGAPYIEIHTGAYADAENDVARQHEF-ERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNI-PNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    +++NAGH LT  N+ P  I A+P + E+++GHA    A+  G+  AV
Sbjct: 178 AATYAASCGIKVNAGHGLTYHNVLP--IAALPEMHELNIGHAIIGRAVMSGLALAV 231


>gi|255320776|ref|ZP_05361951.1| pyridoxine 5'-phosphate synthase [Acinetobacter radioresistens
           SK82]
 gi|262379448|ref|ZP_06072604.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter
           radioresistens SH164]
 gi|255302153|gb|EET81395.1| pyridoxine 5'-phosphate synthase [Acinetobacter radioresistens
           SK82]
 gi|262298905|gb|EEY86818.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter
           radioresistens SH164]
          Length = 241

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 125/239 (52%), Gaps = 9/239 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V+   I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTVYPDPVNAALICEQAGAEGITLHLREDRRHIQDGDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R  +     K  +N+E       +   +  +P+ +  VP+   +LT++ G D + N   +
Sbjct: 61  RPAL-----KTRMNLEIAVTNEMVEFAKEIRPQHVCFVPEKRQELTTEGGLDVVTNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +  + AA   GA  IE++TG Y   +N  +Q+   L 
Sbjct: 116 KAATQALLQVGCDVSLFIDADLAQ--IDAAIACGAPTIEIHTGAYADAHNEAEQQA-ELE 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           ++    + A    L +NAGH L I N+   I AIP I E+++GH+  A +L  G+ +AV
Sbjct: 173 RIIKGTEYAAGKGLVVNAGHGLNIDNVTP-IAAIPQIHELNIGHSIIADSLFIGLAQAV 230


>gi|237748850|ref|ZP_04579330.1| pyridoxine 5-phosphate synthase [Oxalobacter formigenes OXCC13]
 gi|229380212|gb|EEO30303.1| pyridoxine 5-phosphate synthase [Oxalobacter formigenes OXCC13]
          Length = 254

 Score =  120 bits (301), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 126/236 (53%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ +A LRN R   +P+ V    +A Q+GA  +T+H R D+RHI+  D+  IR L
Sbjct: 12  ELGVNIDHIATLRNARGTTYPDPVKAAVMAEQAGADAITLHLREDRRHIKDADVRAIRPL 71

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        +N+E       ++     KP  + LVP+   +LT++ G D +++  ++   
Sbjct: 72  L-----VTRMNLESAITPEMIDFACDIKPHDVCLVPERREELTTEGGLDVVRSFDIVASA 126

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL + G R+SLF D    E  + AA  TGA  IEL+TG Y   ++     R  L ++ 
Sbjct: 127 VERLTDAGIRVSLFID--PEEEQIIAAHETGAPVIELHTGRYANAFDESSL-RHELERVK 183

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              +   K  L++NAGH L   N+   I AI  I+E+++GHA  A A+  G ++A+
Sbjct: 184 AGVEEGIKNGLKVNAGHGLHYANVLP-IAAIDGIAELNIGHAIVAQAVFDGWEKAI 238


>gi|107100234|ref|ZP_01364152.1| hypothetical protein PaerPA_01001257 [Pseudomonas aeruginosa PACS2]
          Length = 238

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 76/233 (32%), Positives = 125/233 (53%), Gaps = 9/233 (3%)

Query: 7   VNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDE 66
           +N++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+  ++ ++  
Sbjct: 1   MNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQERDVRVLKEVL-- 58

Query: 67  QFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVAR 126
              +  +N E    E  L   E  +P    LVP+   +LT++ G D    +  +   V R
Sbjct: 59  ---QTRMNFEMGVTEEMLAFAEEIRPAHSCLVPERREELTTEGGLDVAGQEQRIRDAVRR 115

Query: 127 LHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITA 186
           L  +GS +SLF D +  +  ++A+   GA  IEL+TG Y A   +P+++   L ++    
Sbjct: 116 LAAVGSEVSLFIDPDPRQ--IEASARVGAPAIELHTGRY-ADAEDPEEQARELQRVREGV 172

Query: 187 QLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            L + + L +NAGH L   N+   + AI  I+E+++GHA  A AL  G ++AV
Sbjct: 173 ALGRSLGLIVNAGHGLHYHNVEP-VAAIDGINELNIGHAIVAHALFVGFRQAV 224


>gi|315127394|ref|YP_004069397.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudoalteromonas
           sp. SM9913]
 gi|315015908|gb|ADT69246.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudoalteromonas
           sp. SM9913]
          Length = 243

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 123/240 (51%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P+ VH   +A  +GA G+T+H R D+RHI+  D+  + + I
Sbjct: 6   LGVNVDHIATLRQARGTSYPDPVHAASVAEHAGADGITIHLREDRRHIQDRDVYVMAKTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    KPE + LVP+   +LT++ G D   N   +    
Sbjct: 66  -----QTRMNLETAVTDEMIAIALEVKPEYVCLVPEKREELTTEGGLDVAGNIDKIAAAT 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G ++SLF D +  +  L AAK  GA  +E++TG Y    N+    +  L  +  
Sbjct: 121 KTLTQAGIKVSLFIDADKAQ--LDAAKACGAPYVEIHTGAYADATNDEDTAK-ELEHIRQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             + A  + L +NAGH L   N+   I A+P I E+++GHA  A A   G+ +AV   +R
Sbjct: 178 GVKYAASIGLIVNAGHGLHYHNVKP-IAAMPEIYELNIGHAIIARAAIDGLDKAVRDMKR 236


>gi|71892312|ref|YP_278046.1| pyridoxine 5'-phosphate synthase [Candidatus Blochmannia
           pennsylvanicus str. BPEN]
 gi|91207222|sp|Q492D2|PDXJ_BLOPB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|71796418|gb|AAZ41169.1| putative pyridoxal phosphate biosynthetic protein [Candidatus
           Blochmannia pennsylvanicus str. BPEN]
          Length = 244

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 123/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN RN  +P+ ++   IA QSGA  +T+H R D+RHI   D+  + + I
Sbjct: 6   LGVNIDHIATLRNARNTTYPDPIYAAFIAEQSGADSITIHLREDRRHITDRDVEMLCKTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +N+    KP    LVP+   +LT++ G D +     L   +
Sbjct: 66  -----QTSMNLEIAATDEMINIACTLKPHCCCLVPERRQELTTEGGLDIINKANKLQDII 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G R+SLF D   NE  +  A   GA  IEL+TG Y    +   Q   +  ++  
Sbjct: 121 FKLTEAGIRVSLFID--PNEQQISVAYNIGAPYIELHTGMYSHATDATTQNLEY-KRIKK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           + Q A    L++NAGH L   N+   I  +P I E+++GHA  + ++ CG+ +A+
Sbjct: 178 SVQYAVNKGLKVNAGHGLNYYNV-RPIAMLPGIQELNIGHAIISRSIFCGLPKAI 231


>gi|149926463|ref|ZP_01914724.1| pyridoxal phosphate biosynthetic protein PdxJ [Limnobacter sp.
           MED105]
 gi|149824826|gb|EDM84040.1| pyridoxal phosphate biosynthetic protein PdxJ [Limnobacter sp.
           MED105]
          Length = 246

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 127/236 (53%), Gaps = 10/236 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +R  R    P+ +    +A + GA  +TVH R D+RH++  D+  IR L
Sbjct: 3   ELGVNIDHVATIRQARRGHEPDPLRAALLAEEYGADAITVHVREDRRHMQDDDVRRIRPL 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I  +     +N E    E  + L E  KP+ +  VP+   ++T++ G D +    L+   
Sbjct: 63  ISTR-----MNFECAVVEEMIRLVEDVKPQDVCFVPERREEVTTEGGLDVIGGFHLIAPA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           VARL + G RISLF D + ++  ++AA   GAD IEL+TG Y     +  +  + L+++ 
Sbjct: 118 VARLKDQGMRISLFIDPDLDQ--IEAALKCGADAIELHTGRYAHALGSAVE--LELSRIR 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            +A       L++NAGH L   N+   + AI  ISE+++GH+  A A+  G + A+
Sbjct: 174 KSANFGVAEGLRVNAGHGLNYDNV-QPVAAIETISELNIGHSIVANAVFMGWEGAI 228


>gi|307132115|ref|YP_003884131.1| pyridoxine 5'-phosphate synthase [Dickeya dadantii 3937]
 gi|306529644|gb|ADM99574.1| pyridoxine 5'-phosphate synthase [Dickeya dadantii 3937]
          Length = 243

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 123/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRLLRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  L +    KP    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMLAIACELKPHFCCLVPEKRQEVTTEGGLDVAGQLDRITAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G ++SLF D    +  + AA  +GA  IE++TG Y     +  +++ F  ++  
Sbjct: 121 TQLRQAGIQVSLFIDAGRTQ--IDAAVASGAPYIEIHTGAYADAQTDAARQQEF-ERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    +++NAGH LT  NI   I A+P + E+++GHA    A+  G+  AV
Sbjct: 178 AAAYAASRGIKVNAGHGLTYHNIQP-IAALPEMHELNIGHAIIGRAVMSGLASAV 231


>gi|78188462|ref|YP_378800.1| pyridoxine 5'-phosphate synthase [Chlorobium chlorochromatii CaD3]
 gi|91207228|sp|Q3ATB8|PDXJ_CHLCH RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|78170661|gb|ABB27757.1| pyridoxine 5'-phosphate synthase [Chlorobium chlorochromatii CaD3]
          Length = 235

 Score =  120 bits (300), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 125/235 (53%), Gaps = 10/235 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           ++VN++ VA LRN R    P+ V    IA Q+GA+G+  H R D+RHI+  DL  +R  +
Sbjct: 3   LAVNIDHVATLRNARGEFHPDPVEAALIAEQAGAAGIVCHLREDRRHIKDDDLRRLRAAV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                  +L++E    E    +    KPE ITLVP+   +LT++ G+D +++   L   +
Sbjct: 63  -----TTKLDLEMAMTEELQAIALATKPELITLVPEKREELTTEGGFDIVRHFDTLKAYL 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
               + G  +SLF +   ++ +++ A   GAD +EL+TG Y       Q+E   L ++  
Sbjct: 118 QPFRSAGIEVSLFIE--PDKQAIELAAQAGADIVELHTGLYALKAGEAQEEE--LTRIGN 173

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A+ + L++ AGH L   NI    N I  I E+S+GHA    A+  G++ AV
Sbjct: 174 AAAFARNIGLKVVAGHGLNYSNIAPFRN-IVEIEEVSIGHAIITRAIFSGLEGAV 227


>gi|22125200|ref|NP_668623.1| pyridoxine 5'-phosphate synthase [Yersinia pestis KIM 10]
 gi|45442307|ref|NP_993846.1| pyridoxine 5'-phosphate synthase [Yersinia pestis biovar Microtus
           str. 91001]
 gi|108808363|ref|YP_652279.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Antiqua]
 gi|108811372|ref|YP_647139.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Nepal516]
 gi|145598834|ref|YP_001162910.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Pestoides F]
 gi|149365385|ref|ZP_01887420.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           CA88-4125]
 gi|162421936|ref|YP_001607938.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Angola]
 gi|165928251|ref|ZP_02224083.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165939268|ref|ZP_02227818.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|166008092|ref|ZP_02228990.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166212341|ref|ZP_02238376.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|167398788|ref|ZP_02304312.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167421352|ref|ZP_02313105.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167423609|ref|ZP_02315362.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|167467709|ref|ZP_02332413.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           FV-1]
 gi|170023438|ref|YP_001719943.1| pyridoxine 5'-phosphate synthase [Yersinia pseudotuberculosis
           YPIII]
 gi|218929985|ref|YP_002347860.1| pyridoxine 5'-phosphate synthase [Yersinia pestis CO92]
 gi|229838514|ref|ZP_04458673.1| pyridoxine 5'-phosphate synthase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229895520|ref|ZP_04510691.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Pestoides A]
 gi|229899083|ref|ZP_04514227.1| pyridoxine 5'-phosphate synthase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229901622|ref|ZP_04516744.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Nepal516]
 gi|270489811|ref|ZP_06206885.1| pyridoxine 5'-phosphate synthase [Yersinia pestis KIM D27]
 gi|294504514|ref|YP_003568576.1| pyridoxal phosphate biosynthetic protein [Yersinia pestis Z176003]
 gi|20139009|sp|Q8ZCP4|PDXJ_YERPE RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|21958065|gb|AAM84874.1|AE013732_6 pyridoxine biosynthesis [Yersinia pestis KIM 10]
 gi|45437171|gb|AAS62723.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Microtus str. 91001]
 gi|108775020|gb|ABG17539.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           Nepal516]
 gi|108780276|gb|ABG14334.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           Antiqua]
 gi|115348596|emb|CAL21538.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           CO92]
 gi|145210530|gb|ABP39937.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           Pestoides F]
 gi|149291798|gb|EDM41872.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           CA88-4125]
 gi|162354751|gb|ABX88699.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           Angola]
 gi|165912868|gb|EDR31495.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Orientalis str. IP275]
 gi|165919758|gb|EDR37091.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Orientalis str. F1991016]
 gi|165992474|gb|EDR44775.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Antiqua str. E1979001]
 gi|166206272|gb|EDR50752.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Antiqua str. B42003004]
 gi|166960841|gb|EDR56862.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Orientalis str. MG05-1020]
 gi|167051292|gb|EDR62700.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Antiqua str. UG05-0454]
 gi|167057779|gb|EDR67525.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia pestis
           biovar Mediaevalis str. K1973002]
 gi|169749972|gb|ACA67490.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia
           pseudotuberculosis YPIII]
 gi|229681551|gb|EEO77645.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Nepal516]
 gi|229688028|gb|EEO80100.1| pyridoxine 5'-phosphate synthase [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229694880|gb|EEO84927.1| pyridoxine 5'-phosphate synthase [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229701326|gb|EEO89354.1| pyridoxine 5'-phosphate synthase [Yersinia pestis Pestoides A]
 gi|262362494|gb|ACY59215.1| pyridoxal phosphate biosynthetic protein [Yersinia pestis D106004]
 gi|262366501|gb|ACY63058.1| pyridoxal phosphate biosynthetic protein [Yersinia pestis D182038]
 gi|270338315|gb|EFA49092.1| pyridoxine 5'-phosphate synthase [Yersinia pestis KIM D27]
 gi|294354973|gb|ADE65314.1| pyridoxal phosphate biosynthetic protein [Yersinia pestis Z176003]
 gi|320016072|gb|ADV99643.1| pyridoxine 5'-phosphate synthase [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 243

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++    KP    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVDIACDIKPHFCCLVPEKRQEVTTEGGLDVAGQVDKMTLAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL ++G  +SLF D +  +  + AA   GA  IE++TG Y A  +   + +  L ++A 
Sbjct: 121 GRLADVGILVSLFIDADFRQ--IDAAVAAGAPYIEIHTGAY-ADASTVLERQAELMRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMTGLAAAV 231


>gi|313673400|ref|YP_004051511.1| pyridoxine 5'-phosphate synthase [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312940156|gb|ADR19348.1| pyridoxine 5'-phosphate synthase [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 243

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 126/237 (53%), Gaps = 11/237 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +R  R    P+ VH   +A   GA G+TVH R D+RHI   DL  +R  
Sbjct: 3   KLGVNIDHVATVRQARRGKEPDPVHAAVLAELGGADGITVHLREDRRHIHDRDLFILRDT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     K +LN+E   N+  +N+    KP+  TLVP+   +LT++ G D + N   + +T
Sbjct: 63  V-----KVKLNLEMATNDEIINIALSVKPDICTLVPEKREELTTEGGLDVIHNFDRVART 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLNKL 182
           V  L + G  +S+F D +  +  ++ A  TGA  IE++TG Y  A   +   E   L K+
Sbjct: 118 VEILKSNGIEVSIFIDPDKKQ--IEKAVETGARYIEIHTGRYADATTEDESLEE--LKKI 173

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              ++ A  +   +NAGH L  +N+  L    P+  E ++GH+  + ++  G+K+AV
Sbjct: 174 EAASKYAADLGFVVNAGHGLNYKNVIPLCRIFPF-HEFNIGHSIISKSILVGLKDAV 229


>gi|51597203|ref|YP_071394.1| pyridoxine 5'-phosphate synthase [Yersinia pseudotuberculosis IP
           32953]
 gi|186896300|ref|YP_001873412.1| pyridoxine 5'-phosphate synthase [Yersinia pseudotuberculosis
           PB1/+]
 gi|91207578|sp|Q3V7P0|PDXJ_YERPS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|51590485|emb|CAH22125.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia
           pseudotuberculosis IP 32953]
 gi|186699326|gb|ACC89955.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia
           pseudotuberculosis PB1/+]
          Length = 243

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++    KP    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVDIACDIKPHFCCLVPEKRQEVTTEGGLDVAGQVDKMTLVV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL ++G  +SLF D +  +  + AA   GA  IE++TG Y A  +   + +  L ++A 
Sbjct: 121 GRLADVGILVSLFIDADFRQ--IDAAVAAGAPYIEIHTGAY-ADASTVLERQAELMRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMTGLATAV 231


>gi|226951496|ref|ZP_03821960.1| pyridoxal phosphate biosynthesis protein [Acinetobacter sp. ATCC
           27244]
 gi|294651018|ref|ZP_06728358.1| pyridoxine 5'-phosphate synthase [Acinetobacter haemolyticus ATCC
           19194]
 gi|226837789|gb|EEH70172.1| pyridoxal phosphate biosynthesis protein [Acinetobacter sp. ATCC
           27244]
 gi|292823119|gb|EFF81982.1| pyridoxine 5'-phosphate synthase [Acinetobacter haemolyticus ATCC
           19194]
          Length = 242

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 129/245 (52%), Gaps = 9/245 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    +  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAAILGVNIDHVATLRQARGTVYPDPVQAALVCEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + +   +
Sbjct: 61  RPLL-----KTRMNLELAVTDEMVAFAQEIQPQHVCFVPERRQEVTTEGGLDVVGHFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +GS +SLF D +  +  + AA   GA  IE++TG Y     + QQ+   L 
Sbjct: 116 KAATEALKAIGSDVSLFIDADLAQ--IDAAVACGAPTIEIHTGAYADAETDEQQQA-ELA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++   A+ A    L +NAGH L + N+   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIIKGAEYAASKGLVVNAGHGLNLNNVAP-IAAIPQIHELNIGHSIIADSVFVGLAQAVK 231

Query: 241 CFRRA 245
             + A
Sbjct: 232 DMKAA 236


>gi|110834489|ref|YP_693348.1| pyridoxine 5'-phosphate synthase [Alcanivorax borkumensis SK2]
 gi|122959429|sp|Q0VP22|PDXJ_ALCBS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|110647600|emb|CAL17076.1| pyridoxal phosphate biosynthetic protein PdxJ [Alcanivorax
           borkumensis SK2]
          Length = 244

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 82/240 (34%), Positives = 124/240 (51%), Gaps = 11/240 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P  V    +A Q+GA G+TVH R D+RHI   D+  +    
Sbjct: 9   LGVNIDHIATLRQARGTRYPEPVQAALVAEQAGADGITVHLREDRRHINDRDVELL---- 64

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    E  + +  R +P    LVP+   +LT++ G D + N+A + +  
Sbjct: 65  -AQTLQTRMNLEMAATEEMVVIACRIQPPHCCLVPEKREELTTEGGLDVVGNKAWIAQCC 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLNKLA 183
            RL   G  +SLF D    E  + AA+  GA  IE++TG Y  A   + QQ+ +   + A
Sbjct: 124 QRLGQAGIEVSLFID--AEESQILAARECGAPAIEIHTGGYADAQTIDQQQQELARIRSA 181

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
           +   LAQ   L +NAGH L   N    I  IP I+E+++GH+  A A   G+ EAV   R
Sbjct: 182 VAFALAQ--GLIVNAGHGLHYHNTLA-IAEIPGINELNIGHSIIARAAITGLDEAVRSMR 238


>gi|119383176|ref|YP_914232.1| pyridoxal phosphate biosynthetic protein PdxJ [Paracoccus
           denitrificans PD1222]
 gi|119372943|gb|ABL68536.1| pyridoxine 5'-phosphate synthase [Paracoccus denitrificans PD1222]
          Length = 244

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 81/246 (32%), Positives = 128/246 (52%), Gaps = 18/246 (7%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R  PWP+ V   K+A ++GA G+T H R D+RHI   D   I RL+
Sbjct: 4   LGVNIDHVATIRNARGTPWPDPVRAAKLAEEAGADGITAHLREDRRHISDGD---IDRLM 60

Query: 65  DE-QFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +    P   LN+E         +  R++P  + +VP+   + T++ G D   N+A L   
Sbjct: 61  ESLHLP---LNLEMAATAEMQAIALRHRPHAVCIVPEKREERTTEGGLDVAGNEAFLADF 117

Query: 124 VARLHNLGSRISLFADGNGNEHS-LQAAKLTGADCIELYTGPYGACYNNPQ----QERIF 178
           +A L   G R+SLF    G+E   ++AA   GA  +EL+TG Y  C  + +    +  + 
Sbjct: 118 IAPLREAGCRVSLFI---GHEQDQIEAAARIGAAVVELHTGAY--CDFDTEGRLAERDLE 172

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           L  L   A  A  + L+++AGH LT   +   I AI  + E+++GH   A ++  G+  A
Sbjct: 173 LEALRRGAAQAHLLGLEVHAGHGLTFDTV-GPIAAISELRELNIGHFLIAESVFLGLGPA 231

Query: 239 VFCFRR 244
           +   RR
Sbjct: 232 IREMRR 237


>gi|54310184|ref|YP_131204.1| pyridoxine 5'-phosphate synthase [Photobacterium profundum SS9]
 gi|91207554|sp|Q3V7I6|PDXJ_PHOPR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|46914625|emb|CAG21402.1| putative pyridoxal phosphate biosyntheticprotein PdxJ
           [Photobacterium profundum SS9]
          Length = 243

 Score =  120 bits (300), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 129/235 (54%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ VH  ++A ++GA G+TVH R D+RHI   D+    R++
Sbjct: 6   LGVNIDHIATLRNARGTRYPDPVHAAEVAERAGADGITVHLREDRRHINDRDV----RIL 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            E   +  +N+E    +  +++    KPE + LVP+   +LT++ G D       +    
Sbjct: 62  KETI-QTRMNLEMAVTDEMVSIALDTKPEFVCLVPEKREELTTEGGLDVAGQLEKIKAAT 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L + G ++SLF D +  +  + A    GA  +EL+TG Y A     + ++  L K+A 
Sbjct: 121 QKLTDAGIKVSLFIDADRAQ--IDATLACGAPFVELHTGHY-ADAETEEAQQAELEKIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + +++NAGH LT  N+   I A+P + E+++GH+  + A   G+ +AV
Sbjct: 178 AATYAHGLGIKVNAGHGLTYHNVKP-IAALPELYELNIGHSIISRAAFDGLNKAV 231


>gi|319779584|ref|YP_004130497.1| Pyridoxine 5'-phosphate synthase [Taylorella equigenitalis MCE9]
 gi|317109608|gb|ADU92354.1| Pyridoxine 5'-phosphate synthase [Taylorella equigenitalis MCE9]
          Length = 254

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/238 (31%), Positives = 134/238 (56%), Gaps = 12/238 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR-RL 63
           + VN++ VA LR +R   +P+ +    +A  +GA  +T+H R D+RHI+  D+ E++ RL
Sbjct: 10  LGVNIDHVATLRQQRGTLYPDPIEAALLAESAGADFITLHLREDRRHIQDKDVFEMKDRL 69

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        +N+E    E  L++  + KP+ + LVP+   +LT++ G D + +  L+   
Sbjct: 70  L------THMNLECAITEEMLSIAIKAKPKDVCLVPEKREELTTEGGLDVVTHFDLIKSA 123

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI--FLNK 181
           V++L + G R+SLF D + N+  ++AA   G   IEL+TG Y    +      +   L +
Sbjct: 124 VSKLSDSGIRVSLFIDPDVNQ--IKAAYDAGTKIIELHTGAYAELSDKSSGAEVNTELER 181

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           L    + A+ + L++NAGH L  +N+  +I  +  ISE+++GH+  A ++  G+ +AV
Sbjct: 182 LKTCIREAKTLGLKVNAGHGLNFKNVVPIIK-LEGISELNIGHSLIAQSVFDGLYKAV 238


>gi|268593247|ref|ZP_06127468.1| pyridoxine 5'-phosphate synthase [Providencia rettgeri DSM 1131]
 gi|291311142|gb|EFE51595.1| pyridoxine 5'-phosphate synthase [Providencia rettgeri DSM 1131]
          Length = 243

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 125/240 (52%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+     L+
Sbjct: 6   LGVNIDHIATVRNARGTQYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDIT----LL 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           +E   +  +N+E    +  + +  R KP    LVP+   ++T++ G D    +  +   V
Sbjct: 62  NETI-QTRMNLEMAVTDEMVEIACRIKPTFCCLVPEKREEVTTEGGLDVAGQKQKVADAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D   +   + AA+  GA  IE++TG Y    +  +QE  F  ++  
Sbjct: 121 KRLTEAGILVSLFID--ADHQQIDAAQECGAPFIEIHTGAYADAKSEQEQELEF-RRIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A    +++NAGH LT  N+   I  +P I E+++GHA    AL  G+ +AV   ++
Sbjct: 178 GAVYAASKGIKVNAGHGLTYHNVQR-IAQLPEIYELNIGHAIIGRALFSGLAQAVTDMKK 236


>gi|227112904|ref|ZP_03826560.1| pyridoxine 5'-phosphate synthase [Pectobacterium carotovorum subsp.
           brasiliensis PBR1692]
          Length = 243

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 80/236 (33%), Positives = 127/236 (53%), Gaps = 11/236 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+    R++
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDV----RIL 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            E   +  +N+E    E  LN+    KP    LVP+   ++T++ G D    Q  +   V
Sbjct: 62  RETL-QTRMNLEMAVTEEMLNIACEVKPHFCCLVPEKRQEVTTEGGLDVAGQQEKIDNAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL      +SLF D   ++  + AA  +GA  IE++TG Y    ++  ++  F  ++  
Sbjct: 121 ARLSQANILVSLFID--ADKRQIDAAVASGAPYIEIHTGAYADAPDDAARQHEF-ERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNI-PNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+ P  I A+P + E+++GHA    A+  G+K+AV
Sbjct: 178 AATYAAAKGLKVNAGHGLTYHNVLP--IAALPEMHELNIGHAIIGRAVMSGLKDAV 231


>gi|215261426|pdb|3F4N|A Chain A, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261427|pdb|3F4N|B Chain B, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261428|pdb|3F4N|C Chain C, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261429|pdb|3F4N|D Chain D, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261430|pdb|3F4N|E Chain E, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261431|pdb|3F4N|F Chain F, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261432|pdb|3F4N|G Chain G, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
 gi|215261433|pdb|3F4N|H Chain H, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein Pdxj From Yersinia Pestis
          Length = 246

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 9   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTI 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++    KP    LVP+   ++T++ G D       +T  V
Sbjct: 69  -----QTRMNLEMAVTDEMVDIACDIKPHFCCLVPEKRQEVTTEGGLDVAGQVDKMTLAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL ++G  +SLF D +  +  + AA   GA  IE++TG Y A  +   + +  L ++A 
Sbjct: 124 GRLADVGILVSLFIDADFRQ--IDAAVAAGAPYIEIHTGAY-ADASTVLERQAELMRIAK 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV
Sbjct: 181 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMTGLAAAV 234


>gi|302342383|ref|YP_003806912.1| pyridoxal phosphate biosynthetic protein PdxJ [Desulfarculus
           baarsii DSM 2075]
 gi|301638996|gb|ADK84318.1| pyridoxal phosphate biosynthetic protein PdxJ [Desulfarculus
           baarsii DSM 2075]
          Length = 252

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 129/235 (54%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +SVN++ VA LR  R +  P+ V    +A ++GA G+ VH R D+RHI+  DL  +R+++
Sbjct: 4   LSVNVDHVATLRQARGIDEPDPVWAAVLAEKAGADGIIVHLREDRRHIQDRDLRVLRQVV 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  LN+E    E  + +     P+  TLVP+   +LT++ G +   N   +   +
Sbjct: 64  -----KGALNMEMAATEEMIGIAAEVGPQICTLVPERRQELTTEGGLEVKGNLDYMRDVI 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           A+L+     +SLF D +  +  ++AA + GA  +EL+TG Y        + +  L+ L  
Sbjct: 119 AQLNQADIEVSLFIDPHPEQ--VKAAHMAGAQVVELHTGAYANAAGEAARLK-LLSALED 175

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A+LA ++ +++ AGH L ++N+  L+  IP I E S+GH+  A AL  G + AV
Sbjct: 176 AARLAARVGMRVAAGHGLNLRNVAPLLK-IPEIVEYSIGHSIVARALFVGFESAV 229


>gi|153948330|ref|YP_001400120.1| pyridoxine 5'-phosphate synthase [Yersinia pseudotuberculosis IP
           31758]
 gi|152959825|gb|ABS47286.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia
           pseudotuberculosis IP 31758]
          Length = 243

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++    KP    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVDIACDIKPHFCCLVPEKRQEVTTEGGLDVAGQVDKMTLAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL ++G  +SLF D +  +  + AA   GA  IE++TG Y A  +   + +  L ++A 
Sbjct: 121 GRLADVGILVSLFIDADFRQ--IDAAVAAGAPYIEIHTGAY-ADASTVLERQAELMRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMTGLATAV 231


>gi|85059762|ref|YP_455464.1| pyridoxal phosphate biosynthetic protein PdxJ [Sodalis glossinidius
           str. 'morsitans']
 gi|84780282|dbj|BAE75059.1| pyridoxal phosphate biosynthetic protein [Sodalis glossinidius str.
           'morsitans']
          Length = 243

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/240 (31%), Positives = 125/240 (52%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R + WP+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGVAWPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVQLLRKTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  +++     P    LVP+   ++T++ G D       L + V
Sbjct: 66  -----QTRMNLEMAVTEEMISIACDVAPHFCCLVPEKRQEVTTEGGLDVAGQPDKLRQAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G ++SLF D   +E  + AA   GA  IE++TG Y    +   +   F  ++  
Sbjct: 121 TCLSAAGIQVSLFID--ADERQIAAAADVGAPYIEIHTGAYADATDEVSRAVEF-ARIRQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A K+ L++NAGH L   N+   + A+  + E+++GHA  + A+  G+ +AV   +R
Sbjct: 178 GADFAVKLGLKVNAGHGLDYHNVKP-VAALAQMQELNIGHAIISRAVIGGLADAVRDMKR 236


>gi|149185999|ref|ZP_01864314.1| pyridoxal phosphate biosynthesis protein [Erythrobacter sp. SD-21]
 gi|148830560|gb|EDL48996.1| pyridoxal phosphate biosynthesis protein [Erythrobacter sp. SD-21]
          Length = 246

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 79/241 (32%), Positives = 121/241 (50%), Gaps = 10/241 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R    P+ V   +I    G  G+T H R D+RHIR  DL  I+   
Sbjct: 7   LGVNIDHVATIRNARGGDHPDPVRAAEIVASVGGDGITAHLREDRRHIRDADLKRIQEAT 66

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D   P   LN+E    E  L +  R+ P    +VP+   + T++ G D       L   V
Sbjct: 67  D--LP---LNLEMAATEEMLEIALRHAPHAACIVPEKREERTTEGGLDAAGQHNTLAPIV 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF--LNKL 182
            +L + G R+SLF +  G+E  L AA   G   +E +TG Y   +     E+    L ++
Sbjct: 122 WKLRDNGIRVSLFIE--GDERQLDAALRLGVPVVEFHTGEYAHAHLAGDSEKTARELKRI 179

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  + LA K  ++ +AGH LT +N+   I AIP ++E+++GH     A+  G++ AV   
Sbjct: 180 ADMSALAAKNGIEPHAGHGLTYENV-QPIAAIPQLAELNIGHYLVGEAVFVGLENAVRQM 238

Query: 243 R 243
           R
Sbjct: 239 R 239


>gi|332970681|gb|EGK09662.1| pyridoxal phosphate biosynthetic protein PdxJ [Kingella kingae ATCC
           23330]
          Length = 242

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 77/242 (31%), Positives = 127/242 (52%), Gaps = 9/242 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ VA LRN R + +P+ +    IA   GA+ +T+H R D+RHI+  D+  I++ I
Sbjct: 3   LGINIDHVATLRNARGVSYPSPLEAALIAETHGANLITLHLREDRRHIKDADVFAIKQAI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  LN+E    E  L      +PE + +VP+   ++T++ G D +  Q  +   V
Sbjct: 63  -----RTRLNLEMAMTEEMLANALVVQPEDVCIVPEKREEVTTEGGLDVIAQQDKVRFYV 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L     R+S+F     ++  +QAA   GA  IEL+TG Y A    P Q      ++A 
Sbjct: 118 EKLQAASIRVSIFI--GADKAQIQAAYDAGARVIELHTGAY-ADAETPAQREQERQRIAE 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A  + + +NAGH LTI N+   I  IP I E+++GH+  A A+  G+  A+   + 
Sbjct: 175 AAKFAASLGMTVNAGHGLTIHNVAP-IAQIPEIVELNIGHSIIAQAVFLGLPAAITQMKD 233

Query: 245 AC 246
           A 
Sbjct: 234 AM 235


>gi|87311245|ref|ZP_01093367.1| pyridoxal phosphate biosynthetic protein [Blastopirellula marina
           DSM 3645]
 gi|87285985|gb|EAQ77897.1| pyridoxal phosphate biosynthetic protein [Blastopirellula marina
           DSM 3645]
          Length = 237

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 126/236 (53%), Gaps = 10/236 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ VA +R  R    P+ V    +A   GA  +T+H R D+RHI+  DL  IR  
Sbjct: 3   NLGVNIDHVATVRQARQTNEPDPVWAAALAEMGGADCITLHLREDRRHIQDRDLRIIR-- 60

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +  K ++N+E    E  L +    KP+Q+TLVP+   ++T++ G D L+    +   
Sbjct: 61  ---ETAKVKVNLELATAEEVLKIACEVKPDQVTLVPEKREEVTTEGGLDLLRQPEKVKAA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           + RL + G  +SLF D    +  L  AK  GA  +EL+TG +     + Q   I   KL 
Sbjct: 118 IERLQDAGIAVSLFLDPEPAQ--LLMAKKLGATAVELHTGQFALTRGDAQLAEI--EKLT 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              Q   ++ L++ AGH LT  N+   I AIP +SE+++GH+  A ++  G+++AV
Sbjct: 174 QAGQQICELGLELLAGHGLTYSNVLP-IAAIPKMSELNIGHSIIARSIMVGLQQAV 228


>gi|304413542|ref|ZP_07395015.1| pyridoxine 5'-phosphate synthase [Candidatus Regiella insecticola
           LSR1]
 gi|304284385|gb|EFL92778.1| pyridoxine 5'-phosphate synthase [Candidatus Regiella insecticola
           LSR1]
          Length = 252

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 127/236 (53%), Gaps = 12/236 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ +    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 8   LGVNIDHIATLRNARGTNYPDPIFAAGIAEQAGADGITVHLREDRRHITDPDVELLRKTI 67

Query: 65  DEQFPKAELNIE-GYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
             +     +N+E     E   N C+  KP    LVP++  ++T++ G + +     +T  
Sbjct: 68  STR-----MNLEMAVTKEMIDNACQ-LKPHFCCLVPENRQEITTEGGLNVVDQLETITAA 121

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL  +G ++SLF D + ++  + AA  TG   IE++TG Y       +     L ++ 
Sbjct: 122 VERLSAVGIQVSLFIDADNDQ--IDAAVKTGTPYIEIHTGAYAEAAELDRDNE--LERIT 177

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             A+ A    L++NAGH L   N+ + I A+P I E+++GHA  + A+  G+  A+
Sbjct: 178 KAARYATAQGLKVNAGHGLHYHNVKS-IAALPEIHELNIGHAIISRAVITGLDAAI 232


>gi|32468416|emb|CAD88338.1| GdpxJ protein [Porphyromonas gingivalis]
          Length = 126

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 84/132 (63%), Gaps = 7/132 (5%)

Query: 40  GLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVP 99
           G+TVHPRPD+RHIR +D+ ++++ +      +E NIEG P+E F+ L E  +PEQ+T+VP
Sbjct: 1   GITVHPRPDERHIRRSDVYDLKKAL-----TSEFNIEGNPDERFIRLIEEIRPEQVTMVP 55

Query: 100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE 159
           D P  LTS+ GWD  +N   L + V + H  G R S+F D + +  ++  A  TG D IE
Sbjct: 56  DAPDVLTSNAGWDVARNYDHLCRLVEQFHAWGIRTSIFIDTDLD--NISWAAKTGTDRIE 113

Query: 160 LYTGPYGACYNN 171
           LYT PY A Y+ 
Sbjct: 114 LYTEPYAAAYHK 125


>gi|262373074|ref|ZP_06066353.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter junii
           SH205]
 gi|262313099|gb|EEY94184.1| pyridoxal phosphate biosynthesis protein PdxJ [Acinetobacter junii
           SH205]
          Length = 242

 Score =  119 bits (299), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 74/245 (30%), Positives = 127/245 (51%), Gaps = 9/245 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  ++GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAAILGVNIDHVATLRQARGTTYPDPVQAALICEEAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     K  +N+E    +  +   +  KP+ +  VP+   ++T++ G D + +   +
Sbjct: 61  RPLL-----KTRMNLELAVTDEMVEFAKEIKPQHVCFVPERRQEVTTEGGLDVVGHFDKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +GS +SLF D +  +  + AA   GA  IE++TG Y       +Q    L 
Sbjct: 116 KAATEALKAIGSDVSLFIDADFAQ--IDAAVACGAPTIEIHTGAYADAETEAEQ-HAELE 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++   A+ A    L +NAGH L + N+   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIIKGAEYAAAKGLVVNAGHGLNLNNVAP-IAAIPQIHELNIGHSIIADSIFVGLAQAVK 231

Query: 241 CFRRA 245
             + A
Sbjct: 232 DMKAA 236


>gi|296284259|ref|ZP_06862257.1| pyridoxine 5'-phosphate synthase [Citromicrobium bathyomarinum
           JL354]
          Length = 246

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 83/241 (34%), Positives = 127/241 (52%), Gaps = 14/241 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R    P+ V   +I    G  G+T H R D+RHIR  DL  I+   
Sbjct: 11  LGVNIDHVATIRNARGGDHPDPVRAAQIVAAVGGDGITAHLREDRRHIRDDDLRRIQDAT 70

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDF--LQNQALLTK 122
           D   P   LN+E    E  L +  R++P    +VP+   + T++ G D   L NQ  L  
Sbjct: 71  D--LP---LNLEMAATEEMLAIALRHQPHAACIVPEKREERTTEGGLDAAGLHNQ--LAP 123

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V++L + G R+SLF + +  +  L+AA   GA  +E +TG Y   +   +Q  I L ++
Sbjct: 124 IVSQLTDAGIRVSLFIEAHPAQ--LEAAMRLGAPVVEFHTGEY--AHATGEQRSIELKRI 179

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A LA K  ++ +AGH LT  N+   I AIP I+E+++GH     A+  G++ A+   
Sbjct: 180 ADMAALAVKNGIEPHAGHGLTFDNV-QPIAAIPQIAELNIGHYLIGEAIFTGLEPAIRRM 238

Query: 243 R 243
           R
Sbjct: 239 R 239


>gi|284006742|emb|CBA71999.1| pyridoxal phosphate biosynthetic protein [Arsenophonus nasoniae]
          Length = 228

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 76/230 (33%), Positives = 120/230 (52%), Gaps = 9/230 (3%)

Query: 15  LRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELN 74
           +RN R   +P+ VH   +A Q+GA G+TVH R D+RHI   D+  +R+ +     +  +N
Sbjct: 1   MRNARGTQYPDPVHAAFLAEQAGADGITVHLREDRRHITDRDVQLLRQTL-----QTRMN 55

Query: 75  IEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRI 134
           +E    +  +N     KP+   LVP+   ++T++ G D    QAL+   V +L   G  +
Sbjct: 56  LEMAITDEMVNFACLIKPQFCCLVPERREEVTTEGGLDVFGQQALVATAVKQLAKAGITV 115

Query: 135 SLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDL 194
           SLF D   N+  + AA   GA  IE++TG Y    +  +QE  F  ++      A   +L
Sbjct: 116 SLFID--PNDKQIDAAVEIGAPFIEIHTGAYANAKSQLKQEEEF-KRIKQAVSHATAKNL 172

Query: 195 QINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
           ++NAGH LT  N+   I  +P I E+++GHA    AL  G+  AV   ++
Sbjct: 173 KVNAGHGLTYHNV-QPIAQLPDIYELNIGHAIIGRALFSGMAAAVSDMKK 221


>gi|221135232|ref|ZP_03561535.1| pyridoxine 5'-phosphate synthase [Glaciecola sp. HTCC2999]
          Length = 254

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 80/239 (33%), Positives = 125/239 (52%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ VH   IA ++GA G+TVH R D+RHI   D+  + R +
Sbjct: 9   LGVNIDHVATLRNARGTSYPDPVHAADIAERAGADGITVHLREDRRHINDRDVEILARTL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           + +     +N+E    +  L + ++ +P    LVP+   +LT++ G +   N + +    
Sbjct: 69  NTR-----MNLEMAVTDEMLAIAKKTQPAFCCLVPEKRAELTTEGGLNVAGNLSRMQDAC 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +SLF D    +  + AA       IE++TG Y    +  QQ +  L KL  
Sbjct: 124 GQLAEQGILVSLFIDAEPEQ--IDAAVACDVPYIEIHTGQYADATSIKQQTQ-ELAKLKA 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
             Q A +  LQ+NAGH L   N+   I AIP I E+++GHA  A A+  G+ +AV   R
Sbjct: 181 GIQFAHQRGLQVNAGHGLHYHNVKP-IAAIPEIVELNIGHAIMARAMFDGLGKAVSDMR 238


>gi|119356502|ref|YP_911146.1| pyridoxine 5'-phosphate synthase [Chlorobium phaeobacteroides DSM
           266]
 gi|166219090|sp|A1BE95|PDXJ_CHLPD RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|119353851|gb|ABL64722.1| pyridoxine 5'-phosphate synthase [Chlorobium phaeobacteroides DSM
           266]
          Length = 236

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 130/237 (54%), Gaps = 13/237 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           ++VN++ +A LRN R    P+ V    +A + GA+G+  H R D+RHI+  DL  +R  +
Sbjct: 3   LAVNIDHIATLRNARGEQEPDPVAAALLAERCGAAGIVCHLREDRRHIKDLDLARLREAV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +    E+ + G   E  L    + KPE ITLVP+   +LT++ G+D  ++ A+L + +
Sbjct: 63  TTKL-DLEMAMTGELQEIAL----KTKPELITLVPEKREELTTEGGFDVARHFAVLKEFL 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG--ACYNNPQQERIFLNKL 182
             L++ G  +SLF +    + ++  A+  GAD +EL+TG Y      NN   E   L ++
Sbjct: 118 KPLNDNGIEVSLFIE--PEKKAVDLAREAGADLVELHTGLYAQKELENNTDLE---LQRI 172

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A  A+ + L++ AGH L  +NI      IP I E+S+GHA  A A+  G+ EAV
Sbjct: 173 REAATYAKSIGLRVVAGHGLNYRNIGPF-REIPEIEEVSIGHAIIARAVFTGLDEAV 228


>gi|189500795|ref|YP_001960265.1| pyridoxine 5'-phosphate synthase [Chlorobium phaeobacteroides BS1]
 gi|238692261|sp|B3ELU3|PDXJ_CHLPB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|189496236|gb|ACE04784.1| pyridoxal phosphate biosynthetic protein PdxJ [Chlorobium
           phaeobacteroides BS1]
          Length = 238

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 125/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           ++VN++ +A LRN RN   P+ V    IA  SGASG+  H R D+RHI+  DL  +R  +
Sbjct: 3   LAVNIDHIATLRNARNEQQPDPVTAAAIAELSGASGIVCHLREDRRHIKDRDLERLRESV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                  +L++E    E    +  R KPE ITLVP+   +LT++ G+D + +   L + +
Sbjct: 63  -----TTKLDLEMAMTEEMQRIAIRTKPELITLVPEKREELTTEGGFDIISHYDRLAEFI 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             + + G  +SLF +    E ++  A   GAD +E++TGPY +    P+     + ++ I
Sbjct: 118 KPVRDAGIEVSLFIE--PEEKAVALAAKAGADIVEMHTGPY-SLKKRPEDIDAEIKRIRI 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A+   L++ AGH L   NI      I  I E+S+GHA  A A   G++ AV
Sbjct: 175 AASYARDSGLRVVAGHGLNYYNILPF-RRIEEIEEVSIGHALIARAALAGMETAV 228


>gi|302878423|ref|YP_003846987.1| pyridoxal phosphate biosynthetic protein PdxJ [Gallionella
           capsiferriformans ES-2]
 gi|302581212|gb|ADL55223.1| pyridoxal phosphate biosynthetic protein PdxJ [Gallionella
           capsiferriformans ES-2]
          Length = 239

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 122/236 (51%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + +N++ VA LR  R   +PNLV    I  ++GA  +T+H R D+RHI+  D+  +R +
Sbjct: 3   KLGLNIDHVATLRQARGARYPNLVRAALICEEAGADAITIHLREDRRHIQDADVEVLRGM 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     +  +N+E    E  +    R KP  + LVP+   +LT++ G + L+    +   
Sbjct: 63  L-----QTRMNLECAVTEEMIANALRIKPHDLCLVPERREELTTEGGLNVLRYFDAVKSA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
             R  + G R+SLF D +  +  + AA   GA  IEL+TG Y    + P +    L ++ 
Sbjct: 118 CERCADAGIRVSLFIDADNAQ--IDAAVRAGAPVIELHTGKYADADSVPARA-YELERIR 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              + A    LQ+NAGH L   N+   I AIP I E+++GHA  A ++  G+  AV
Sbjct: 175 AAVEYAHGQGLQVNAGHGLHYHNV-QAIAAIPNIVELNIGHAIIAESVFIGLDAAV 229


>gi|33519986|ref|NP_878818.1| pyridoxine 5'-phosphate synthase [Candidatus Blochmannia
           floridanus]
 gi|81666892|sp|Q7VRR1|PDXJ_BLOFL RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|33504332|emb|CAD83225.1| pyridoxal phosphate biosynthetic protein [Candidatus Blochmannia
           floridanus]
          Length = 247

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 126/236 (53%), Gaps = 11/236 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +++N++ +A +RN R   +P+ V+   IA QSG  G+TVH R D+RHI   D+  +R ++
Sbjct: 6   LALNIDHIATVRNARGTQYPDPVYAAYIAEQSGIDGITVHLREDRRHITDRDVKLLREIV 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +  + KP    LVP+   +LT++ G D +     +   V
Sbjct: 66  -----QTTMNLEMAATDEMVMIACQLKPHYCCLVPERRRELTTEGGLDLIYQIDKMQNIV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF-LNKLA 183
            +L + G R+SLF D +  +  + A+   G  CIEL TG Y    N  +++RI    ++ 
Sbjct: 121 LKLSDAGIRVSLFIDPDIEQ--IDASYKIGVRCIELNTGKYAESKN--KEDRILEYRRIE 176

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            + + A    L INAGH L   N+   I  +  I E+++GHA  + A+ CG+ +A+
Sbjct: 177 KSIKHALSYGLMINAGHGLNYDNV-KFIAMLSQIRELNIGHAIVSRAVFCGLPKAI 231


>gi|209517219|ref|ZP_03266064.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           H160]
 gi|209502355|gb|EEA02366.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           H160]
          Length = 254

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 124/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+ ++R L+
Sbjct: 13  LGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADAITLHLREDRRHIVDADVRKLRPLL 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E       L++    +P  + LVP+   +LT++ G D       +    
Sbjct: 73  -----KTRMNLECAVTPEMLDIACEVQPHDVCLVPEKREELTTEGGLDVAGQFEAVRAAC 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L +  SR+SLF D    E  ++AA   GA  IEL+TG Y   ++  +Q+R + +++  
Sbjct: 128 KQLADANSRVSLFID--PEETQIRAAHEAGAPVIELHTGRYAEAHDAAEQQREY-DRIVR 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             +    + L++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV
Sbjct: 185 AVEFGATLGLKVNAGHGLHYTNVQQ-IAAIDGIVELNIGHAIVAHAIFAGWDNAV 238


>gi|317491021|ref|ZP_07949457.1| pyridoxal phosphate biosynthesis protein PdxJ [Enterobacteriaceae
           bacterium 9_2_54FAA]
 gi|316920568|gb|EFV41891.1| pyridoxal phosphate biosynthesis protein PdxJ [Enterobacteriaceae
           bacterium 9_2_54FAA]
          Length = 243

 Score =  119 bits (298), Expect = 4e-25,   Method: Compositional matrix adjust.
 Identities = 75/240 (31%), Positives = 128/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRLLRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +     P    LVP+   ++T++ G D       +   V
Sbjct: 66  -----QTRMNLEMAVTDEMIEIACELNPHFCCLVPEKRQEVTTEGGLDVAGQLDKMMVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +  ++AA   GA  IE++TG Y    ++ +++  F  ++A 
Sbjct: 121 ERLTQAGILVSLFIDADPRQ--IEAAVSVGAPYIEIHTGAYADAESDLKRQAEF-ERIAH 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A +  L++NAGH LT  N+   I A+P + E+++GH+    A+  G+ EAV   ++
Sbjct: 178 AARFASERGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHSIIGRAVMSGLPEAVNAMKQ 236


>gi|271501618|ref|YP_003334644.1| pyridoxal phosphate biosynthetic protein PdxJ [Dickeya dadantii
           Ech586]
 gi|270345173|gb|ACZ77938.1| pyridoxal phosphate biosynthetic protein PdxJ [Dickeya dadantii
           Ech586]
          Length = 243

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 125/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ +    +A Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPIQAAFVAEQAGADGITVHLREDRRHITDRDVRLLRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  L +    KP    LVP+   ++T++ G D     A +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMLAIACELKPHFCCLVPEKRQEVTTEGGLDVAGQLARITSAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G ++SLF D +  +  + AA  +GA  IE++TG Y    ++  +++ F  ++  
Sbjct: 121 TQLREAGIQVSLFIDADRTQ--IDAAVASGAPYIEIHTGAYADAQDDVARQQEF-ERIRD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               A    +++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV
Sbjct: 178 AVAYAASRGIKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLAPAV 231


>gi|32468404|emb|CAD88332.1| GdpxJ protein [Porphyromonas gingivalis]
 gi|32468408|emb|CAD88334.1| GdpxJ protein [Porphyromonas gingivalis]
 gi|32468424|emb|CAD88342.1| GdpxJ protein [Porphyromonas gingivalis]
 gi|32468428|emb|CAD88344.1| GdpxJ protein [Porphyromonas gingivalis]
          Length = 126

 Score =  119 bits (298), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 84/132 (63%), Gaps = 7/132 (5%)

Query: 40  GLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVP 99
           G+TVHPRPD+RHIR +D+ ++++ +  +F     NIEG P+E F+ L E  +PEQ+T+VP
Sbjct: 1   GITVHPRPDERHIRRSDVYDLKKALTTEF-----NIEGNPDERFIRLIEEIRPEQVTMVP 55

Query: 100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE 159
           D P  LTS+ GWD  +N   L + V + H  G R S+F D + +  ++  A  TG D IE
Sbjct: 56  DAPDVLTSNAGWDVARNYDHLCRLVEQFHAWGIRTSIFIDTDLD--NISWAAKTGTDRIE 113

Query: 160 LYTGPYGACYNN 171
           LYT PY A Y+ 
Sbjct: 114 LYTEPYAAAYHK 125


>gi|190571021|ref|YP_001975379.1| pyridoxal phosphate biosynthetic protein PdxJ [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|213019542|ref|ZP_03335348.1| pyridoxal phosphate biosynthetic protein PdxJ [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
 gi|238057710|sp|B3CLF3|PDXJ_WOLPP RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|190357293|emb|CAQ54721.1| pyridoxal phosphate biosynthetic protein PdxJ [Wolbachia
           endosymbiont of Culex quinquefasciatus Pel]
 gi|212994964|gb|EEB55606.1| pyridoxal phosphate biosynthetic protein PdxJ [Wolbachia
           endosymbiont of Culex quinquefasciatus JHB]
          Length = 235

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 72/231 (31%), Positives = 127/231 (54%), Gaps = 11/231 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +   KIA+ +GA  LTVH R D+RHIR  D+  +++ I
Sbjct: 3   LGVNIDHVATLRNARGASYPDPLKAAKIAINAGADFLTVHLREDRRHIRDEDVFNLKQNI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                  ELN+E    E  L + +  KP  I +VP+   +LT++ G + +   + L+  +
Sbjct: 63  S-----TELNLEIAATEEMLKIAKEVKPYSICIVPEKREELTTEGGLNIVNMHSKLSGII 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             +H+   ++SLF D N N+           D IE++TG Y  C +NP +E++ L  +  
Sbjct: 118 EEMHSFDIKVSLFIDPNINQLKYLEKLERKPDIIEIHTGDY--C-DNPSEEKLKL--ITN 172

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
           +A+    + ++ +AGH +  ++    I  IP+IS +++GH+  + A+  G+
Sbjct: 173 SAEYINNLGIECHAGHGINYKHAKE-IKKIPHISALNIGHSLISEAIFHGL 222


>gi|99082403|ref|YP_614557.1| pyridoxine 5'-phosphate synthase [Ruegeria sp. TM1040]
 gi|99038683|gb|ABF65295.1| pyridoxal phosphate biosynthetic protein PdxJ [Ruegeria sp. TM1040]
          Length = 252

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 76/251 (30%), Positives = 131/251 (52%), Gaps = 17/251 (6%)

Query: 1   MSTS---VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDL 57
           MST+   + VN++ VA +RN R   +P+ +   K+A ++GA G+T H R D+RHI   D+
Sbjct: 1   MSTNTLRLGVNIDHVATVRNARGGAYPDPIRAAKLAEEAGADGITAHLREDRRHIVDADI 60

Query: 58  PEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQ 117
             +   +        LN E    E    +  R+KP  + +VP+   + T++ G D ++++
Sbjct: 61  DGLMAAL-----TVPLNFEMAATEEMQKIALRHKPHAVCIVPEKREERTTEGGLDVVRDE 115

Query: 118 ALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE-- 175
           + L   +A L   GSR+S+F     ++  ++AA   GA+ IEL+TG Y  C ++ + +  
Sbjct: 116 SRLAACIAPLREAGSRVSIFI--AADQKQIEAAHRIGAEVIELHTGAY--CDHHAEGDFA 171

Query: 176 --RIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALEC 233
                L  L   A  A  + L+++AGH LT + +   I A P + E+++GH     A+  
Sbjct: 172 ARDAELAALGEMATYAHSLGLEVHAGHGLTYETVAP-IAAFPEVRELNIGHFLIGEAIFR 230

Query: 234 GVKEAVFCFRR 244
           G+  A+   RR
Sbjct: 231 GLSPAIGEMRR 241


>gi|146306510|ref|YP_001186975.1| pyridoxal phosphate biosynthetic protein PdxJ [Pseudomonas
           mendocina ymp]
 gi|166219109|sp|A4XSC7|PDXJ_PSEMY RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|145574711|gb|ABP84243.1| pyridoxine 5'-phosphate synthase [Pseudomonas mendocina ymp]
          Length = 248

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 80/235 (34%), Positives = 120/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D   +R L 
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQDRD---VRVLA 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D    +  +N E    +  L   E+ +P  + LVP+   +LT++ G D    +A +   V
Sbjct: 66  D--VLQTRMNFEMGVTDFMLGFAEQIRPAHVCLVPETRQELTTEGGLDVAGQEARIAAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D    E  ++AA   GA  IEL+TG Y   +   +  +  L+++  
Sbjct: 124 ERLTLAGCEVSLFID--AEERQIEAAMRVGAPAIELHTGRYADAHTAEEAAQ-ELSRIRD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N    + AIP I+E+++GHA  A AL  G K+AV
Sbjct: 181 GVICGLNHGLIVNAGHGLHYHN-AEAVAAIPGINELNIGHAIVAHALFVGFKQAV 234


>gi|119944415|ref|YP_942095.1| pyridoxal phosphate biosynthetic protein PdxJ [Psychromonas
           ingrahamii 37]
 gi|119863019|gb|ABM02496.1| pyridoxal phosphate biosynthetic protein PdxJ [Psychromonas
           ingrahamii 37]
          Length = 244

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 77/240 (32%), Positives = 128/240 (53%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P   H+  IA  +GA G+T+H R D+RHI   D+      +
Sbjct: 6   LGVNIDHIATLRNARGTCYPEPAHLAAIAECAGADGITIHLREDRRHINDRDVA-----V 60

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    +  +++  + KP  + LVP+   +LT++ G + + + + +   V
Sbjct: 61  LAQTLQTRMNLEMAVTDEMVDIALKTKPAFVCLVPEKREELTTEGGLNVVASFSKIASAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL+    ++SLF D    +  + AA  TGA  IEL+TG Y    +   Q+   L ++A 
Sbjct: 121 SRLNAAAIQVSLFIDPENAQ--IDAAIKTGAAYIELHTGKYADAPSEDIQQ-FELMRVAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A  A +  +++NAGH L   N+   I A+P I E+++GHA  A AL  G   AV   +R
Sbjct: 178 AATYASQAGIKVNAGHGLNYHNVKP-IAALPEIIELNIGHAIVARALVDGFGPAVAEMKR 236


>gi|32468410|emb|CAD88335.1| GdpxJ protein [Porphyromonas gingivalis]
          Length = 126

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 84/132 (63%), Gaps = 7/132 (5%)

Query: 40  GLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVP 99
           G+TVHPRPD+RHIR +D+ ++++ +  +F     NIEG P+E F+ L E  +PEQ+T+VP
Sbjct: 1   GITVHPRPDERHIRRSDVYDLKKALTTEF-----NIEGNPDERFIRLIEEIRPEQVTMVP 55

Query: 100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE 159
           D P  LTS+ GWD  +N   L + V + H  G R S+F D + +  ++  A  TG D IE
Sbjct: 56  DAPDVLTSNAGWDVARNYDHLCRLVEQFHAWGIRTSIFIDTDLD--NISWAARTGTDRIE 113

Query: 160 LYTGPYGACYNN 171
           LYT PY A Y+ 
Sbjct: 114 LYTEPYAAAYHK 125


>gi|262368558|ref|ZP_06061887.1| pyridoxine 5'-phosphate synthase [Acinetobacter johnsonii SH046]
 gi|262316236|gb|EEY97274.1| pyridoxine 5'-phosphate synthase [Acinetobacter johnsonii SH046]
          Length = 241

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 127/239 (53%), Gaps = 9/239 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V+   I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTSYPDPVNAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R  +     K  +N+E    +  +   +  KP  +  VP+   ++T++ G D + +   +
Sbjct: 61  RPAL-----KTRMNLELAVTDEMIAFAKEIKPHHVCFVPEKRQEVTTEGGLDVVGHFDDV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +  + AA   GA  IE++TG Y A    P+ ++  L 
Sbjct: 116 KAATQALSEIGCDVSLFIDADFAQ--IDAAVACGAPTIEIHTGAY-ADAETPEAQQHELE 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           ++   A+ A    L +NAGH L ++N+   I  IP I E+++GH+  A A+  G+++AV
Sbjct: 173 RIVKGAEYAASKGLVVNAGHGLNLENV-TPIAQIPQIHELNIGHSLIADAIFVGLEQAV 230


>gi|32468426|emb|CAD88343.1| GdpxJ protein [Porphyromonas gingivalis]
          Length = 126

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 84/132 (63%), Gaps = 7/132 (5%)

Query: 40  GLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVP 99
           G+TVHPRPD+RHIR +D+ ++++ +      +E NIEG P+E F+ L E  +PEQ+T+VP
Sbjct: 1   GITVHPRPDERHIRRSDVYDLKKAL-----TSEFNIEGNPDERFIRLIEDIRPEQVTMVP 55

Query: 100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE 159
           D P  LTS+ GWD  +N   L + V + H  G R S+F D + +  ++  A  TG D IE
Sbjct: 56  DAPDVLTSNAGWDVARNYDHLCRLVEQFHAWGIRTSIFIDTDLD--NISWAAKTGTDRIE 113

Query: 160 LYTGPYGACYNN 171
           LYT PY A Y+ 
Sbjct: 114 LYTEPYAAAYHK 125


>gi|90412089|ref|ZP_01220096.1| pyridoxal phosphate biosynthetic protein [Photobacterium profundum
           3TCK]
 gi|90327067|gb|EAS43446.1| pyridoxal phosphate biosynthetic protein [Photobacterium profundum
           3TCK]
          Length = 243

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 127/235 (54%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ VH  ++A ++GA G+TVH R D+RHI   D+    R++
Sbjct: 6   LGVNIDHIATLRNARGTRYPDPVHAAEVAERAGADGITVHLREDRRHINDRDV----RIL 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            E   +  +N+E    +  +++    KPE + LVP+   +LT++ G D       +    
Sbjct: 62  KETI-QTRMNLEMAVTDEMVSIALDTKPEFVCLVPEKREELTTEGGLDVAGQLEKIKAAT 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G ++SLF D   +   + A    GA  +EL+TG Y A     + ++  L+K+A 
Sbjct: 121 QKLTAAGIKVSLFID--ADRAQIDATLACGAPFVELHTGHY-ADAETEEAQQAELDKIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + +++NAGH LT  N+   I A+P + E+++GH+    A   G+ +AV
Sbjct: 178 AATYAHGLGIKVNAGHGLTYHNVKP-IAALPELYELNIGHSIIGRAAFDGLNKAV 231


>gi|218438251|ref|YP_002376580.1| pyridoxine 5'-phosphate synthase [Cyanothece sp. PCC 7424]
 gi|226694866|sp|B7K7E4|PDXJ_CYAP7 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|218170979|gb|ACK69712.1| pyridoxal phosphate biosynthetic protein PdxJ [Cyanothece sp. PCC
           7424]
          Length = 240

 Score =  119 bits (297), Expect = 5e-25,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 127/236 (53%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ VA +R  R    P+ +    +A   GA G+TVH R D+RHI+  D+  +R+ 
Sbjct: 3   TLGVNIDHVATIRQARRTVEPDPLAAAVLAELGGADGITVHLREDRRHIQDRDVRLLRQT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     +  LN+E  P E  +++    KP+ +TLVP+   ++T++ G D + N     + 
Sbjct: 63  V-----RTHLNLEMAPTEEMISIALDIKPDYVTLVPEKREEVTTEGGIDLVSNFTRFAQV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V +L   G  +S F D +  +  ++AA  TGA  IEL+TG Y    N   + +  L  L 
Sbjct: 118 VDQLQGAGIPVSWFIDADPAQ--IEAASKTGAKFIELHTGKYAEALNEESRAQ-ELESLK 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              + A  + L++NAGH LT  N+   +  +P + E+++GH+  + A+  G+ +AV
Sbjct: 175 KGCEQALSLGLRVNAGHGLTYWNVYP-VACLPGMEELNIGHSIISRAVLIGIDKAV 229


>gi|308048452|ref|YP_003912018.1| pyridoxine 5'-phosphate synthase [Ferrimonas balearica DSM 9799]
 gi|307630642|gb|ADN74944.1| pyridoxine 5'-phosphate synthase [Ferrimonas balearica DSM 9799]
          Length = 244

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 81/239 (33%), Positives = 130/239 (54%), Gaps = 9/239 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MS  + VN++ +A LR  R   +P+ VH   +A  +GA G+T+H R D+RHI   D+  +
Sbjct: 1   MSILLGVNIDHIATLRQARGTDYPDPVHAAAVAEHAGADGITIHLREDRRHIIDRDVEVL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
            + +     K  +N+E    E  L + ER +PE + LVP+   +LT++ G D +  QA +
Sbjct: 61  AKTL-----KTRMNLEMAVTEEMLAIAERIRPEYVCLVPEKREELTTEGGLDVVGQQAKI 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           ++ V RL   G ++SLF D +  +  + A   TGA  IE++TG Y    +   +++  L 
Sbjct: 116 SEAVTRLRQAGIKVSLFIDADPRQ--IDATVATGAPYIEIHTGHYADAEDEISRDK-ELV 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           ++   A  A +  L +NAGH L   N+   I AIP + E+++GHA  A A   G+  AV
Sbjct: 173 RIREAASYAHERGLVVNAGHGLHYHNVKP-IAAIPELYELNIGHAIIARAAIDGLDLAV 230


>gi|302383076|ref|YP_003818899.1| pyridoxal phosphate biosynthetic protein PdxJ [Brevundimonas
           subvibrioides ATCC 15264]
 gi|302193704|gb|ADL01276.1| pyridoxal phosphate biosynthetic protein PdxJ [Brevundimonas
           subvibrioides ATCC 15264]
          Length = 255

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 74/241 (30%), Positives = 123/241 (51%), Gaps = 7/241 (2%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ V   + AL++GA G+T H R D+RHI   D+  +  ++
Sbjct: 7   LGVNIDHVATVRNARGGLYPDPVRAAREALEAGADGITAHLREDRRHISDADIDHLSAVL 66

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +Q     LN+E    +  L +   ++P  + LVP+   + T++ G D +     +T  V
Sbjct: 67  RDQ--DRPLNLEMAVTQEMLAIALHHRPRAVCLVPEKREERTTEGGLDVVGGHNWITPVV 124

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNKL 182
            RL+  GSR+SLF     +   + AA  TGA  +EL+TG Y     +  P      L  L
Sbjct: 125 GRLNEAGSRVSLFI--GADPAQIAAAHRTGAAVVELHTGAYCDAVRDGRPDDAERELVAL 182

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A  A  + L+++AGH +  + +   + AIP I E+++GH     A+  G+  A+   
Sbjct: 183 KAGATQAHALGLEVHAGHGIDYETVAA-VAAIPEIMELNIGHFLIGEAIFVGLGPAIGRM 241

Query: 243 R 243
           R
Sbjct: 242 R 242


>gi|226226653|ref|YP_002760759.1| pyridoxal phosphate biosynthetic protein PdxJ [Gemmatimonas
           aurantiaca T-27]
 gi|226089844|dbj|BAH38289.1| pyridoxal phosphate biosynthetic protein PdxJ [Gemmatimonas
           aurantiaca T-27]
          Length = 246

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 126/237 (53%), Gaps = 12/237 (5%)

Query: 7   VNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLIDE 66
           VN++ VA +R  R    P+ V    +  ++GA G+T H R D+RHI+  D   I RL+ +
Sbjct: 10  VNIDHVATVRQARRGQEPDPVAAALLCERAGADGITAHLREDRRHIQDDD---IHRLMAQ 66

Query: 67  QFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVAR 126
                 LN+E    +  L+L E  +P Q+TLVP+   ++T++ G D ++++ +L   +AR
Sbjct: 67  --VTTLLNLECATTDDMLSLAETLRPAQVTLVPERREEITTEGGLDVVRHEVVLRDAIAR 124

Query: 127 LHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITA 186
           L   G R SLF D      ++  ++  GAD +EL+TG Y     +P      L  L   A
Sbjct: 125 LRAAGIRSSLFID--PEREAVDVSRRIGADAVELHTGQYAHAPRDPAT----LRALRDAA 178

Query: 187 QLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
                + + ++AGH L++ N+   + AIP I E+++GHA    A+  G++ AV   R
Sbjct: 179 AHGAAIGIAVHAGHGLSVANV-GPVAAIPEIEELNIGHAIVGRAIFVGLEVAVHEIR 234


>gi|296532094|ref|ZP_06894866.1| pyridoxine 5'-phosphate synthase [Roseomonas cervicalis ATCC 49957]
 gi|296267578|gb|EFH13431.1| pyridoxine 5'-phosphate synthase [Roseomonas cervicalis ATCC 49957]
          Length = 254

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 88/252 (34%), Positives = 130/252 (51%), Gaps = 10/252 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +SVN++ VA LRN R   +P+ V   +  LQ+GA G+TVH R D+RHIR  D   + RL 
Sbjct: 3   LSVNVDHVATLRNARGGRFPDPVEAARACLQAGADGITVHLREDRRHIRDAD---VARLG 59

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            E  P   LN E    E  + +    +P    +VP+   +LT++ G D L+    L   +
Sbjct: 60  AE--PGLRLNFEMAATEEMVGIALGLRPAACCIVPEKRQELTTEGGLDLLRAGPELAGAI 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL   G  +++F + +  +  +QAA   GA  +EL+TG Y     +P      L +LA 
Sbjct: 118 ARLAGAGIEVAIFVEPDTAQ--IQAAARLGAQAVELHTGTY--ADADPAARPPLLARLAR 173

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
            A+ A    L  +AGH L   ++   I AIP I+E+S+GHA    A+  G+  AV   R 
Sbjct: 174 GAEAAAAAGLACHAGHGLDHVSVRG-IAAIPQIAEVSIGHALIGAAVFEGLPAAVRRMRA 232

Query: 245 ACGQHLDNTMRL 256
           A  +   NT+ L
Sbjct: 233 AMVEARRNTIAL 244


>gi|148652189|ref|YP_001279282.1| pyridoxine 5'-phosphate synthase [Psychrobacter sp. PRwf-1]
 gi|148571273|gb|ABQ93332.1| pyridoxal phosphate biosynthetic protein PdxJ [Psychrobacter sp.
           PRwf-1]
          Length = 255

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 81/244 (33%), Positives = 128/244 (52%), Gaps = 11/244 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R + +P+ V    +  ++GA G+T+H R D+RHI+  D+  +R L+
Sbjct: 14  LGVNIDHVATLRQARGVAYPDPVEAALLCEKAGADGITLHLREDRRHIQDADVYRMRPLL 73

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   +N+E    +  L++    KP+ + LVP+   +LT++ G D       L   V
Sbjct: 74  -----TTRMNLEMATTQEMLSIALEVKPQWVCLVPEKREELTTEGGLDVAAQVDGLKHYV 128

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFLNKL 182
           A L   G+++SLF D    +  + AA   GAD IEL+TG Y      + P  ++  L   
Sbjct: 129 ASLQQNGTKVSLFIDPEPIQ--IDAAIACGADAIELHTGQYSEATLTSEPSTQKELLRIQ 186

Query: 183 AITA-QLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
             TA  LA    L +NAGH LT  N+   I AI  I E+++GHA  A ++  G++ AV  
Sbjct: 187 QATAYALAANNKLIVNAGHGLTRDNV-GPIAAIDGIYELNIGHALIADSIFMGLESAVKA 245

Query: 242 FRRA 245
            ++A
Sbjct: 246 MKQA 249


>gi|91784704|ref|YP_559910.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           xenovorans LB400]
 gi|91688658|gb|ABE31858.1| pyridoxine 5'-phosphate synthase [Burkholderia xenovorans LB400]
          Length = 254

 Score =  119 bits (297), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 124/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+ ++R L+
Sbjct: 13  LGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADVITLHLREDRRHIVDADVRKLRPLL 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E       L++    +P  + LVP+   +LT++ G D       +    
Sbjct: 73  -----KTRMNLECAVTREMLDIACEVQPHDVCLVPEKRQELTTEGGLDVAGQFEAVRAAC 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L    SR+SLF D   +E  ++AA   GA  IEL+TG Y   ++  +Q+R F  ++  
Sbjct: 128 RQLAEANSRVSLFID--PDETQIRAAHEAGAPVIELHTGRYAEAHDPAEQQREF-ERVVH 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             +  + + +++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV
Sbjct: 185 AVEFGRTLGIKVNAGHGLHYTNVQQ-IAAIEGIDELNIGHAIVAHAIFAGWDNAV 238


>gi|254446510|ref|ZP_05059986.1| pyridoxal phosphate biosynthetic protein PdxJ [Verrucomicrobiae
           bacterium DG1235]
 gi|198260818|gb|EDY85126.1| pyridoxal phosphate biosynthetic protein PdxJ [Verrucomicrobiae
           bacterium DG1235]
          Length = 252

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 76/247 (30%), Positives = 129/247 (52%), Gaps = 18/247 (7%)

Query: 2   STSVSVNLNAVAVLRNRR---------NLPWPNLVHIGKIALQSGASGLTVHPRPDQRHI 52
           S  + VN++ VA +R  R             P+ V I  +  ++GA G+TVHPR D RHI
Sbjct: 5   SILLGVNIDHVATVREARYKESPRACGQFVEPDPVTIALLCEKAGAHGITVHPREDARHI 64

Query: 53  RYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWD 112
           +  D+  +R  I     +  LN+E    +  L       PE I +VP+   ++T++ G D
Sbjct: 65  QKADVRRLRECI-----QTRLNMEMAATDEMLAFALEILPETICVVPESREEVTTEGGLD 119

Query: 113 FLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP 172
                  + + V    + G   SLF D + N+  ++A+  TGA  +EL+TG Y   Y + 
Sbjct: 120 VAGQFDRIERIVKAAADAGIETSLFIDPDQNQ--IEASAKTGAKYVELHTGAYANAYYSK 177

Query: 173 QQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALE 232
           ++   + ++L   A+LA ++ L +NAGH +   N+  +I  IP+++E+++GH+  + AL 
Sbjct: 178 ERGPEY-DRLVAGAELAAELGLVVNAGHGINYVNVSEVIT-IPFLNELNIGHSIISRALF 235

Query: 233 CGVKEAV 239
            G+ EAV
Sbjct: 236 FGIDEAV 242


>gi|169632757|ref|YP_001706493.1| pyridoxine 5'-phosphate synthase [Acinetobacter baumannii SDF]
 gi|169151549|emb|CAP00316.1| pyridoxal phosphate biosynthetic protein [Acinetobacter baumannii]
          Length = 241

 Score =  118 bits (296), Expect = 6e-25,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 127/246 (51%), Gaps = 11/246 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTAYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RPLL-----KTRMNLEMAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY-GACYNNPQQERIFL 179
                 L  +G  +SLF D +  +  + AA   GA  IEL+TG Y  A     QQE   L
Sbjct: 116 KAATQALAAIGCDVSLFIDADFAQ--IDAAIACGAPTIELHTGAYTDATTEQEQQEE--L 171

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++    + A    L +NAGH L ++NI   I AIP I  +++GH+  A ++  G+ +AV
Sbjct: 172 ARIVKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHALNIGHSIIAESVFVGLVQAV 230

Query: 240 FCFRRA 245
              + A
Sbjct: 231 KDMKTA 236


>gi|330502448|ref|YP_004379317.1| pyridoxine 5'-phosphate synthase [Pseudomonas mendocina NK-01]
 gi|328916734|gb|AEB57565.1| pyridoxine 5'-phosphate synthase [Pseudomonas mendocina NK-01]
          Length = 248

 Score =  118 bits (296), Expect = 7e-25,   Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D   +R L 
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPVKAALDAEEAGADGITVHLREDRRHIQDRD---VRVLA 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           D    +  +N E    +  L   E+ +P  + LVP+   +LT++ G D    +A +   V
Sbjct: 66  D--VLQTRMNFEMGVTDFMLGFAEQIRPAHVCLVPETRQELTTEGGLDVAGQEARIAAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D    E  ++AA   GA  IEL+TG Y A  +  ++    L+++  
Sbjct: 124 ERLTLAGCEVSLFID--AEERQIEAAMRVGAPAIELHTGRY-ADAHTAEEAAHELSRIRD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                    L +NAGH L   N    + AIP I+E+++GHA  A AL  G K+AV
Sbjct: 181 GVICGLNHGLIVNAGHGLHYHN-AEAVAAIPGINELNIGHAIVAHALFVGFKQAV 234


>gi|320353408|ref|YP_004194747.1| pyridoxine 5'-phosphate synthase [Desulfobulbus propionicus DSM
           2032]
 gi|320121910|gb|ADW17456.1| pyridoxine 5'-phosphate synthase [Desulfobulbus propionicus DSM
           2032]
          Length = 392

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 129/235 (54%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +++N++ VA +R  R    P+ V    +   +GA G+ VH R D+RHI+  D+  +R+ +
Sbjct: 157 LAINVDHVATIRQARGGQEPDPVLAASLCELAGADGIVVHLREDRRHIQDRDVRLLRQTV 216

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K +LN+E       +++     P+ +TLVP+   +LT++ G D L N   LTKT+
Sbjct: 217 -----KTKLNLEMANVPEIVDIAVEVVPDMVTLVPEKRKELTTEGGLDVLANAKKLTKTI 271

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            ++   G  +SLF D +  +         GA  +EL+TG Y       +QE+ F   +  
Sbjct: 272 DKMRKAGIPVSLFVDADAAQVQAALD--VGATFVELHTGRYCEARTMEEQEQQF-RLIEQ 328

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           TA+LA +  L++NAGH L  +N  + I A+PYI E+S+GHA  + A+  G++ AV
Sbjct: 329 TAELAYESGLRVNAGHGLDYRN-THPIAALPYIEELSIGHAVISRAVLVGLENAV 382


>gi|293609822|ref|ZP_06692124.1| conserved hypothetical protein [Acinetobacter sp. SH024]
 gi|292828274|gb|EFF86637.1| conserved hypothetical protein [Acinetobacter sp. SH024]
          Length = 241

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 75/245 (30%), Positives = 128/245 (52%), Gaps = 9/245 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  ++GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTTYPDPVEAALICEEAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RPLL-----KTRMNLELAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +  + AA   GA  IEL+TG Y A     Q ++  L 
Sbjct: 116 KAATQTLAAIGCDVSLFIDADLAQ--IDAAVACGAPTIELHTGAY-ADAETEQDQQAELE 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L ++NI   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIIKGVEYAASKGLVVNAGHGLNLKNIAP-IAAIPQIHELNIGHSIIAESVFVGLVQAVK 231

Query: 241 CFRRA 245
             + A
Sbjct: 232 DMKTA 236


>gi|186475609|ref|YP_001857079.1| pyridoxine 5'-phosphate synthase [Burkholderia phymatum STM815]
 gi|184192068|gb|ACC70033.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           phymatum STM815]
          Length = 254

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 124/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +     A ++GA  +T+H R D+RHI   D+  +R  +
Sbjct: 13  LGVNIDHVATLRNARGTSYPDPIRAALQAEEAGADAITLHLREDRRHIVDADVRALRPQL 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +     +N+E    +  L++    +P  + LVP+   +LT++ G D   +   +    
Sbjct: 73  TTR-----MNLECAVTQEMLDIACEVQPHDVCLVPEKRQELTTEGGLDVAGHFEAVRAAC 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L + GSR+SLF D   +E  ++AA   GA  IEL+TG Y   ++  +Q+R +  ++  
Sbjct: 128 KQLADAGSRVSLFID--ADEAQIRAAHEAGAPVIELHTGAYAEAHDASEQQREY-ERIVR 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             +    + L++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV
Sbjct: 185 GVEFGASLGLKVNAGHGLHYTNVQQ-IAAIEGIVELNIGHAIVAHAIFAGWDNAV 238


>gi|32468420|emb|CAD88340.1| GdpxJ protein [Porphyromonas gingivalis]
 gi|32468438|emb|CAD88349.1| GdpxJ protein [Porphyromonas gingivalis]
          Length = 126

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 84/132 (63%), Gaps = 7/132 (5%)

Query: 40  GLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVP 99
           G+TVHPRPD+RHIR +D+ ++++ +  +F     NIEG P+E F+ L E  +PEQ+T+VP
Sbjct: 1   GITVHPRPDERHIRRSDVYDLKKALTTEF-----NIEGNPDERFIRLIEDIRPEQVTMVP 55

Query: 100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE 159
           D P  LTS+ GWD  +N   L + V + H  G R S+F D + +  ++  A  TG D IE
Sbjct: 56  DAPDVLTSNAGWDVARNYDHLCRLVEQFHAWGIRTSIFIDTDLD--NISWAAKTGTDRIE 113

Query: 160 LYTGPYGACYNN 171
           LYT PY A Y+ 
Sbjct: 114 LYTEPYAAAYHK 125


>gi|22298381|ref|NP_681628.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermosynechococcus
           elongatus BP-1]
 gi|30316019|sp|Q8DKM1|PDXJ_THEEB RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|22294560|dbj|BAC08390.1| pyridoxal phosphate biosynthetic protein [Thermosynechococcus
           elongatus BP-1]
          Length = 238

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 79/236 (33%), Positives = 123/236 (52%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ VA +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R  
Sbjct: 3   TLGVNIDHVATIRQARRTVEPDPVAAALLAELGGADGITVHLREDRRHIQERDVRLLR-- 60

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              Q  +  LN+E       + +    +P+ +TLVP+   ++T++ G D +  Q  LT+ 
Sbjct: 61  ---QTVRTHLNLEMAATPEMVAIALDIRPDYVTLVPERREEVTTEGGLDVVSQQEPLTQV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V  L   G  +SLF D +  +  L AA  T A  IEL+TG Y        Q+R  L  LA
Sbjct: 118 VQTLQGAGIPVSLFIDADPTQ--LAAAAKTTAQFIELHTGRYAEAKGEVAQQR-ELAILA 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              Q A+ + L++NAGH LT  N+   I  +  I E+++GH   + A+  G+ +AV
Sbjct: 175 DGVQQAKALGLRVNAGHGLTYSNV-GAIARLEGIEELNIGHTIISRAVLVGMVQAV 229


>gi|332532632|ref|ZP_08408508.1| pyridoxine 5'-phosphate synthase [Pseudoalteromonas haloplanktis
           ANT/505]
 gi|332037848|gb|EGI74297.1| pyridoxine 5'-phosphate synthase [Pseudoalteromonas haloplanktis
           ANT/505]
          Length = 243

 Score =  118 bits (296), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 122/240 (50%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P+  H   +A  +GA G+T+H R D+RHI+  D+  + + I
Sbjct: 6   LGVNVDHIATLRQARGTSYPDPAHAASVAEHAGADGITIHLREDRRHIQDRDVYVMAKTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    KPE + LVP+   +LT++ G D   N   +    
Sbjct: 66  -----QTRMNLETAVTDEMIKIALEVKPEYVCLVPEKREELTTEGGLDVAGNIDKIKAAT 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G ++SLF D +  +  L AAK  GA  +E++TG Y    N+    +  L  +  
Sbjct: 121 KTLTEAGIKVSLFIDADKAQ--LDAAKECGAPYVEIHTGAYADATNDTDLHK-ELEHIRE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             + A  + L +NAGH L   N+   I A+P I E+++GHA  A A   G+ +AV   +R
Sbjct: 178 GVKYAASLGLIVNAGHGLHYHNVKP-IAAMPEIYELNIGHAIIARAAIDGLDKAVRDMKR 236


>gi|238692027|sp|B3DF93|PDXJ_MICAN RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|190192143|dbj|BAG48278.1| pyridoxal phosphate biosynthetic protein PdxJ [Microcystis
           aeruginosa NIES-843]
          Length = 240

 Score =  118 bits (295), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 123/236 (52%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ VA +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R  
Sbjct: 3   TLGVNIDHVATIRQARRTVEPDPVAAAVLAEIGGADGITVHLREDRRHIQDRDVRILR-- 60

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              Q  +  LN+E  P E  + +    KP+ +TLVP+   ++T++ G D L N     + 
Sbjct: 61  ---QTVRTHLNLEMAPTEEMIAIALDIKPDYVTLVPEKRQEVTTEGGIDMLGNFDRFCRV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL      +S F D +  +  +QAA  TGA  IEL+TG Y        ++ + L  L 
Sbjct: 118 VERLQAANIPVSWFIDADFAQ--IQAAANTGAKFIELHTGQYAEAQQESDRQAL-LTILK 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              + A  + L++NAGH LT  N+   +  +P + E+++GH   + A+  G++ AV
Sbjct: 175 EGCEYASSLGLRVNAGHGLTYGNV-YAVACLPNMEELNIGHTIISRAVLVGLERAV 229


>gi|1172052|sp|P46212|PDXJ_AQUPY RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|642968|emb|CAA52337.1| pdxj protein [Aquifex pyrophilus]
          Length = 236

 Score =  118 bits (295), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 76/248 (30%), Positives = 133/248 (53%), Gaps = 16/248 (6%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +R  R    P+ V    IA Q+GA  +T+H R D+RHI+  DL  I+ L+
Sbjct: 3   LGVNVDHVATVRQARRTFEPSPVCAALIAQQAGADQITLHLREDRRHIQDRDLELIKELV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           +   P   +N+E  P E    +  R +P++ITLVP+   ++T++ G D +  +  L + +
Sbjct: 63  N--IP---VNLEMAPTEEMREIALRVRPDRITLVPERREEITTEGGLDVVSMKERLKEYL 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQE-RIFLNKLA 183
             L   G  ISLF + +  +  ++A++  GAD IE++TG Y     +  +E R  L ++ 
Sbjct: 118 KPLKEAGIEISLFIEPDKEQ--IEASRDVGADAIEIHTGRYQPLERHRFEEAREELRRIR 175

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIP-YISEISVGHAFAATALECGVKEAVFCF 242
             A  A++  L++ AGH LT  N+   +  +   + E+++GH+  A A+       +F F
Sbjct: 176 EAAIYARERGLRVYAGHGLTYHNVKEFVRELKDVVEELNIGHSIVANAV-------IFGF 228

Query: 243 RRACGQHL 250
            RA  + +
Sbjct: 229 ERAVKEMI 236


>gi|253999486|ref|YP_003051549.1| pyridoxine 5'-phosphate synthase [Methylovorus sp. SIP3-4]
 gi|253986165|gb|ACT51022.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylovorus sp.
           SIP3-4]
          Length = 243

 Score =  118 bits (295), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 74/231 (32%), Positives = 126/231 (54%), Gaps = 9/231 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LR  R   +P++V     A ++GA  +T+H R D+RHI+  D+  +R L
Sbjct: 3   KLGVNIDHVATLRQARGTQYPSVVQAALRAEEAGADSITIHLREDRRHIQDADVFALRPL 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     + ++N+E    E  L +  + KP+ + LVP+   + T++ G +   N A ++  
Sbjct: 63  L-----QTKMNLEMAVTEEMLGIALQVKPQDVCLVPERREERTTEGGLEVAGNLAAVSHA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
              L +   R+SLF   +  +  + AAK  GA  IE++TG + A    P+++   L ++ 
Sbjct: 118 CQVLRDADIRVSLFIAPDIAQ--IDAAKAAGAPVIEIHTGTF-ADAETPEEQAHELARVQ 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECG 234
                 +K+ L +NAGH L I N+ +LI AIP I E+++GHA  A A+  G
Sbjct: 175 AAVAHGRKLGLVVNAGHGLNIHNV-HLIAAIPGIEELNIGHAIVAHAIFVG 224


>gi|88608435|ref|YP_506210.1| pyridoxal phosphate biosynthetic protein PdxJ [Neorickettsia
           sennetsu str. Miyayama]
 gi|88600604|gb|ABD46072.1| pyridoxal phosphate biosynthetic protein PdxJ [Neorickettsia
           sennetsu str. Miyayama]
          Length = 244

 Score =  118 bits (295), Expect = 9e-25,   Method: Compositional matrix adjust.
 Identities = 75/227 (33%), Positives = 119/227 (52%), Gaps = 9/227 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           T VS+NL+ VA+LRN R+   P++ ++  + + SG SG+T+HPR D+RH    D+  I  
Sbjct: 2   TRVSINLDKVALLRNSRSAGSPDIKYVANLGIMSGCSGITLHPRADRRHALIEDVQIILG 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           L +    + E N+EG      + L E     Q T+VP    + T++ G+   +   LL  
Sbjct: 62  LSEVACGEVECNVEGDLRPEIIELVEASSIHQFTIVPVRDGERTTERGFSVGEKAELLGS 121

Query: 123 TVARL-HNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGA--CYNNPQQERIFL 179
           T+ R+      R+SLF +      S++ A   G D +EL+   Y    C +   +E   +
Sbjct: 122 TIERIKKKRNVRVSLFVE--PEPASVKYAAEVGCDAVELHAKWYARAFCTHRESEE---I 176

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAF 226
            +L   A  A+ + L++N GHDL++ NI  +IN I    EIS+GHA 
Sbjct: 177 KRLHFAALEARNLGLKVNLGHDLSLVNISTVINKIRP-DEISIGHAL 222


>gi|300717984|ref|YP_003742787.1| Pyridoxal phosphate biosynthesis protein [Erwinia billingiae Eb661]
 gi|299063820|emb|CAX60940.1| Pyridoxal phosphate biosynthesis protein [Erwinia billingiae Eb661]
          Length = 243

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 124/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ V    ++ Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHVATVRNARGTNYPDPVQAAFVSEQAGADGITVHLREDRRHITDRDVRILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++    KP    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVDIACEIKPHFCCLVPEKREEVTTEGGLDVAGQLEKVTYAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +  + AA  +GA  IE++TG Y       ++   F+ ++  
Sbjct: 121 TRLAEAGILVSLFIDADHRQ--IDAAMASGAPYIEIHTGAYAEAEEGRERHAEFI-RIKD 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+ +AV
Sbjct: 178 AAAYAAGKGLKVNAGHGLTYHNV-QPIAALPQMHELNIGHAIIGRAVMSGLADAV 231


>gi|134095250|ref|YP_001100325.1| pyridoxine 5'-phosphate synthase [Herminiimonas arsenicoxydans]
 gi|133739153|emb|CAL62202.1| Pyridoxine 5'-phosphate synthase (PNP synthase) [Herminiimonas
           arsenicoxydans]
          Length = 255

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 126/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ VA LRN R   +P  +     A ++GA  +T+H R D+RHIR  D+  IR  +
Sbjct: 13  LGINIDHVATLRNARGTVYPYPLQAALQAEEAGADAITLHLREDRRHIRDADVELIRPQL 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E       ++   R KP+ + LVP+   ++T++ G D ++  + ++  +
Sbjct: 73  -----RTRMNLESAVTSEMIDFACRIKPQDVCLVPERREEVTTEGGLDIVKYFSEVSAAI 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G R+SLF D +  +  +QAA   GA  IEL+TG Y   ++   Q+ + L ++  
Sbjct: 128 RQLQGEGIRVSLFIDADVAQ--IQAAAEAGAPVIELHTGRYADAHDEAGQQ-MELQRVKQ 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                 K  L++NAGH L   N+   I AI  I+E+++GHA  A A+  G + AV
Sbjct: 185 GVHEGVKRGLKVNAGHGLHYTNV-QAIAAIQDIAELNIGHAIVAHAVFVGWQNAV 238


>gi|325268087|ref|ZP_08134733.1| pyridoxine 5'-phosphate synthase [Kingella denitrificans ATCC
           33394]
 gi|324980472|gb|EGC16138.1| pyridoxine 5'-phosphate synthase [Kingella denitrificans ATCC
           33394]
          Length = 305

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 127/235 (54%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R + +P+ +    IA   GA  +T+H R D+RHI+  D+  I++ I
Sbjct: 64  LGVNIDHVATLRNARGVSYPSPLEAALIAETYGADLITLHLREDRRHIKDDDVALIKQAI 123

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  L    R +PE + +VP+   ++T++ G D +     +   +
Sbjct: 124 -----RTRMNLEMAMTEEMLAHALRIRPEDVCIVPEKRAEVTTEGGLDVIGQAGKVRHYI 178

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L     R+S+F   +  +  +Q A   GA  +EL+TG Y A    P+Q R  L ++  
Sbjct: 179 YELQAASIRVSIFIAPDKPQ--IQKAFDMGARVVELHTGAY-ADAATPEQCRNELQRIRE 235

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            AQ A ++ + +NAGH LTI N+   I  IP I+E+++GH+  A A+  G+ +A+
Sbjct: 236 AAQFAAQLGMTVNAGHGLTIHNVAP-IAQIPEIAELNIGHSLIAQAVFLGLPKAI 289


>gi|187735701|ref|YP_001877813.1| pyridoxal phosphate biosynthetic protein PdxJ [Akkermansia
           muciniphila ATCC BAA-835]
 gi|254781557|sp|B2URE7|PDXJ_AKKM8 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|187425753|gb|ACD05032.1| pyridoxal phosphate biosynthetic protein PdxJ [Akkermansia
           muciniphila ATCC BAA-835]
          Length = 246

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/250 (31%), Positives = 136/250 (54%), Gaps = 20/250 (8%)

Query: 5   VSVNLNAVAVLRNRRNLPW-------PNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDL 57
           + VN++ +A LR  R           P+++     A + GA  +T+H R D+RH++  D 
Sbjct: 3   LGVNIDHIATLRQARYATMLDSFNVEPSVLDAAYAAQRGGADSITLHVRGDRRHMQDADA 62

Query: 58  PEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQ 117
             +R  +    P   LN+E       ++   R KP+ I +VP+   ++T++ G D + ++
Sbjct: 63  LSVRESV--ALP---LNLEMGNTPEMVDFALRLKPDYICMVPEKREEITTEGGLDAVFHE 117

Query: 118 ALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY-NNPQQER 176
             L  T+AR+ + G ++SLF D    +  ++AA   GA  IEL+TG    C+ N+  +ER
Sbjct: 118 KDLAPTMARMADNGIQVSLFIDPEVPQ--VEAAARLGAPMIELHTG----CFANHSGRER 171

Query: 177 IF-LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGV 235
              L +L   A+LA  + +Q+NAGH +  QN+  L+  +PY+ E+++GH   + AL  G+
Sbjct: 172 TEELARLKRAAELAHSLGIQVNAGHGINYQNLEQLLAGVPYLHELNIGHTIVSRALFVGM 231

Query: 236 KEAVFCFRRA 245
           ++AV   R+A
Sbjct: 232 EQAVREMRQA 241


>gi|258543241|ref|YP_003188674.1| pyridoxine 5'-phosphate synthase [Acetobacter pasteurianus IFO
           3283-01]
 gi|256634319|dbj|BAI00295.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-01]
 gi|256637377|dbj|BAI03346.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-03]
 gi|256640429|dbj|BAI06391.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-07]
 gi|256643486|dbj|BAI09441.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-22]
 gi|256646541|dbj|BAI12489.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-26]
 gi|256649594|dbj|BAI15535.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-32]
 gi|256652582|dbj|BAI18516.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-01-42C]
 gi|256655638|dbj|BAI21565.1| pyridoxal phosphate biosynthetic protein PdxJ [Acetobacter
           pasteurianus IFO 3283-12]
          Length = 240

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 126/243 (51%), Gaps = 14/243 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +  + VN++ VA +RN R   +P+ V    +A+Q+GA G+T H R D+RHIR  DL  +R
Sbjct: 4   AIRLGVNIDHVATIRNARGGTYPDPVAAALLAIQAGADGITAHLREDRRHIRDKDLQRLR 63

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             I      A LN+E    E  + +    +P    LVP+   +LT++ G +       LT
Sbjct: 64  AEI-----AAPLNMEMAATEEMVGIALGLRPHACCLVPERREELTTEGGLNVAGQLETLT 118

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             V +L   G R+SLF D +  +  ++AA  TGA  +EL+TG Y        +E   L +
Sbjct: 119 PKVQKLAQAGIRVSLFIDPSSAQ--IEAAAKTGAQVVELHTGAYA---EGKAEE---LER 170

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           L   A  A  + L+++AGH LT +N+   I ++P + E+++GH     A+  G+   V  
Sbjct: 171 LRAAATQAAALGLEVHAGHGLTFENV-GPIASLPELRELNIGHFLIGQAIFDGLAAVVQN 229

Query: 242 FRR 244
            +R
Sbjct: 230 MKR 232


>gi|291333806|gb|ADD93490.1| pyridoxal phosphate biosynthetic protein PdxJ [uncultured marine
           bacterium MedDCM-OCT-S04-C123]
          Length = 245

 Score =  118 bits (295), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 72/239 (30%), Positives = 121/239 (50%), Gaps = 12/239 (5%)

Query: 5   VSVNLNAVAVLRNRR----NLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           + VN++  A LR  R        P+ +    I + +G  G+T H R D+RHI+  D   I
Sbjct: 4   LGVNIDHTATLREARYRGQEGGEPDPIEAASICIDAGCHGITAHLREDRRHIQDND---I 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
            RL+        LN E       +      KP  + +VP+   ++T++ G D       +
Sbjct: 61  DRLV--SVLTVPLNFEIANTPEMIAKALEIKPTAVCMVPEKREEVTTEGGLDVASQLEAI 118

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
           +K+V  L   G  +SLF D +  E  ++A+  TGA  IEL+TG Y   ++   + +  L 
Sbjct: 119 SKSVTELQGNGIEVSLFIDPD--EEIIRASHSTGAKAIELHTGAYAEAFSQTSERKKELE 176

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +L+I + LA  + +++NAGH L   N+  L+  +P++ E+++GH+  A AL  G + AV
Sbjct: 177 RLSIASNLAHSLGMKVNAGHGLNYTNLTGLLE-VPWLEELNIGHSIVARALTVGFERAV 234


>gi|332284260|ref|YP_004416171.1| pyridoxal phosphate biosynthetic protein PdxJ [Pusillimonas sp.
           T7-7]
 gi|330428213|gb|AEC19547.1| pyridoxal phosphate biosynthetic protein PdxJ [Pusillimonas sp.
           T7-7]
          Length = 244

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 126/236 (53%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LR +R   +P+ +     A ++GA  +T+H R D+RHI+  D+  +R L
Sbjct: 3   ELGVNIDHVATLRQQRYTSYPDPIQAALRAEEAGADLITLHLREDRRHIQDADVEAMRPL 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     +  +N+E       L++  R +P+ + LVP+   +LT++ G D L     + + 
Sbjct: 63  L-----RTRMNLECAVTSEMLDIACRVRPQDVCLVPEKRAELTTEGGLDVLGRFEQVRQA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           VA+L + G R+SLF D    +  + AA+  GA  IEL+TG Y         +   L +L 
Sbjct: 118 VAQLQDAGIRVSLFIDPEAEQ--IDAAQRAGATVIELHTGAYADAGGQAASD-FELARLR 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               L  +  L++NAGH L   N+   I  +P ++E+++GHA  A A+  G ++AV
Sbjct: 175 AGIALGVRHGLRVNAGHGLHYDNVQT-IAEMPGLAELNIGHAIVARAVFDGWEKAV 229


>gi|194290149|ref|YP_002006056.1| pyridoxine 5'-phosphate synthase [Cupriavidus taiwanensis LMG
           19424]
 gi|238692742|sp|B3R1Z6|PDXJ_CUPTR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|193223984|emb|CAQ69993.1| Pyridoxal phosphate biosynthetic protein [Cupriavidus taiwanensis
           LMG 19424]
          Length = 260

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/236 (33%), Positives = 125/236 (52%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LRN R   +P+ +    +A Q+GA  +T+H R D+RHIR  D+  +R  
Sbjct: 11  DLGVNIDHVATLRNARGTVYPDPIRAALLAEQAGADLITLHLREDRRHIRDADVRALRPQ 70

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        +N+E    +  L++    +P+ + LVP+   ++T++ G D      L+   
Sbjct: 71  L-----ATRMNLECAITQEMLDIACEIRPQDVCLVPERREEVTTEGGLDVAGRFELVKAA 125

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
            A+L   G R+SLF D + ++  + AA   GA  IEL+TG Y   +   +Q   F  ++A
Sbjct: 126 CAQLAGAGIRVSLFIDPDADQ--IAAAAACGAPVIELHTGRYADAHTPAEQAAEF-RRIA 182

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             A   QK  L +NAGH L   N+   I A+P I E+++GHA  A A+  G + AV
Sbjct: 183 DGADAGQKHGLVVNAGHGLHYTNV-QPIAALPGIKELNIGHAIVAHAVFTGWENAV 237


>gi|295677173|ref|YP_003605697.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           CCGE1002]
 gi|295437016|gb|ADG16186.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           CCGE1002]
          Length = 254

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 124/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+ ++R L+
Sbjct: 13  LGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADAITLHLREDRRHIVDADVHKLRPLL 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E       L++  + +P  + LVP+   +LT++ G D       +    
Sbjct: 73  -----KTRMNLECAVTAEMLDIACQVQPHDVCLVPEKRAELTTEGGLDVAGQFEAVRAAC 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L +  SR+SLF D   +E  ++AA   GA  IEL+TG Y   ++  +Q+R +  ++  
Sbjct: 128 KQLADANSRVSLFID--PDETQIRAAHEAGAPVIELHTGRYAEAHDPAEQQREY-ERIVR 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                  + L++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV
Sbjct: 185 AVDFGTTLGLKVNAGHGLHYTNVQQ-IAAIDGIVELNIGHAIVAHAIFAGWDNAV 238


>gi|116073012|ref|ZP_01470274.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. RS9916]
 gi|116068317|gb|EAU74069.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. RS9916]
          Length = 248

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 125/240 (52%), Gaps = 10/240 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R+ 
Sbjct: 3   SLGVNIDHIANVRQARQTVEPDPVTMCLLAELGGADGITVHLREDRRHIQDRDVELLRQT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     ++ LN+E         +  R KP+ +TLVP+   ++T++ G D       LT  
Sbjct: 63  V-----RSRLNLEMAATGEMQTIALRIKPDMVTLVPERREEVTTEGGLDVAGQIPSLTSM 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V  L   G  +SLF D    +  L+A + TGA  +EL+TG Y     + Q     L +L 
Sbjct: 118 VQTLQGSGIPVSLFVDPELGQ--LKACQATGARWVELHTGTYAEASWDEQPAE--LARLT 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
                A+ + L++NAGH LT QN+   + AI  + E+++GH   A AL  G++ AV   R
Sbjct: 174 EATAQARALGLRVNAGHGLTYQNVEP-VAAIEGMEELNIGHTIVARALAVGLQAAVQEMR 232


>gi|113953542|ref|YP_730361.1| pyridoxine 5'-phosphate synthase [Synechococcus sp. CC9311]
 gi|122945712|sp|Q0IB11|PDXJ_SYNS3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|113880893|gb|ABI45851.1| pyridoxal phosphate biosynthetic protein PdxJ [Synechococcus sp.
           CC9311]
          Length = 249

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 77/236 (32%), Positives = 129/236 (54%), Gaps = 10/236 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V +  +A   GA G+T+H R D+RHI+  DL  +   
Sbjct: 3   SLGVNIDHIANVRQARRTVEPDPVPMALMAELGGADGITIHLREDRRHIQDRDLTLL--- 59

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              Q  +  LN+E       + +  R +P+ +TLVP+   ++T++ G D       L+  
Sbjct: 60  --GQTVRTRLNLEMAATTEMVEIALREQPDMVTLVPERREEVTTEGGLDVRSQCKSLSSV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           +  L +    +SLF D + N+  L+A + +GA  +EL+TG Y     + +++ I L +L 
Sbjct: 118 IDTLQSNDIPVSLFVDPDRNQ--LEACQQSGARWVELHTGRYAEA--SWREQPITLARLI 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              + A+ M L++NAGH LT QN+   I AI  + E+++GH   A AL  G++EAV
Sbjct: 174 EATEQARSMGLRVNAGHGLTYQNVEP-IAAIAGMEELNIGHTIVARALCVGLQEAV 228


>gi|304310582|ref|YP_003810180.1| Pyridoxal phosphate biosynthetic protein [gamma proteobacterium
           HdN1]
 gi|301796315|emb|CBL44523.1| Pyridoxal phosphate biosynthetic protein [gamma proteobacterium
           HdN1]
          Length = 246

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/240 (32%), Positives = 125/240 (52%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V     A ++GA G+TVH R D+RHI+  D+     LI
Sbjct: 9   LGVNVDHVATLRQARGTRFPDPVQAALDAEEAGADGITVHLREDRRHIQDRDV-----LI 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N+E    +  L + ER KP    LVP+   + T++ G D +  +  +    
Sbjct: 64  LKDVLQTRMNLEMAVTDEMLAIAERVKPPHCCLVPERREERTTEGGLDVVSQRERVRHAC 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G   SLF     ++  +QAA   GA  IEL+TG Y    +  + +  +  ++  
Sbjct: 124 ERLRAAGIEASLFI--APDKAQIQAAFDVGAPVIELHTGHYADALSAEETKTAY-GQIVE 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             Q A+ + L +NAGH L  QN+   I AI  I+E+++GH+  A A+  G+KEAV   +R
Sbjct: 181 AVQYARSLGLIVNAGHGLHYQNVEP-IAAIKGINELNIGHSIVARAVFTGLKEAVREMKR 239


>gi|297539121|ref|YP_003674890.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylotenera sp.
           301]
 gi|297258468|gb|ADI30313.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylotenera sp.
           301]
          Length = 242

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/236 (31%), Positives = 124/236 (52%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +R  R   +P++V     A QSGA  +T+H R D+RH++  D+  +R L
Sbjct: 3   KLGVNIDHVATIRQARGTKYPSVVQAALRAEQSGADSITLHLREDRRHMQDADVHALRNL 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     +  +N+E    +  +++     P+ + LVP+   + T++ G D + N A + K 
Sbjct: 63  L-----QTRMNLECAVTDEMIDIALEVSPQDVCLVPERREERTTEGGLDVIGNFANVQKA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V +L + G R+SLF   +  +  + AAK  GA  IEL+TG +    N   ++R  L ++ 
Sbjct: 118 VKKLSDAGIRVSLFIGPDAAQ--IDAAKKAGAPVIELHTGTFADAENPVDKDR-ELQRIK 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
                  K+ L +NAGH L   N+   I +I  I E+++GHA  A AL  G   AV
Sbjct: 175 DAVNHGLKLGLVVNAGHGLHYHNVHE-IASIEGIDELNIGHAIVAHALFVGWDNAV 229


>gi|292489087|ref|YP_003531974.1| Pyridoxine 5'-phosphate synthase [Erwinia amylovora CFBP1430]
 gi|292900211|ref|YP_003539580.1| pyridoxal phosphate biosynthetic protein [Erwinia amylovora ATCC
           49946]
 gi|291200059|emb|CBJ47185.1| pyridoxal phosphate biosynthetic protein [Erwinia amylovora ATCC
           49946]
 gi|291554521|emb|CBA22088.1| Pyridoxine 5'-phosphate synthase [Erwinia amylovora CFBP1430]
 gi|312173245|emb|CBX81500.1| Pyridoxine 5'-phosphate synthase [Erwinia amylovora ATCC BAA-2158]
          Length = 243

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 123/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ V    ++ Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHVATVRNARGTHYPDPVQAAYVSEQAGADGITVHLREDRRHITDRDVRILRETI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++    +P    LVP+   ++T++ G D    Q  +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVDIACEIQPHFCCLVPEKREEVTTEGGLDVAGQQDKVTAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL+  G  +SLF D +  +  + AA   GA  IE++TG Y      P ++   L ++A 
Sbjct: 121 KRLNAAGILVSLFIDADPRQ--IDAAVAAGAPYIEIHTGAYAEAQEGPARD-AELARIAE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               A    L++NAGH LT  N+   + A+P + E+++GHA    A+  G+  AV
Sbjct: 178 ATTYAAGKGLKVNAGHGLTYHNVLP-VAALPEMHELNIGHAIIGRAMFSGLAAAV 231


>gi|259907680|ref|YP_002648036.1| pyridoxine 5'-phosphate synthase [Erwinia pyrifoliae Ep1/96]
 gi|224963302|emb|CAX54787.1| Pyridoxal phosphate biosynthetic protein (PNP synthase) [Erwinia
           pyrifoliae Ep1/96]
 gi|283477531|emb|CAY73447.1| Pyridoxine 5'-phosphate synthase [Erwinia pyrifoliae DSM 12163]
 gi|310764812|gb|ADP09762.1| pyridoxine 5'-phosphate synthase [Erwinia sp. Ejp617]
          Length = 243

 Score =  117 bits (294), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 123/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ V    ++ Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHVATVRNARGTHYPDPVQAAFVSEQAGADGITVHLREDRRHITDRDVRILRETI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++    +P    LVP+   ++T++ G D    Q  +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVDIACEIQPHFCCLVPEKREEVTTEGGLDVAAQQDKVTAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G  +SLF D +  +  + AA   GA  IE++TG Y      P ++   L ++A 
Sbjct: 121 KRLSAAGILVSLFIDADPRQ--IDAAVAAGAPYIEIHTGAYAEAPEGPARD-AELARIAE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   + A+P + E+++GHA    A+  G+  AV
Sbjct: 178 AATCAAGKGLKVNAGHGLTYHNVLP-VAALPEMHELNIGHAIIGRAVFTGLAAAV 231


>gi|119489401|ref|ZP_01622181.1| pyridoxal phosphate biosynthetic protein [Lyngbya sp. PCC 8106]
 gi|119454674|gb|EAW35820.1| pyridoxal phosphate biosynthetic protein [Lyngbya sp. PCC 8106]
          Length = 238

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/243 (32%), Positives = 131/243 (53%), Gaps = 12/243 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ +A LR  R    P+ V    IA  +GA G+TVH R D+RHI+  D+    RL
Sbjct: 3   TLGVNIDHIATLRQARRTVEPDPVAGAVIAELAGADGITVHLREDRRHIQERDV----RL 58

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           + E   +  LN+E  P +  + +    KP+ ITLVP+   ++T++ G D +     +TK 
Sbjct: 59  LRETV-RTHLNLEMAPTDEMVTIALEIKPDYITLVPERREEVTTEGGLDIVGQIERMTKV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V +L + G  +SLF D N  +  + A+  T A  +EL+TG Y       Q + + +  L 
Sbjct: 118 VGQLQDAGIPVSLFIDANPAQ--IGASARTKAVFVELHTGCYADAKGEQQDKELAV--LI 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNI-PNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
             ++LA    L++NAGH LT  N+ P  +  I  + E+++GH   + A+  G++ AV   
Sbjct: 174 AGSKLALDAGLRVNAGHGLTYWNVYP--VACIEGMEELNIGHTIISRAVLVGLERAVREM 231

Query: 243 RRA 245
           ++A
Sbjct: 232 KQA 234


>gi|238788221|ref|ZP_04632016.1| Pyridoxal phosphate biosynthetic protein [Yersinia frederiksenii
           ATCC 33641]
 gi|238723808|gb|EEQ15453.1| Pyridoxal phosphate biosynthetic protein [Yersinia frederiksenii
           ATCC 33641]
          Length = 243

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 125/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++    +P    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVDIACELQPHFCCLVPEKRQEVTTEGGLDVAGQIDKMTIAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G  +SLF D +  +  + AA   GA  IE++TG Y    ++  ++   L ++A 
Sbjct: 121 SRLSEAGILVSLFIDADMRQ--IDAAVTVGAPYIEIHTGAYADATSDLARQA-ELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMSGLATAV 231


>gi|238753921|ref|ZP_04615281.1| Pyridoxal phosphate biosynthetic protein [Yersinia ruckeri ATCC
           29473]
 gi|238707909|gb|EEQ00267.1| Pyridoxal phosphate biosynthetic protein [Yersinia ruckeri ATCC
           29473]
          Length = 243

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 78/235 (33%), Positives = 123/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVQAAFIAEQNGAEGITVHLREDRRHITDRDVRILRETI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  L +    KP    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMLAIACELKPHFCCLVPEKREEVTTEGGLDVAGQLDKMTFAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L + G  +SLF D   ++  + AA   GA  IE++TG Y     +  ++   L ++A 
Sbjct: 121 EQLTDAGILVSLFID--ADKRQIDAAVAAGAPYIEIHTGAYADAQTHLSRQAELL-RIAN 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A +  L++NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV
Sbjct: 178 AASYAAEKGLKVNAGHGLTYHNVQP-IAALPEIHELNIGHAIIGQAVMTGLAVAV 231


>gi|88812352|ref|ZP_01127602.1| Pyridoxal phosphate biosynthetic protein PdxJ [Nitrococcus mobilis
           Nb-231]
 gi|88790359|gb|EAR21476.1| Pyridoxal phosphate biosynthetic protein PdxJ [Nitrococcus mobilis
           Nb-231]
          Length = 254

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 122/240 (50%), Gaps = 9/240 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V    +A Q+GA+ +T+H R D+RHI+  DL  +R ++
Sbjct: 12  LGVNIDHVATLRQARGTRYPDPVQAAIVAEQAGANAVTLHLREDRRHIQERDLRLLRDIV 71

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +A LN+E       L + ERY+P    +VP+   +LT++ G D     A   +  
Sbjct: 72  -----QARLNLEMAMTAEMLEIAERYRPHDSCIVPERREELTTEGGLDVRAQLARTREAC 126

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL   G +++LF D    +  + AA   GA C+E++TG Y        +    L ++  
Sbjct: 127 TRLRAAGVQVALFIDPEIEQ--IDAAVEAGAPCVEIHTGHYAEAAETASRAH-ELERIRA 183

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244
             +   +  LQ+NAGH L  +N+   + A+  +  +++GHA  A A+  G   AV   RR
Sbjct: 184 AVRHGLQRGLQVNAGHGLNYRNVKP-VAALAGLGTLNIGHAIVAQAVFVGFATAVGDMRR 242


>gi|94264469|ref|ZP_01288257.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93455100|gb|EAT05324.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 440

 Score =  117 bits (293), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 129/235 (54%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +++N++ VA LR  R +  P+ V    I   +GA+G+ VH R D+RHI+  DL  +++ +
Sbjct: 201 LAINVDHVATLRQARGINEPDPVLAAGICELAGAAGIVVHLREDRRHIQDRDLQLLKQTV 260

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K++LN+E   N   + +    +P+ +TLVP+   +LT++ G +    +  LT  +
Sbjct: 261 -----KSKLNLEMGANPEIIAIALELQPDMVTLVPEKRRELTTEGGLNVKGGRKKLTGVI 315

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +    G  +SLF D +  +  ++AA   GA  +E++TG Y    +  +QE  F   +A 
Sbjct: 316 EQFRQKGIPVSLFIDPDARQ--IEAAAAIGATFVEIHTGRYCDATSEAEQELEF-ALVAE 372

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A +A +  L++NAGH L  +N    I A+  I E+S+GHA  A A+  G++ AV
Sbjct: 373 AADIAWQAGLRVNAGHGLNYRNT-GRIAALENIEELSIGHAIMARAIMVGLERAV 426


>gi|170695425|ref|ZP_02886570.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           graminis C4D1M]
 gi|170139616|gb|EDT07799.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           graminis C4D1M]
          Length = 254

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 124/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+  +R L+
Sbjct: 13  LGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADAITLHLREDRRHIVDADVRALRPLL 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E    +  L++    +P  + LVP+   +LT++ G D       +    
Sbjct: 73  -----KTRMNLECAVTQEMLDIACDVQPHDVCLVPEKRQELTTEGGLDVAGQFEAVRAAC 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L +  SR+SLF D   +E  ++AA   GA  IEL+TG Y   ++  +Q+R +  ++  
Sbjct: 128 RQLADANSRVSLFID--PDETQIRAAHEAGAPVIELHTGRYAEAHDPAEQQREY-ERVVR 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             +    + +++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV
Sbjct: 185 AVEFGATLGIKVNAGHGLHYTNVQQ-IAAIDGIVELNIGHAIVAHAIFAGWDNAV 238


>gi|153005194|ref|YP_001379519.1| pyridoxine 5'-phosphate synthase [Anaeromyxobacter sp. Fw109-5]
 gi|152028767|gb|ABS26535.1| pyridoxal phosphate biosynthetic protein PdxJ [Anaeromyxobacter sp.
           Fw109-5]
          Length = 242

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 127/244 (52%), Gaps = 11/244 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   + VN++ VA LR  R   +P+ V    +A  +GA  +T+H R D+RHI+  DL  +
Sbjct: 1   MPARLGVNVDHVATLRQSRRTTYPDPVAAVVLAELAGADQITIHLREDRRHIQERDLQIL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           RR +       +LN+E    +  + +    KP+ +TLVP+   +LT++ G D    +  +
Sbjct: 61  RRTV-----ATKLNLEMAATQEMVKIAYEVKPDVVTLVPERREELTTEGGLDVFGGRENV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN-PQQERIFL 179
            K V  L +   ++SLF D + ++  ++AA    A  +E +TG Y  C        R  L
Sbjct: 116 RKVVKTLRDADIKVSLFIDPDLDQ--VKAAHRAEAATVEFHTGRY--CDARLASDRRKEL 171

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           ++L    + A K+ L++ AGH L  QN+   + AIP I E+++GH+    A+  G++ AV
Sbjct: 172 SRLVDACKAAAKLGLEVAAGHGLNYQNVVP-VAAIPEIEELNIGHSIVGRAVLVGMERAV 230

Query: 240 FCFR 243
              R
Sbjct: 231 REMR 234


>gi|32468432|emb|CAD88346.1| GdpxJ protein [Porphyromonas gingivalis]
          Length = 126

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 59/132 (44%), Positives = 83/132 (62%), Gaps = 7/132 (5%)

Query: 40  GLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVP 99
           G+TVHPR D+RHIR +D+ ++++ +  +F     NIEG P+E F+ L E  +PEQ+T+VP
Sbjct: 1   GITVHPRLDERHIRRSDVYDLKKALTTEF-----NIEGNPDERFIRLIEEIRPEQVTMVP 55

Query: 100 DDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIE 159
           D P  LTS+ GWD  +N   L + V R H  G R S+F D + +  ++  A  TG D IE
Sbjct: 56  DAPDVLTSNAGWDVARNYDHLCRLVERFHAWGIRTSIFIDTDLD--NISWAAKTGTDRIE 113

Query: 160 LYTGPYGACYNN 171
           LYT PY A Y+ 
Sbjct: 114 LYTEPYAAAYHK 125


>gi|88808740|ref|ZP_01124250.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. WH
           7805]
 gi|88787728|gb|EAR18885.1| pyridoxal phosphate biosynthetic protein [Synechococcus sp. WH
           7805]
          Length = 249

 Score =  117 bits (293), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 74/240 (30%), Positives = 129/240 (53%), Gaps = 10/240 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           S+ VN++ +A +R  R    P+ V +  +A   GA G+TVH R D+RHI+  D+  +R+ 
Sbjct: 3   SLGVNIDHIANVRQARRTVEPDPVPMALLAELGGADGITVHLREDRRHIQDRDVDLLRQT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     +  LN+E    +  +++  R +P+ +TLVP+   +++++ G D    +A L+  
Sbjct: 63  V-----RTRLNLEMAATDEMISIALRVQPDMVTLVPERREEVSTEGGLDVSSQRADLSIK 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           ++ L + G  +SLF D    +  LQA +   A  +EL+TG Y       Q     L +L 
Sbjct: 118 ISSLQDAGIPVSLFVDPEKGQ--LQACRDCKARWVELHTGTYAESKWTDQPAE--LARLI 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
               LA+   L++NAGH LT QN+   +  I  + E+++GH+  A +L  G+++AV   R
Sbjct: 174 EATALARSFGLRVNAGHGLTYQNV-EPVACIDGMEELNIGHSIVARSLAVGLQQAVREMR 232


>gi|91207548|sp|Q2Y865|PDXJ_NITMU RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
          Length = 241

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 122/237 (51%), Gaps = 11/237 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LR  R   +P+ +    IA  +GA  +T+H R D+RHI+  D+  +R  
Sbjct: 3   KLGVNIDHVATLRQARGTTYPDPIEAALIAESAGADAITLHLREDRRHIQDRDVEILRGA 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     K  +N+E    +  +    R KP  I LVP+   +LT++ G D  ++   + + 
Sbjct: 63  L-----KTRMNLESAVTDEMIGFALRIKPHDICLVPERREELTTEGGLDVARHFEQVQRA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLNKL 182
             RL   G R+SLF D    +  + A+   GA  IE++TG Y  A   + QQ  +   + 
Sbjct: 118 CHRLAEAGIRVSLFVDAEPAQ--IDASVEAGAPVIEIHTGHYADAQTTDEQQGELERVRA 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           A++  L     L +NAGH L   N+   I AIP +SE+++GHA  A AL  G + AV
Sbjct: 176 AVSKGL--NHGLTVNAGHGLHYLNV-QAIAAIPGVSELNIGHAIVARALFVGFERAV 229


>gi|126667178|ref|ZP_01738152.1| pyridoxal phosphate biosynthetic protein [Marinobacter sp. ELB17]
 gi|126628334|gb|EAZ98957.1| pyridoxal phosphate biosynthetic protein [Marinobacter sp. ELB17]
          Length = 244

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 79/235 (33%), Positives = 124/235 (52%), Gaps = 10/235 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V    +A ++GA G+T+HPR D+RHI+  D+  +R  +
Sbjct: 7   LGVNIDHVATLRQARGTRYPDPVQAALLAEEAGADGITIHPREDRRHIQDRDVLLLRDTL 66

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                + ++N+E    +  L+  E+ +P  + LVP+   +LT++ G D    +A + K  
Sbjct: 67  -----QTKMNLEMAVTDAMLDFAEQIRPACVCLVPEKREELTTEGGLDVEGQEARIAKAC 121

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G+ +SLF D   N+  + AA   GA  IEL+TG Y                L  
Sbjct: 122 ERLAAIGAEVSLFID--PNKIQIDAAVRCGAPVIELHTGEYAEASGAAADA--AFKVLVE 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               A+K  L +NAGH L   N    + AI  I+E+++GHA  A A+  G+KEAV
Sbjct: 178 AVSYARKKGLVVNAGHGLNYHNTER-VAAIAGINELNIGHAIIARAVFTGLKEAV 231


>gi|332162688|ref|YP_004299265.1| pyridoxine 5'-phosphate synthase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|318606793|emb|CBY28291.1| pyridoxine 5'-phosphate synthase [Yersinia enterocolitica subsp.
           palearctica Y11]
 gi|325666918|gb|ADZ43562.1| pyridoxine 5'-phosphate synthase [Yersinia enterocolitica subsp.
           palearctica 105.5R(r)]
 gi|330860316|emb|CBX70630.1| pyridoxine 5'-phosphate synthase [Yersinia enterocolitica W22703]
          Length = 243

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 122/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRETI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +     P    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVGIACEINPHFCCLVPEKRQEVTTEGGLDVAGQIDKMTVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G  +SLF D +  +  + AA   GA  IE++TG Y    ++  ++   L ++A 
Sbjct: 121 SRLAEAGILVSLFIDADMRQ--IDAAVAVGAPYIEIHTGAYADATSDLARQA-ELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV
Sbjct: 178 AATYAASKGLKVNAGHGLTYHNVQP-IAALPEIHELNIGHAIIGQAVMSGLAAAV 231


>gi|291287213|ref|YP_003504029.1| pyridoxal phosphate biosynthetic protein PdxJ [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290884373|gb|ADD68073.1| pyridoxal phosphate biosynthetic protein PdxJ [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 244

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 71/235 (30%), Positives = 127/235 (54%), Gaps = 10/235 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +R  R    P+ VH   +A   GA  +TVH R D+RHI   DL  +R  I
Sbjct: 4   LGVNIDHVATVRQARLGVEPDPVHAAVLAELGGADQITVHLREDRRHINDRDLRVLRETI 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  LN+E       + +    +P+ +TLVP+   +LT++ G D ++N   +   V
Sbjct: 64  -----KTRLNLEMACTPEMVEIALETEPDMVTLVPEKRQELTTEGGLDVIKNFETINDAV 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           + L + G  +SLF D +  +  + A+  T A  +EL+TG Y       Q+E   L+++  
Sbjct: 119 STLKSAGIFVSLFVDPDNKQ--IDASAETHASAVELHTGAYADAKGAAQREE--LSRIMF 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             + ++++ L +N+GH L  +N+  ++  IP + E+++GH+  + A+  G+++AV
Sbjct: 175 AGEKSRELGLVLNSGHGLNYRNVGEIV-CIPGMYEVNIGHSIISRAIYVGLEKAV 228


>gi|82702882|ref|YP_412448.1| pyridoxal phosphate biosynthetic protein PdxJ [Nitrosospira
           multiformis ATCC 25196]
 gi|82410947|gb|ABB75056.1| pyridoxine 5'-phosphate synthase [Nitrosospira multiformis ATCC
           25196]
          Length = 265

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 122/237 (51%), Gaps = 11/237 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LR  R   +P+ +    IA  +GA  +T+H R D+RHI+  D+  +R  
Sbjct: 27  KLGVNIDHVATLRQARGTTYPDPIEAALIAESAGADAITLHLREDRRHIQDRDVEILRGA 86

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     K  +N+E    +  +    R KP  I LVP+   +LT++ G D  ++   + + 
Sbjct: 87  L-----KTRMNLESAVTDEMIGFALRIKPHDICLVPERREELTTEGGLDVARHFEQVQRA 141

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG-ACYNNPQQERIFLNKL 182
             RL   G R+SLF D    +  + A+   GA  IE++TG Y  A   + QQ  +   + 
Sbjct: 142 CHRLAEAGIRVSLFVDAEPAQ--IDASVEAGAPVIEIHTGHYADAQTTDEQQGELERVRA 199

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           A++  L     L +NAGH L   N+   I AIP +SE+++GHA  A AL  G + AV
Sbjct: 200 AVSKGL--NHGLTVNAGHGLHYLNV-QAIAAIPGVSELNIGHAIVARALFVGFERAV 253


>gi|254486425|ref|ZP_05099630.1| pyridoxal phosphate biosynthetic protein PdxJ [Roseobacter sp.
           GAI101]
 gi|214043294|gb|EEB83932.1| pyridoxal phosphate biosynthetic protein PdxJ [Roseobacter sp.
           GAI101]
          Length = 250

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 122/242 (50%), Gaps = 10/242 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ +   ++A ++GA G+T H R D+RHI   D+  +  ++
Sbjct: 9   LGVNIDHVATVRNARGGAYPDPLRAARVAQEAGADGITAHLREDRRHITDADIEGLLEVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   LN E    +    +  R+KP  + +VP+   + T++ G +  + +  L   +
Sbjct: 69  -----TVPLNFEMAATDEMQKIALRHKPHAVCIVPEKREERTTEGGLEVAREENKLAHFI 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERI--FLNKL 182
           A L   G R+S+F      +  ++AA   GA+ IEL+TG Y   +     E     L KL
Sbjct: 124 APLREAGCRVSIFI--AAEQRQIEAANRIGAEVIELHTGAYCDAFAEGHWEEAQKELQKL 181

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              AQ   ++ L+I+AGH LT   + + I + P + E+++GH     A+  G+  A+   
Sbjct: 182 EEMAQYGHELGLEIHAGHGLTYDTVSS-IASFPQVKELNIGHFLVGEAIFLGLGPAIHEM 240

Query: 243 RR 244
           RR
Sbjct: 241 RR 242


>gi|325123048|gb|ADY82571.1| pyridoxal phosphate biosynthetic protein PdxJ [Acinetobacter
           calcoaceticus PHEA-2]
          Length = 241

 Score =  117 bits (292), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/245 (30%), Positives = 127/245 (51%), Gaps = 9/245 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  ++GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTTYPDPVEAALICEEAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RPLL-----KTRMNLELAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +  + AA   GA  IEL+TG Y A     Q ++  L 
Sbjct: 116 KAATQTLAAIGCDVSLFIDADLAQ--IDAAVACGAPTIELHTGAY-ADAETEQDQQAELE 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L + NI   I AIP I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIIKGVEYAASKGLVVNAGHGLNLINIAP-IAAIPQIHELNIGHSIIAESVFVGLVQAVK 231

Query: 241 CFRRA 245
             + A
Sbjct: 232 DMKTA 236


>gi|238784190|ref|ZP_04628203.1| Pyridoxine 5'-phosphate synthase [Yersinia bercovieri ATCC 43970]
 gi|238714899|gb|EEQ06898.1| Pyridoxine 5'-phosphate synthase [Yersinia bercovieri ATCC 43970]
          Length = 243

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 122/237 (51%), Gaps = 13/237 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    +P    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVGIACELQPHFCCLVPEKRQEVTTEGGLDVAGQIDKMTVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNKL 182
           +RL   G  +SLF D +  +  + AA   GA  IE++TG Y     +   Q E + + K 
Sbjct: 121 SRLAEAGILVSLFIDADMRQ--IDAAVTVGAPYIEIHTGAYADATTDLARQAELVRITK- 177

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A  A    L++NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV
Sbjct: 178 --AATYAASKGLKVNAGHGLTYHNVQP-IAALPEIHELNIGHAIIGQAVMTGLAAAV 231


>gi|323526856|ref|YP_004229009.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           CCGE1001]
 gi|323383858|gb|ADX55949.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia sp.
           CCGE1001]
          Length = 254

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 123/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +    +A ++GA  +T+H R D+RHI   D+  +R L+
Sbjct: 13  LGVNIDHVATLRNARGTSYPDPIRAALMAEEAGADAITLHLREDRRHIVDADVRALRPLL 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E    +  L++    +P  + LVP+   +LT++ G D       +    
Sbjct: 73  -----KTRMNLECAVTQEMLDIACEVQPHDVCLVPEKRQELTTEGGLDVAGQFEAVRAAC 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L +  SR+SLF D   +E  ++AA   GA  IEL+TG Y    +  +Q+R +  ++  
Sbjct: 128 RQLADANSRVSLFID--PDETQIRAAHEAGAPVIELHTGRYAEARDPAEQQREY-ERVVR 184

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             +    + +++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV
Sbjct: 185 AVEFGATLGIKVNAGHGLHYTNVQQ-IAAIDGIVELNIGHAIVAHAIFAGWDNAV 238


>gi|93005200|ref|YP_579637.1| pyridoxal phosphate biosynthetic protein PdxJ [Psychrobacter
           cryohalolentis K5]
 gi|122415960|sp|Q1QDV0|PDXJ_PSYCK RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|92392878|gb|ABE74153.1| pyridoxal phosphate biosynthetic protein PdxJ [Psychrobacter
           cryohalolentis K5]
          Length = 264

 Score =  116 bits (291), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 131/245 (53%), Gaps = 12/245 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R + +P+ +    +  ++GA G+T+H R D+RHI+  D+ E+   +
Sbjct: 25  LGVNVDHVATLRQARGVGYPSPLAAALLCEKAGADGITIHLREDRRHIQDADVYEMAGQL 84

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   +N+E       L++  + KP  + LVP+   +LT++ G D     A LT  V
Sbjct: 85  -----TTRMNLEMAATTEMLDIACQVKPYWVCLVPEKRAELTTEGGLDVAGQLASLTDYV 139

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER--IFLNKL 182
           ++L   G ++SLF D    +  ++AA    AD IEL+TG Y       + +R  + L ++
Sbjct: 140 SQLQAAGIKVSLFID--PEDKQIEAAVNCSADAIELHTGSYAEAGLAGKTDRVNVELERI 197

Query: 183 AITAQLAQKMD--LQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
                 A+++D  L +NAGH LT  N+ + I  I  I E+++GHA  A AL  G+++AV 
Sbjct: 198 KNAVITAKRLDSKLLVNAGHGLTRDNV-HAIAQIDGIYELNIGHALIADALFVGIEQAVI 256

Query: 241 CFRRA 245
             + A
Sbjct: 257 MMKTA 261


>gi|94271344|ref|ZP_01291941.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
 gi|93450472|gb|EAT01646.1| conserved hypothetical protein [delta proteobacterium MLMS-1]
          Length = 440

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 129/235 (54%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +++N++ VA LR  R +  P+ V    I   +GA+G+ VH R D+RHI+  DL  +++ +
Sbjct: 201 LAINVDHVATLRQARGINEPDPVLAAGICELAGAAGIVVHLREDRRHIQDRDLQLLKQTV 260

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K++LN+E   N   + +    +P+ +TLVP+   +LT++ G +    +  LT  +
Sbjct: 261 -----KSKLNLEMGANPEIIAIALELQPDMVTLVPEKRRELTTEGGLNVKGGRKKLTGVI 315

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +    G  +SLF D +  +  ++AA   GA  +E++TG Y    +  +QE  F   +A 
Sbjct: 316 EQFRQKGIPVSLFIDPDARQ--IEAAAAIGATFVEIHTGRYCDATSEAEQELEF-ALVAE 372

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A +A +  L++NAGH L  +N    I A+  I E+S+GHA  A A+  G++ AV
Sbjct: 373 AADIAWQAGLRVNAGHGLNYRNT-GRIAALENIEELSIGHAIMARAILVGLERAV 426


>gi|167563523|ref|ZP_02356439.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           oklahomensis EO147]
 gi|167570684|ref|ZP_02363558.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           oklahomensis C6786]
          Length = 257

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 79/238 (33%), Positives = 125/238 (52%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +  + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R
Sbjct: 10  AIELGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLR 69

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+     K  +N+E       L++    +P    LVP+   +LT++ G D   +   + 
Sbjct: 70  PLL-----KTRMNLECAVTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVAGHFDAVR 124

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L N+G R+SLF D   ++  ++AA  TGA  IEL+TG Y   ++  +QER F  +
Sbjct: 125 AACKQLANVGVRVSLFID--PDDAQIRAAHETGAPVIELHTGRYADAHDEAEQEREF-ER 181

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A        + L++NAGH L   N+   I A+P I E+++GHA  A A+  G   AV
Sbjct: 182 IAAGVDAGIALGLKVNAGHGLHYTNV-QAIAALPGIDELNIGHAIVAHAVFVGWDNAV 238


>gi|218530500|ref|YP_002421316.1| pyridoxine 5'-phosphate synthase [Methylobacterium chloromethanicum
           CM4]
 gi|218522803|gb|ACK83388.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylobacterium
           chloromethanicum CM4]
          Length = 249

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 133/260 (51%), Gaps = 15/260 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA +RN R    P+ V     A+ +GA G+T H R D+RHIR  D+  +R
Sbjct: 3   SLRLGVNIDHVATVRNARGGFAPDPVRAAHEAVAAGADGITAHLREDRRHIRDADIAALR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           +L         LN+E    +  + +    +P    LVP+   + T++ G D +  +A L 
Sbjct: 63  KL------PVPLNLEMAATDEMVGIALATQPHAACLVPEKREERTTEGGLDIIAGRAHLA 116

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF--L 179
             +A L   G R+SLF +   +E  ++AA    A  +EL+TG Y        Q+RI   L
Sbjct: 117 PRIATLSEAGIRVSLFVE--PDEAVMEAAHALQAPVVELHTGSYCEAVIEGDQKRIAHEL 174

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++   +     + L+I+AGH LT++++   + A+P I E+++GHA  A A+  G+++AV
Sbjct: 175 GRIVRASAHGAGLGLEIHAGHGLTVESV-GPVAALPQIRELNIGHALIAEAIFVGLRQAV 233

Query: 240 FCFRRACGQHLDNTMRLTHP 259
              R A    +D   R   P
Sbjct: 234 HDMRAA----MDRARRKAEP 249


>gi|238796738|ref|ZP_04640244.1| Pyridoxine 5'-phosphate synthase [Yersinia mollaretii ATCC 43969]
 gi|238719469|gb|EEQ11279.1| Pyridoxine 5'-phosphate synthase [Yersinia mollaretii ATCC 43969]
          Length = 243

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 122/237 (51%), Gaps = 13/237 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ +    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPIQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    +P    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVGIACELQPHFCCLVPEKRQEVTTEGGLDVAGQIDKMTIAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNKL 182
           +RL   G  +SLF D +  +  + AA   GA  IE++TG Y     +   Q E + + K 
Sbjct: 121 SRLAEAGILVSLFIDADMRQ--IDAAVTVGAPYIEIHTGAYADAITDLARQAELVRITK- 177

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A  A    L++NAGH LT  N+   I A+P I E+++GHA    A+  G+  AV
Sbjct: 178 --AATYAASKGLKVNAGHGLTYHNVQP-IAALPEIQELNIGHAIIGQAVMTGLAAAV 231


>gi|240138859|ref|YP_002963334.1| Pyridoxal phosphate biosynthetic protein pdxJ (PNP synthase)
           [Methylobacterium extorquens AM1]
 gi|240008831|gb|ACS40057.1| Pyridoxal phosphate biosynthetic protein pdxJ (PNP synthase)
           [Methylobacterium extorquens AM1]
          Length = 249

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 133/260 (51%), Gaps = 15/260 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA +RN R    P+ V     A+ +GA G+T H R D+RHIR  D+  +R
Sbjct: 3   SLRLGVNIDHVATVRNARGGFAPDPVRAAHEAVAAGADGITAHLREDRRHIRDDDIAALR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           +L         LN+E    +  + +    +P    LVP+   + T++ G D +  +A L 
Sbjct: 63  KL------PVPLNLEMAATDEMVGIALATQPHAACLVPEKREERTTEGGLDIIAGRAHLA 116

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF--L 179
             +A L   G R+SLF +   +E  ++AA    A  +EL+TG Y        Q RI   L
Sbjct: 117 PRIATLSKAGIRVSLFVE--PDEAVMEAAHALQAPVVELHTGSYCEAVIEGDQSRIAHEL 174

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++   +     + L+I+AGH LT++++ + + A+P I E+++GHA  A A+  G+++AV
Sbjct: 175 GRIVRASAHGAGLGLEIHAGHGLTVESVGS-VAALPQIRELNIGHALIAEAIFVGLRQAV 233

Query: 240 FCFRRACGQHLDNTMRLTHP 259
              R A    +D   R   P
Sbjct: 234 HDMRAA----MDRARRKAEP 249


>gi|87198933|ref|YP_496190.1| pyridoxal phosphate biosynthetic protein PdxJ [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87134614|gb|ABD25356.1| pyridoxine 5'-phosphate synthase [Novosphingobium aromaticivorans
           DSM 12444]
          Length = 247

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 78/239 (32%), Positives = 121/239 (50%), Gaps = 10/239 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R    P+ V   +I    G  G+T H R D+RHIR  DL  I+   
Sbjct: 12  LGVNIDHVATIRNARGGDHPDPVRAAEIVAAVGGDGITAHLREDRRHIRDEDLARIQAAT 71

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
               P   LN+E    +  L +  R+KP    +VP+   + T++ G D       L   V
Sbjct: 72  --SLP---LNLEMAATDEMLEIALRHKPHAACIVPERREERTTEGGLDAAGQHNRLAPIV 126

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL + G R+SLF      +  ++AA   GA  +EL+TG Y     + +   + L ++A 
Sbjct: 127 ARLSDAGIRVSLFIAPEPRQ--IEAAMKLGAPVVELHTGEYAHAEGDARA--VELRRIAD 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A LA +  ++ +AGH LT +N+   I AIP ++E+++GH     A+  G+  AV   R
Sbjct: 183 MAALAARNGIEPHAGHGLTYENV-QPIAAIPQLAELNIGHYLIGEAIFVGLDTAVRRMR 240


>gi|157413578|ref|YP_001484444.1| pyridoxine 5'-phosphate synthase [Prochlorococcus marinus str. MIT
           9215]
 gi|166980407|sp|A8G5H7|PDXJ_PROM2 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|157388153|gb|ABV50858.1| Pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9215]
          Length = 238

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 74/236 (31%), Positives = 124/236 (52%), Gaps = 10/236 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ +A +R  R    P+ V    +A   GA  +TVH R D+RHI+  DL  ++  
Sbjct: 3   TLGVNIDHIANVRQARKTVEPDPVQFAFLAELGGADSITVHLREDRRHIQDRDLFLLKET 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I     K +LN+E    E  L + ++  P+ +TLVP+   ++T++ G D   N   L K 
Sbjct: 63  I-----KTKLNLEMAATEEMLEIAKKILPDYVTLVPEKREEVTTEGGLDLKSNVQYLKKA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V  L +    +S F D  G +  +  +K  G D IEL+TG Y     + Q +   L ++ 
Sbjct: 118 VGNLQDSNIEVSAFIDPLGEQ--INYSKEIGFDFIELHTGKYAKLSGSDQYKE--LQRII 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            +  LA  + L +NAGH L   N+   I +I  ++E+++GH+  A AL  G++++V
Sbjct: 174 ESTYLANDLGLVVNAGHGLNYNNVKK-IASINNMNELNIGHSIVARALAIGLEKSV 228


>gi|254429657|ref|ZP_05043364.1| pyridoxal phosphate biosynthetic protein PdxJ [Alcanivorax sp.
           DG881]
 gi|196195826|gb|EDX90785.1| pyridoxal phosphate biosynthetic protein PdxJ [Alcanivorax sp.
           DG881]
          Length = 241

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 80/242 (33%), Positives = 123/242 (50%), Gaps = 15/242 (6%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LR  R   +P  V    +A Q+GA G+TVH R D+RHI   D+  +    
Sbjct: 6   LGVNIDHIATLRQARGTRYPEPVQAALVAEQAGADGITVHLREDRRHINDRDVELL---- 61

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  +N+E    E  + +  R +P    LVP+   +LT++ G D   N+A + +  
Sbjct: 62  -AQTLQTRMNLEMAATEEMVGIACRIQPPHCCLVPEKREELTTEGGLDVAGNKAWIAQCC 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFLNKL 182
            RL   G  +SLF D   ++  + AA+  GA  IE++TG Y      +  QQE   L ++
Sbjct: 121 QRLGQAGIEVSLFID--ADKAQIAAARECGAPAIEIHTGGYADAETVDAQQQE---LARI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQN-IPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
                 A +  L +NAGH L   N +P  I  IP I+E+++GH+  A A   G+ EAV  
Sbjct: 176 REGVAFALEQGLVVNAGHGLHYHNTLP--IAEIPGINELNIGHSIIARAAITGLDEAVRS 233

Query: 242 FR 243
            R
Sbjct: 234 MR 235


>gi|148264770|ref|YP_001231476.1| pyridoxine 5'-phosphate synthase [Geobacter uraniireducens Rf4]
 gi|189036749|sp|A5G535|PDXJ_GEOUR RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|146398270|gb|ABQ26903.1| pyridoxine 5'-phosphate synthase [Geobacter uraniireducens Rf4]
          Length = 239

 Score =  116 bits (291), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 82/237 (34%), Positives = 129/237 (54%), Gaps = 9/237 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA +R  R    P+ V    IA  +GA G+T+H R D+RHI+  DL  +R 
Sbjct: 2   AKLGVNIDHVATIRQARGGVEPDPVAAAAIAELAGADGITIHLREDRRHIQDRDLKLLR- 60

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
               Q  K  LN+E    +  +N+    KP+  TLVP+   +LT++ G D   N   + +
Sbjct: 61  ----QTVKTRLNLEMAATDEMVNIAISVKPDMCTLVPEKRQELTTEGGLDVRLNLESIKE 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V RL + G  +SLF D + ++  ++AA  TGAD IE++TG + A   + + E+  L K+
Sbjct: 117 AVQRLQDGGLIVSLFIDPDPDQ--IKAADKTGADYIEIHTGAF-AEARDWKSEQAELAKI 173

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               +LA K+ + INAGH L   NI   + A+  I E ++GH+  + A+  G+  AV
Sbjct: 174 ENAIKLAGKLGMGINAGHGLNYANIRK-VAALGGIEEYNIGHSIISKAVLVGLDRAV 229


>gi|193215547|ref|YP_001996746.1| pyridoxine 5'-phosphate synthase [Chloroherpeton thalassium ATCC
           35110]
 gi|238692693|sp|B3QTV1|PDXJ_CHLT3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|193089024|gb|ACF14299.1| pyridoxal phosphate biosynthetic protein PdxJ [Chloroherpeton
           thalassium ATCC 35110]
          Length = 236

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 123/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           ++VN++ +A LRN R    P+ V   ++A  SGASG+  H R D+RHI+  DL  +R  +
Sbjct: 3   LAVNIDHIATLRNARQETQPDPVTAARLAELSGASGIVCHLREDRRHIKDRDLELLRATV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                + +L++E    +    +  + KP+ +TLVP+   +LT++ G D +  +  L   +
Sbjct: 63  -----QTKLDLEMAMTKEMKAIAIKTKPDLVTLVPEKRQELTTEGGLDVITRKDDLIPYI 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G   SLF +      ++  A   GA  +EL+TG Y +   +P++    L +L  
Sbjct: 118 DELQQHGIPTSLFIEPTPE--AITVATEVGAAFVELHTGKY-SLLKSPKEIEAELLRLQD 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A LA+K  L++ AGH L  +N    I  I  I E+S+GHA  A A   G+ EAV
Sbjct: 175 AASLAKKFGLRVVAGHGLNYENTAE-IKRIKEIEEVSIGHALIARATLMGMSEAV 228


>gi|161344770|ref|NP_440111.2| pyridoxine 5'-phosphate synthase [Synechocystis sp. PCC 6803]
          Length = 241

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/243 (31%), Positives = 129/243 (53%), Gaps = 9/243 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ VA +R  R    P+ +    +A  +GA G+T H R D+RHI+  D+  +R+ 
Sbjct: 3   TLGVNIDHVATIRQARQTVEPDPIAAAVLAELAGADGITAHLREDRRHIQERDVEILRKT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     +  LN+E    +  + +    KP+ +TLVP+   ++T++ G D   N   L   
Sbjct: 63  V-----RTHLNLEMAATKEMVEIALNLKPDYVTLVPERREEVTTEGGLDVAGNLNYLLGV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V +L +    +SLF D +  +  L+A+  TGA  IEL+TG Y        Q R  L  LA
Sbjct: 118 VEQLQSRHIPVSLFIDPDVAQ--LKASAQTGAKFIELHTGKYANAPTADDQAR-ELGSLA 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
           I   +A ++ L+INAGH LT  N+   +  +P + E+++GH+  + A+  G++ AV   +
Sbjct: 175 IACDIALELGLRINAGHGLTYWNV-RPVAELPGMEELNIGHSIMSRAILVGMERAVREMK 233

Query: 244 RAC 246
            A 
Sbjct: 234 LAM 236


>gi|254490833|ref|ZP_05104016.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylophaga
           thiooxidans DMS010]
 gi|224464005|gb|EEF80271.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylophaga
           thiooxydans DMS010]
          Length = 243

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 80/256 (31%), Positives = 130/256 (50%), Gaps = 13/256 (5%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MS  + VN++ +A LR  R   +P+ +     A Q+GA  +T+H R D+RHI+  D+  +
Sbjct: 1   MSIFLGVNIDHIATLRQARGTRYPDPIQAAIEAEQAGADSITLHLREDRRHIQERDVAML 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
             ++     + ++N+E    E  L + E+Y+PE   LVP+   +LT++ G D       +
Sbjct: 61  TDIL-----QTKMNLEMAVTEEMLAIAEKYQPEDCCLVPEKREELTTEGGLDVAGQLERM 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            +   RL +   ++SLF D +  +  + AA   G   +EL+TG Y        +    L 
Sbjct: 116 KQACQRLADANIKVSLFIDPDLRQ--IDAAIACGVPIVELHTGRYAE-AETDAEAARELA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
            ++  A+ A    LQ+NAGH L   N    I AIP + E+++GHA  A +L  G+KEAV 
Sbjct: 173 IISEAAEQAHARGLQVNAGHGLHYHNTAP-IAAIPQLVELNIGHAIIARSLFTGLKEAV- 230

Query: 241 CFRRACGQHLDNTMRL 256
              R   Q + +  RL
Sbjct: 231 ---REMKQLMQDARRL 243


>gi|197122772|ref|YP_002134723.1| pyridoxine 5'-phosphate synthase [Anaeromyxobacter sp. K]
 gi|220917555|ref|YP_002492859.1| pyridoxal phosphate biosynthetic protein PdxJ [Anaeromyxobacter
           dehalogenans 2CP-1]
 gi|196172621|gb|ACG73594.1| pyridoxal phosphate biosynthetic protein PdxJ [Anaeromyxobacter sp.
           K]
 gi|219955409|gb|ACL65793.1| pyridoxal phosphate biosynthetic protein PdxJ [Anaeromyxobacter
           dehalogenans 2CP-1]
          Length = 242

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 127/243 (52%), Gaps = 9/243 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   + VN++ VA LR  R   +P+ V    +A   GA  +T+H R D+RHI+  DL  +
Sbjct: 1   MPARLGVNVDHVATLRQSRRTQYPDPVAAAVLAEMGGADQITIHLREDRRHIQERDLQVL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R+ +      + LN+E    +  + +    KP+  TLVP+   +LT++ G D +  +  +
Sbjct: 61  RKTV-----SSRLNLEMAATQDMVKIAYGVKPDIATLVPERREELTTEGGLDVVGGREHV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            K V  L +    +SLF D + ++  ++AA    A+ +EL+TG Y        + R  L+
Sbjct: 116 RKVVKTLRDAEIEVSLFIDPDLDQ--VKAAHRAEAEVVELHTGRYCDARLASDRRR-ELS 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A K+ L++ AGH L  QN+   + AIP I E+++GH+  A A+  G + AV 
Sbjct: 173 RVIDACKAAAKLGLRVAAGHGLNYQNVVP-VAAIPEIEELNIGHSIVARAVLVGFERAVR 231

Query: 241 CFR 243
             R
Sbjct: 232 EMR 234


>gi|238750383|ref|ZP_04611884.1| Pyridoxine 5'-phosphate synthase [Yersinia rohdei ATCC 43380]
 gi|238711314|gb|EEQ03531.1| Pyridoxine 5'-phosphate synthase [Yersinia rohdei ATCC 43380]
          Length = 243

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 123/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRETI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    +P    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVGIACELQPHFCCLVPEKRQEVTTEGGLDVAGQIDKMTIAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G  +SLF D +  +  + AA   GA  IE++TG Y    ++  ++   L ++A 
Sbjct: 121 SRLSEAGILVSLFIDADMRQ--IDAAVAVGAPYIEIHTGAYADASSDLARQA-ELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV
Sbjct: 178 AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMTGLAAAV 231


>gi|295690022|ref|YP_003593715.1| pyridoxal phosphate biosynthetic protein PdxJ [Caulobacter segnis
           ATCC 21756]
 gi|295431925|gb|ADG11097.1| pyridoxal phosphate biosynthetic protein PdxJ [Caulobacter segnis
           ATCC 21756]
          Length = 252

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/245 (31%), Positives = 130/245 (53%), Gaps = 7/245 (2%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           MS  + VN++ VA +RN R   +P  V   ++AL +GA G+T H R D+RHI   D+  +
Sbjct: 1   MSLRLGVNIDHVATIRNARGSWYPEPVRAAELALAAGADGITAHLREDRRHISDADIAVL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
             L  ++     LN E    +  + +    KP    LVP+   ++T++ G D ++ QA +
Sbjct: 61  TDLCHKRGKP--LNFEMAVTDEMVEIALGAKPHAACLVPERREEVTTEGGLDVIKGQARI 118

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIF 178
               ARL  +G+R+SLF + +  +  ++A+   GA  +EL+TG Y   A      +    
Sbjct: 119 VAATARLRTVGARVSLFIEPDPEQ--IRASAAAGAQVVELHTGAYCDAARAGEASRAETI 176

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           L +L + A LA ++ L+++AGH +    +   I AIP I+E+++GH     A+  G+ +A
Sbjct: 177 LQRLKVGAALAAELGLEVHAGHGIDYATVKP-IAAIPEIAELNIGHFLIGEAIFVGLPQA 235

Query: 239 VFCFR 243
           +   R
Sbjct: 236 IQRMR 240


>gi|294669205|ref|ZP_06734285.1| pyridoxine 5'-phosphate synthase [Neisseria elongata subsp.
           glycolytica ATCC 29315]
 gi|291308837|gb|EFE50080.1| pyridoxine 5'-phosphate synthase [Neisseria elongata subsp.
           glycolytica ATCC 29315]
          Length = 242

 Score =  116 bits (290), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 76/239 (31%), Positives = 125/239 (52%), Gaps = 9/239 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ +    +A   GA  +T+H R D+RHI+  D+ +I R +
Sbjct: 3   LGVNIDHVATLRNARGTSYPSPLEAALLAETHGADYITLHLREDRRHIKDDDVAQIARAV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    E  L    R +P+++ +VP+   ++T++ G D L  Q       
Sbjct: 63  -----RTHINLEMALTEEMLEHALRVRPKEVCIVPEKRQEITTEGGLDVLGQQQKTADFT 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G R+SLF D   +E  +QAA   GA  +EL+TG Y    +  ++ R  L ++  
Sbjct: 118 RILSEAGIRVSLFID--ADEAQIQAASDIGAPAVELHTGAYADAADAAER-RQRLAQIEE 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A  A +  L +NAGH L I N+  +   +P I+E+++GHA  A AL  G+  A+   +
Sbjct: 175 GAYFASERGLIVNAGHGLNIHNVAPIAKILP-IAELNIGHALIAQALFLGLPAAIVQMK 232


>gi|148244711|ref|YP_001219405.1| pyridoxine 5'-phosphate synthase [Candidatus Vesicomyosocius
           okutanii HA]
 gi|146326538|dbj|BAF61681.1| pyridoxine 5-phosphate synthase [Candidatus Vesicomyosocius
           okutanii HA]
          Length = 241

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 70/239 (29%), Positives = 124/239 (51%), Gaps = 10/239 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   + +N++ +A +R  R   +P+LV    +  +SGA  +T+H R D+RHI+  D+  +
Sbjct: 1   MGIYLGINIDHIATIRQVRGTDYPSLVEAALLCEKSGADSITLHLREDRRHIQDADVEIL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R  +       ++N+E    +  + +  + KP+   LVP+   +LT++ G +     + +
Sbjct: 61  RGKL-----TTKMNLEMAATDEMIAIASKIKPQNCCLVPEKREELTTEGGLNVTSQISKI 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                +L      +SLF D   ++  + AAK  GA  +EL+TG Y    N  Q     L 
Sbjct: 116 CDICIQLKMSNIIVSLFIDAQKDQ--IDAAKQCGAAVVELHTGHYANATNEAQLTE--LE 171

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           ++ I A  A+ + LQ+NAGH LT+ NI N I  +P I E+++GH+  + A+   +  A+
Sbjct: 172 RIKIMATYARSIGLQVNAGHGLTLGNITN-IAKLPEIVELNIGHSIISRAIFVSLGTAI 229


>gi|254561466|ref|YP_003068561.1| pyridoxal phosphate biosynthetic protein pdxJ [Methylobacterium
           extorquens DM4]
 gi|254268744|emb|CAX24705.1| Pyridoxal phosphate biosynthetic protein pdxJ (PNP synthase)
           [Methylobacterium extorquens DM4]
          Length = 249

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 132/260 (50%), Gaps = 15/260 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA +RN R    P+ V     A+ +GA G+T H R D+RHIR  D+  +R
Sbjct: 3   SLRLGVNIDHVATVRNARGGFAPDPVRAAHEAVAAGADGITAHLREDRRHIRDADIAALR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           +L         LN+E    +  + +    +P    LVP+   + T++ G D +  +A L 
Sbjct: 63  KL------PVPLNLEMAATDEMVGIALATQPHAACLVPEKREERTTEGGLDIIAGRAHLA 116

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF--L 179
             +A L   G R+SLF +   +E  ++AA    A  +EL+TG Y        Q RI   L
Sbjct: 117 PRIATLSEAGIRVSLFVE--PDEAVMEAAHALQAPVVELHTGSYCEAVIEGDQSRIAHEL 174

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++   +     + L+I+AGH LT++++   + A+P I E+++GHA  A A+  G+++AV
Sbjct: 175 GRIVRASAHGAGLGLEIHAGHGLTVESV-GPVAALPQIRELNIGHALIAEAIFVGLRQAV 233

Query: 240 FCFRRACGQHLDNTMRLTHP 259
              R A    +D   R   P
Sbjct: 234 HDMRAA----MDRARRKAEP 249


>gi|218781166|ref|YP_002432484.1| pyridoxine 5'-phosphate synthase [Desulfatibacillum alkenivorans
           AK-01]
 gi|226694867|sp|B8FJ89|PDXJ_DESAA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|218762550|gb|ACL05016.1| pyridoxal phosphate biosynthetic protein PdxJ [Desulfatibacillum
           alkenivorans AK-01]
          Length = 235

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 67/237 (28%), Positives = 131/237 (55%), Gaps = 13/237 (5%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             ++VN++ VA LR  R + +P+ V    +   +GA G+ VH R D+RHI+  D+  IR+
Sbjct: 2   AGLAVNVDHVATLRQARGVDYPDPVAAAVLVELAGADGVVVHLREDRRHIQDRDVRIIRQ 61

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
           ++     +++L +E       + +    +P Q TLVP+   ++T++ G D + ++  +  
Sbjct: 62  IV-----QSKLILEMAATPEMIGIALEVRPHQATLVPEKREEVTTEGGLDVVMHKDSVAD 116

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            +  L   G ++SLF D + N+  ++AA   GAD +EL+TG +  C +   +    + + 
Sbjct: 117 AIKTLQAGGIKVSLFVDPDLNQ--IKAAHKAGADVVELHTGDF--CESRSPKAMAAIQE- 171

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A+LA+K+ ++++AGH +  ++I + +  +  I E S+GH+  + A+  G+  AV
Sbjct: 172 --AARLARKVGMEVHAGHGIDFRSIQDFVG-VKEIQEFSIGHSIVSRAVFIGLDAAV 225


>gi|123441366|ref|YP_001005353.1| pyridoxine 5'-phosphate synthase [Yersinia enterocolitica subsp.
           enterocolitica 8081]
 gi|122088327|emb|CAL11118.1| pyridoxal phosphate biosynthetic protein PdxJ [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 243

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 122/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRETI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +     P    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVGIACEINPHFCCLVPEKRQEVTTEGGLDVAGQIDKMTVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G  +SLF D +  +  + AA   GA  IE++TG Y    ++  ++   L ++A 
Sbjct: 121 SRLAKAGILVSLFIDADMRQ--IDAAVAVGAPYIEIHTGAYADATSDLARQA-ELVRIAK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV
Sbjct: 178 AATYAASKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMSGLAAAV 231


>gi|254525405|ref|ZP_05137457.1| pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9202]
 gi|221536829|gb|EEE39282.1| pyridoxal phosphate biosynthetic protein PdxJ [Prochlorococcus
           marinus str. MIT 9202]
          Length = 238

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 73/236 (30%), Positives = 124/236 (52%), Gaps = 10/236 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ +A +R  R    P+ V    +A   GA  +TVH R D+RHI+  D+  ++  
Sbjct: 3   TLGVNIDHIANVRQARKTVEPDPVQFAFLAELGGADSITVHLREDRRHIQDRDVFLLKET 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I     K +LN+E    E  L + ++  P+ +TLVP+   ++T++ G D   N   L K 
Sbjct: 63  I-----KTKLNLEMAATEEMLEIAQKILPDYVTLVPEKREEVTTEGGLDLKSNLQYLKKA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V  L +    +S F D  G +  +  +K  G D IEL+TG Y     + Q +   L ++ 
Sbjct: 118 VGNLQDSNIEVSAFIDPLGEQ--INYSKEIGFDFIELHTGKYAELSGSDQYKE--LQRII 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            +  LA  + L +NAGH L   N+   I +I  ++E+++GH+  A AL  G++++V
Sbjct: 174 ESTHLANDLGLVVNAGHGLNYNNVKK-IASINNMNELNIGHSIVARALAIGLEKSV 228


>gi|284929734|ref|YP_003422256.1| pyridoxine 5'-phosphate synthase [cyanobacterium UCYN-A]
 gi|284810178|gb|ADB95875.1| pyridoxine 5'-phosphate synthase [cyanobacterium UCYN-A]
          Length = 249

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 81/237 (34%), Positives = 127/237 (53%), Gaps = 11/237 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ +A +R  R    PN V    +A   GA+G+T+H R D+RHI+  D+  I+  
Sbjct: 12  TLGVNIDHIATIRQARCSTEPNPVIAAVLAELGGANGITMHLREDRRHIQDRDVFLIKET 71

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I     +  LN+E    E  L +    KP  ITLVP+   ++T++ G D   N   L K 
Sbjct: 72  I-----QTRLNLEIAATEEMLQIAFDIKPHCITLVPEKREEITTEGGLDVKTNLEHLKKI 126

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQ-QERIFLNKL 182
           V R+   G   SLF D N ++  +QA+  T A  IEL+TG Y    ++ Q QE + L KL
Sbjct: 127 VGRIQENGIIASLFIDSNQDQ--IQASADTRAKHIELHTGQYVNSTSDKQCQEELKLLKL 184

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
               + A  + ++INAGH L   N+ + +  +P I E+++GH   + A+  G++ AV
Sbjct: 185 G--CKQALDLGIKINAGHGLNYSNVYS-VACLPGIEELNIGHTIVSRAVLVGMERAV 238


>gi|312114993|ref|YP_004012589.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodomicrobium
           vannielii ATCC 17100]
 gi|311220122|gb|ADP71490.1| pyridoxal phosphate biosynthetic protein PdxJ [Rhodomicrobium
           vannielii ATCC 17100]
          Length = 264

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 79/246 (32%), Positives = 126/246 (51%), Gaps = 10/246 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + +N++ VA LRN R    P+ +   ++A+++G  G+T H R D+RHIR  D+  I+  I
Sbjct: 9   LGLNIDHVATLRNARGGARPDPIEAARVAVKAGVDGITAHLREDRRHIRDEDIRRIKAEI 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                 A LN+E    E    +    KP    +VP+   +LT++ G D    +  L   V
Sbjct: 69  -----AAPLNLEMAATEEMTGIALVTKPHACCIVPERREELTTEGGLDAAGGEDHLLPIV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFLNKL 182
            RL + G R+SLF D    +  ++AA   GA  +EL+TG Y   +   +    R  L++L
Sbjct: 124 KRLVDDGIRVSLFIDPEPRQ--IEAAARMGAPVVELHTGQYCEAWLARDEATARAELDRL 181

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A  A LA    L+++AGH L  +   +L  A P I E+++GH     A+  G+ EA++  
Sbjct: 182 AKAATLAASAGLEVHAGHGLDFETAKHL-AAFPEIRELNIGHVIIGEAIFIGLSEAIWRM 240

Query: 243 RRACGQ 248
           R A  +
Sbjct: 241 RAAIAK 246


>gi|86157925|ref|YP_464710.1| pyridoxine 5'-phosphate synthase [Anaeromyxobacter dehalogenans
           2CP-C]
 gi|85774436|gb|ABC81273.1| pyridoxine 5'-phosphate synthase [Anaeromyxobacter dehalogenans
           2CP-C]
          Length = 242

 Score =  116 bits (290), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 128/244 (52%), Gaps = 11/244 (4%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   + VN++ VA LR  R   +P+ V    +A   GA  +T+H R D+RHI+  DL  +
Sbjct: 1   MPARLGVNVDHVATLRQSRRTQYPDPVAAAVLAEMGGADQITIHLREDRRHIQERDLQVL 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R+ +      + LN+E    +  + +    KP+  TLVP+   +LT++ G D +  +  +
Sbjct: 61  RKTV-----SSRLNLEMAATQDMVKIAYGVKPDIATLVPERREELTTEGGLDVVGGREHV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            K V  L +    +SLF D + ++  ++AA    A+ +EL+TG Y        + R  L+
Sbjct: 116 RKVVKTLRDAEIEVSLFIDPDLDQ--VKAAHRAEAEVVELHTGRYCDARLASDRRR-ELS 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNI-PNLINAIPYISEISVGHAFAATALECGVKEAV 239
           ++    + A K+ L++ AGH L  QN+ P  + AIP I E+++GH+  A A+  G + AV
Sbjct: 173 RVIDACKAAAKLGLRVAAGHGLNYQNVLP--VAAIPEIEELNIGHSIVARAVLVGFERAV 230

Query: 240 FCFR 243
              R
Sbjct: 231 REMR 234


>gi|307823642|ref|ZP_07653871.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylobacter
           tundripaludum SV96]
 gi|307735627|gb|EFO06475.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylobacter
           tundripaludum SV96]
          Length = 248

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 77/235 (32%), Positives = 119/235 (50%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P  V    +A Q+GA G+T H R D+RHI+  D+  ++ ++
Sbjct: 8   LGVNIDHVATLRQARGTLYPEPVQAALVAEQAGADGITAHLREDRRHIQDRDIYLLKEML 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   LN+E    +  + +  + +P    LVP+   +LT++ G D   N   L    
Sbjct: 68  -----HTRLNMEMAVTDEMVGIAVKVQPYACCLVPEKREELTTEGGLDVAGNLHRLQWAC 122

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G+ +SLF D   +E  + AA   GA  +EL+TG Y    N  QQ    L ++  
Sbjct: 123 DKLAGAGAEVSLFID--PDEMQIDAAVKAGAPVVELHTGCYAEAGNRLQQAE-ELARIRR 179

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    LQ+NAGH L   N+   I AIP I E+++GH+  A A+  G+ + V
Sbjct: 180 AAVYAHSAGLQVNAGHGLNFYNV-EAICAIPEIVELNIGHSIIAQAVFSGLAQTV 233


>gi|297181857|gb|ADI18036.1| pyridoxal phosphate biosynthesis protein [uncultured delta
           proteobacterium HF0200_19J16]
          Length = 240

 Score =  115 bits (289), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 129/236 (54%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ +N++ VA +R  R +  P+ V    +   +GA G+TVH R D+RHI   DL     L
Sbjct: 3   ALHINIDHVATVRQARQINEPDPVTAAGLVELAGADGITVHLREDRRHILDRDL-----L 57

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           I +Q  + +LN+E    E  + +     P+ +TLVP+   ++T++ G D +    ++   
Sbjct: 58  ILKQTVQTKLNLEMAATEEMIGIALEIGPDIVTLVPEKREEITTEGGLDVIGASKIMRDG 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           + ++ + G ++SLF D    E  ++A++  GA+ +EL+TG Y       + +  +  +L 
Sbjct: 118 IKQIRDAGIQVSLFID--PEEDQIKASREIGAEDVELHTGCYANVKKIAELDSEY-QRLV 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             A++A +  LQ+NAGH L   N    I  +P++ E+++GH+  + A+  G+ +AV
Sbjct: 175 SGAEIAHQQKLQVNAGHGLNYINTQR-ICGLPHLRELNIGHSIISRAIFVGIFQAV 229


>gi|163744859|ref|ZP_02152219.1| pyridoxal phosphate biosynthetic protein PdxJ [Oceanibulbus
           indolifex HEL-45]
 gi|161381677|gb|EDQ06086.1| pyridoxal phosphate biosynthetic protein PdxJ [Oceanibulbus
           indolifex HEL-45]
          Length = 250

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 70/242 (28%), Positives = 124/242 (51%), Gaps = 10/242 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ +   KIA ++GA G+T H R D+RHI   D+  +  ++
Sbjct: 9   LGVNIDHVATVRNARGGAYPDPLRAAKIAEKAGADGITAHLREDRRHISDADIEGLMEVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   LN E    +    +  R+KP  + +VP+   + T++ G +  + +  L   +
Sbjct: 69  -----SVPLNFEMAATDEMQKIALRHKPHAVCIVPEKREERTTEGGLEVAREENKLAHFI 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER--IFLNKL 182
           A L   GSR+S+F      +  ++AA   GA+ IEL+TG Y   +   + +   + L KL
Sbjct: 124 APLREAGSRVSIFIAAEPAQ--IEAANRIGAEVIELHTGAYCDAFAEGRWDEADVELKKL 181

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              +  A  + L+++AGH LT   +   + A P + E+++GH     A+  G++ A+   
Sbjct: 182 REMSTFAASLGLEVHAGHGLTYDTV-TPVAAFPEVRELNIGHFLIGEAIFLGLEPAITEM 240

Query: 243 RR 244
           RR
Sbjct: 241 RR 242


>gi|56478593|ref|YP_160182.1| pyridoxine 5'-phosphate synthase [Aromatoleum aromaticum EbN1]
 gi|81598582|sp|Q5P083|PDXJ_AZOSE RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|56314636|emb|CAI09281.1| Pyridoxine-5-phosphate synthase [Aromatoleum aromaticum EbN1]
          Length = 251

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 75/247 (30%), Positives = 126/247 (51%), Gaps = 14/247 (5%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA LR  R    P+       A   GA G+TVH R D+RHI+  D   +RRL
Sbjct: 3   ELGVNIDHVATLRQARRTWEPDPAWAAMEAHLGGADGITVHLREDRRHIQDED---VRRL 59

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              +  + +LN+E    +  + +    +PE   LVP+  H++T++ G D L  +  L   
Sbjct: 60  --RELTQVKLNLEMAATDEMVGIACALRPEMAMLVPEGRHEVTTEGGLDVLAQEGRLKDV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYG----ACYNNPQQERIF- 178
           VARL + G   S+F D    +  ++AA   GA   E++TGPY     A   +PQ   +  
Sbjct: 118 VARLADAGIVTSVFIDAELGQ--VEAAARIGARVCEIHTGPYAHAFHAAGRDPQSAAVVD 175

Query: 179 -LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKE 237
            ++K+    +  + + ++ NAGH L   N+   I  +P + E+ +GHA  + ++  G+++
Sbjct: 176 EIDKVRRAGEAIRALGMRFNAGHALNYYNV-QPIARLPEVRELHIGHAIVSRSVFTGLRD 234

Query: 238 AVFCFRR 244
           AV   +R
Sbjct: 235 AVREMKR 241


>gi|299135105|ref|ZP_07028296.1| pyridoxal phosphate biosynthetic protein PdxJ [Afipia sp. 1NLS2]
 gi|298590082|gb|EFI50286.1| pyridoxal phosphate biosynthetic protein PdxJ [Afipia sp. 1NLS2]
          Length = 252

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 78/246 (31%), Positives = 129/246 (52%), Gaps = 11/246 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R    P+ V    +A+++GA G+T H R D+RHIR TD+  ++R I
Sbjct: 8   LGVNVDHVATLRNARGGLLPDPVRAALLAIEAGADGITAHLREDRRHIRDTDMARLKREI 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +      LN E    +  + +    KP  + LVP+   +LT++ G D +  QA L   +
Sbjct: 68  SKP-----LNFEMAVTDEMVGIALATKPHAVCLVPERRMELTTEGGLDVVGQQATLAPAI 122

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFLNKL 182
           A+ +  G R SLF   +  +  + AA+L  A  IE++TG +       N + +  +L ++
Sbjct: 123 AKFNEAGIRASLFISPDPAQIEM-AAQLK-APVIEIHTGTWCDALAERNSRSDAEWL-RV 179

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+LA  + L+++AGH L        I A+P I E+++GH     AL  G+ +A+   
Sbjct: 180 VEGAKLAHSLGLEVHAGHGLDYAT-AETIAALPQIMELNIGHFLMGEALFVGLAQAIGTM 238

Query: 243 RRACGQ 248
           R A  +
Sbjct: 239 RAAMAR 244


>gi|167581154|ref|ZP_02374028.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           thailandensis TXDOH]
          Length = 257

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 126/238 (52%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +  + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R
Sbjct: 10  AIELGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLR 69

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+     K  +N+E       L++    +P    LVP+   +LT++ G D + +   + 
Sbjct: 70  PLV-----KTRMNLECAVTPEMLDIACEVRPHDACLVPEKRSELTTEGGLDVVGHFDAVR 124

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G R+SLF D   ++  ++AA  TGA  IEL+TG Y   ++  +Q+R F  +
Sbjct: 125 AACKQLADAGVRVSLFID--PDDAQIRAAHETGAPVIELHTGRYADAHDTAEQQREF-ER 181

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV
Sbjct: 182 IATGVDAGIALGLKVNAGHGLHYSNV-QAIAALPGIAELNIGHAIVAHAVFAGWDNAV 238


>gi|163851694|ref|YP_001639737.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylobacterium
           extorquens PA1]
 gi|163663299|gb|ABY30666.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylobacterium
           extorquens PA1]
          Length = 249

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 81/260 (31%), Positives = 132/260 (50%), Gaps = 15/260 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S  + VN++ VA +RN R    P+ V     A+ +GA G+T H R D+RHIR  D+  +R
Sbjct: 3   SLRLGVNIDHVATVRNARGGFAPDPVRAAHEAVAAGADGITAHLREDRRHIRDADIAALR 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
           +L         LN+E    +  + +    +P    LVP+   + T++ G D +  +A L 
Sbjct: 63  KL------PVPLNLEMAATDEMVRIALATQPHAACLVPEKREERTTEGGLDIIAGRAHLA 116

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF--L 179
             +A L   G R+SLF +   +E  ++AA    A  +EL+TG Y        Q RI   L
Sbjct: 117 PRIATLSEAGIRVSLFVE--PDEAVMEAAHALQAPVVELHTGSYCEAVIEGDQSRIAHEL 174

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            ++   +     + L+I+AGH LT++++   + A+P I E+++GHA  A A+  G+++AV
Sbjct: 175 GRIVRASAHGAGLGLEIHAGHGLTVESV-GPVAALPQIRELNIGHALIAEAIFVGLRQAV 233

Query: 240 FCFRRACGQHLDNTMRLTHP 259
              R A    +D   R   P
Sbjct: 234 HDMRAA----MDRARRKAEP 249


>gi|289209105|ref|YP_003461171.1| pyridoxal phosphate biosynthetic protein PdxJ [Thioalkalivibrio sp.
           K90mix]
 gi|288944736|gb|ADC72435.1| pyridoxal phosphate biosynthetic protein PdxJ [Thioalkalivibrio sp.
           K90mix]
          Length = 255

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 81/242 (33%), Positives = 124/242 (51%), Gaps = 13/242 (5%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VNL+ +A +R  R+ P+P+L+   ++A  SGA  +T+H R D+RHI+  D+  I+  
Sbjct: 8   KLGVNLDHIATIRQARHTPYPDLMQAVRLAEASGADSITLHLREDRRHIQDDDVFGIK-- 65

Query: 64  IDEQFPK--AELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
                PK    +N+E    E    +  +  PE   +VP+   +LT++ G D       L 
Sbjct: 66  -----PKLTVPMNLEMAATEGMQAIALKLLPEACCIVPEKREELTTEGGLDAAGQLERLR 120

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             VA L   G  +SLF + +  +  L+AA   GA  +EL+TG Y    +  ++ER+ L  
Sbjct: 121 DFVAPLTTAGIEVSLFVEPDVRQ--LEAAVKIGAPVVELHTGAYANARDAAERERL-LAG 177

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A   Q M L INAGH L   N+   I A P   E+++GH+  A AL  G+ EAV  
Sbjct: 178 INEAAAAGQAMGLVINAGHGLDYDNV-RPIAANPVFHELNIGHSIVARALFTGLPEAVSH 236

Query: 242 FR 243
            R
Sbjct: 237 MR 238


>gi|206890735|ref|YP_002249462.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|226700974|sp|B5YGR4|PDXJ_THEYD RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|206742673|gb|ACI21730.1| pyridoxal phosphate biosynthetic protein PdxJ [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 242

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/235 (29%), Positives = 129/235 (54%), Gaps = 10/235 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +R  R    P+ V    +A+  GA G+T+H R D+RHI+  DL  +R ++
Sbjct: 4   LGVNVDHIATVRQARKTFEPDPVMAATLAILGGADGITIHLREDRRHIQDRDLKILREVV 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                  ELN+E    E  +N+    KP+ +T+VP+   +LT++ G + ++ +  L + +
Sbjct: 64  -----PCELNLEMAATEEMINIALNIKPDMVTIVPEKRQELTTEGGLNVIELKDSLKEAI 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            ++ + G  +SLF   N   + ++ +K  GAD +E++TG Y     + Q + +   K A+
Sbjct: 119 KKIKDAGIPVSLFI--NPERNDIECSKDIGADMVEIHTGYYSESRGDVQLKELERIKDAV 176

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              ++  + L+ NAGH L   N+ + I AI  +  + +GH+  A A+  G+++AV
Sbjct: 177 AYSIS--LGLKTNAGHGLNYYNVKS-IAAIKGLRGLYIGHSIIARAVLVGIEKAV 228


>gi|50085652|ref|YP_047162.1| pyridoxine 5'-phosphate synthase [Acinetobacter sp. ADP1]
 gi|91207272|sp|Q3V7G6|PDXJ_ACIAD RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|49531628|emb|CAG69340.1| pyridoxal phosphate biosynthetic protein [Acinetobacter sp. ADP1]
          Length = 241

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 73/239 (30%), Positives = 125/239 (52%), Gaps = 9/239 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    +  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTRYPDPVSAALVCEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D +     +
Sbjct: 61  RPLL-----KTRMNLELAVTDEMIAFAKEIQPQHVCFVPERRQEVTTEGGLDVVGQFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +  + AA   GA  IEL+TG Y A     +Q++  L 
Sbjct: 116 KAATQTLAAVGCDVSLFIDADLAQ--IDAAIACGAPTIELHTGAY-ADAETEEQQQAELQ 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           ++    + A    L +NAGH L + NI   I AIP I E+++GH+  A ++  G+ +AV
Sbjct: 173 RIIEGVEYAASKGLVVNAGHGLNLDNITP-IAAIPQIHELNIGHSIIADSVFVGLAQAV 230


>gi|262278200|ref|ZP_06055985.1| pyridoxal phosphate biosynthetic protein [Acinetobacter
           calcoaceticus RUH2202]
 gi|262258551|gb|EEY77284.1| pyridoxal phosphate biosynthetic protein [Acinetobacter
           calcoaceticus RUH2202]
          Length = 241

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 75/245 (30%), Positives = 127/245 (51%), Gaps = 9/245 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTTYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RPLL-----KTRMNLELAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +  + AA   GA  IEL+TG Y A     Q ++  L 
Sbjct: 116 KAATQTLAAIGCDVSLFIDADLAQ--IDAAVACGAPTIELHTGAY-ADAATEQDQQAELA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L ++NI   I AI  I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIIKGVEYAASKGLVVNAGHGLNLKNIAP-IAAISQIHELNIGHSIIAESIFVGLVQAVK 231

Query: 241 CFRRA 245
             + A
Sbjct: 232 DMKAA 236


>gi|317052485|ref|YP_004113601.1| pyridoxal phosphate biosynthetic protein PdxJ [Desulfurispirillum
           indicum S5]
 gi|316947569|gb|ADU67045.1| pyridoxal phosphate biosynthetic protein PdxJ [Desulfurispirillum
           indicum S5]
          Length = 247

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 127/250 (50%), Gaps = 9/250 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M   + VN++ VA +R  R    P +V    +A   GA  +T+H R D+RHI+  D+   
Sbjct: 1   MMVKLGVNVDHVATVRQARRGHDPEVVAAAALAELGGADSITIHLREDRRHIQDRDVH-- 58

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
              I  Q     +N+E    E  + +    +P Q+TLVP+   +LT++ G D L N   L
Sbjct: 59  ---ILMQTVSTSINLEMACTEEMIAIACAARPLQVTLVPEKREELTTEGGLDVLGNAREL 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
            K   RL + G R+S F D   N+  +QA++  GA  IE++TG Y    +     R  L 
Sbjct: 116 EKAATRLRDAGIRVSFFID--ANQQQIQASRDCGAQAIEIHTGHYADARDEATSNRELL- 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++  ++   +++ LQ+NAGH L   N+   I  IP + E+++GH+  A AL  G++ AV 
Sbjct: 173 RIVESSHFTRQIGLQLNAGHGLNYTNV-GPIAQIPGMRELNIGHSIVARALFVGMQRAVE 231

Query: 241 CFRRACGQHL 250
             +    Q +
Sbjct: 232 QMKAVINQSM 241


>gi|329297708|ref|ZP_08255044.1| pyridoxine 5'-phosphate synthase [Plautia stali symbiont]
          Length = 243

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 122/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    +A Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATVRNARGTNYPDPVQAAFVAEQAGADGITVHLREDRRHITDRDVRILRDTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             +     +N+E    +  + +    KP  + LVP+   ++T++ G D    Q  +   V
Sbjct: 66  HTR-----MNLEMAVTDEMVGIACDIKPHFVCLVPEKRQEVTTEGGLDVAGQQDKVKAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +SLF D   ++  ++AA  +GA  IE++TG Y        ++   L ++A 
Sbjct: 121 KQLSEAGILVSLFID--ADQRQIEAAVASGAPYIEIHTGAYAEAPEGLARD-AELARIAS 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A    L++NAGH LT  N+   I A+P + E+++GH     AL  G+  AV
Sbjct: 178 AATFAASRGLKVNAGHGLTYHNV-QPIAALPEMHELNIGHTIIGRALFSGLAAAV 231


>gi|326386645|ref|ZP_08208267.1| pyridoxal phosphate biosynthetic protein PdxJ [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208960|gb|EGD59755.1| pyridoxal phosphate biosynthetic protein PdxJ [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 247

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 79/239 (33%), Positives = 119/239 (49%), Gaps = 10/239 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R    P+ V   +I    GA G+T H R D+RHIR  D+  I+   
Sbjct: 12  LGVNIDHVATIRNARGGEHPDPVRAAEIVASVGADGITAHLREDRRHIRDEDIARIQAAT 71

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
               P   LN E    E  + +  R+KP    +VP+   + T++ G D       L   V
Sbjct: 72  S--LP---LNFEMAATEEMVAIALRHKPHAACIVPERREERTTEGGLDAAGQHNRLAPIV 126

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL + G R+SLF      +  ++AA   GA  +EL+TG Y       Q   + L ++A 
Sbjct: 127 ARLSDAGIRVSLFIAPEPRQ--IEAAIKLGAPVVELHTGEYAHAIGEAQA--VELKRIAD 182

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A LA    ++ +AGH LT +N+   I AIP ++E+++GH     A+  G+  AV   R
Sbjct: 183 MAALAAVNGIEPHAGHGLTFENV-QPIAAIPQLAELNIGHYLIGEAIFTGLGAAVRHMR 240


>gi|296113911|ref|YP_003627849.1| pyridoxal phosphate biosynthetic protein PdxJ [Moraxella
           catarrhalis RH4]
 gi|295921605|gb|ADG61956.1| pyridoxal phosphate biosynthetic protein PdxJ [Moraxella
           catarrhalis RH4]
          Length = 249

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 86/250 (34%), Positives = 133/250 (53%), Gaps = 18/250 (7%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R + +P  +    I  Q+GASG+T+H R D+RHI+  D+ E   LI
Sbjct: 6   LGVNIDHIATLRNARGVGYPCPIKGALICEQAGASGITLHLREDRRHIQDEDVYE---LI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N+E    +  LN+  + +P  + LVP+   +LT++ G D     A L+   
Sbjct: 63  GQLTTR--MNLEMAVTDEMLNIALKVRPAWVCLVPEKRQELTTEGGLDI----ANLSNIQ 116

Query: 125 ARLHNLGS---RISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFL 179
           A +H+L     ++SLF D   + H + AA   GAD IEL+TG Y      NN +     L
Sbjct: 117 AFIHSLQQADIKVSLFID--PDPHQIDAAIALGADAIELHTGAYAQATLQNNQKLVDKEL 174

Query: 180 NKLAITAQLAQKM-DLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           +++     +AQK   L INAGH LT  N+   I  I  I E+++GHA  + A+  G+  A
Sbjct: 175 DRIQKAVAMAQKKSSLLINAGHGLTSDNVAA-IAQIDGIHELNIGHALISDAIFMGLDNA 233

Query: 239 VFCFRRACGQ 248
           V   + A  Q
Sbjct: 234 VKAMKMAFVQ 243


>gi|322420019|ref|YP_004199242.1| pyridoxal phosphate biosynthetic protein PdxJ [Geobacter sp. M18]
 gi|320126406|gb|ADW13966.1| pyridoxal phosphate biosynthetic protein PdxJ [Geobacter sp. M18]
          Length = 239

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 81/235 (34%), Positives = 130/235 (55%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R    P+ V    IA  +GA G+T+H R D+RHI+  DL  +R   
Sbjct: 4   LGVNVDHVATLRQARGGTEPDPVAAAAIAELAGADGITIHLREDRRHIQDRDLKIMR--- 60

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  +  LN+E    +  +++    KPE  TLVP+   +LT++ G D   +Q  L   +
Sbjct: 61  --QTVQTRLNLEMAATDEMISIALAIKPECCTLVPEKRAELTTEGGLDVRIHQEALKVAI 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G  +SLF D + ++  ++ A   GAD IE++TG + A   N ++E++ L K+  
Sbjct: 119 EKLQAGGIIVSLFIDPDPDQ--IKVANKIGADYIEIHTGSF-AEAANWKEEQLELIKIEN 175

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             +LA+K+DL +NAGH L   N+   + AI  I E ++GH+  + A+  G+  AV
Sbjct: 176 AVKLARKLDLGVNAGHGLNYVNVKK-VAAIGGIEEFNIGHSIMSRAILVGLDRAV 229


>gi|149177295|ref|ZP_01855900.1| pyridoxal phosphate biosynthetic protein [Planctomyces maris DSM
           8797]
 gi|148843820|gb|EDL58178.1| pyridoxal phosphate biosynthetic protein [Planctomyces maris DSM
           8797]
          Length = 238

 Score =  115 bits (289), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 69/236 (29%), Positives = 133/236 (56%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ VA +R  R    P+ V    +A   GA G+T+H R D+RHI+  DL  +++ 
Sbjct: 3   ALGVNIDHVATVRQARLTYEPDPVWAAVLAELGGADGITLHLREDRRHIQDHDLYTMKKT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     + +LN+E    E    +    +P+Q++LVP+   +LT++ G + + N   +++ 
Sbjct: 63  V-----QVKLNLEMAAEEEMTQIALDVRPDQVSLVPEKREELTTEGGLNVIANAERVSQC 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL   G  +SLF D +  +  ++A+K  G   +EL+TG Y    +  +QE+  L+ L 
Sbjct: 118 VHRLQQAGIEVSLFIDPDPAQ--IEASKKAGVHAVELHTGRYADASSAGEQEQ-ELSILE 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             +    +  ++++ GH LT +N+   +  IP++SE+++GH+  + A+  G+++AV
Sbjct: 175 KASAFTIEQGMKLHMGHGLTYRNVTP-VALIPHVSELNIGHSIISRAVLVGMEQAV 229


>gi|299769161|ref|YP_003731187.1| pyridoxine 5'-phosphate synthase [Acinetobacter sp. DR1]
 gi|298699249|gb|ADI89814.1| pyridoxine 5'-phosphate synthase [Acinetobacter sp. DR1]
          Length = 241

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 75/245 (30%), Positives = 127/245 (51%), Gaps = 9/245 (3%)

Query: 1   MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEI 60
           M+  + VN++ VA LR  R   +P+ V    I  Q+GA G+T+H R D+RHI+  D+  +
Sbjct: 1   MAALLGVNIDHVATLRQARGTTYPDPVEAALICEQAGAEGITLHLREDRRHIQDDDVRRM 60

Query: 61  RRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALL 120
           R L+     K  +N+E    +  +   +  +P+ +  VP+   ++T++ G D + N   +
Sbjct: 61  RPLL-----KTRMNLELAVTDEMVEFAKEIQPQHVCFVPERRQEVTTEGGLDVVGNFEKV 115

Query: 121 TKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLN 180
                 L  +G  +SLF D +  +  + AA   GA  IEL+TG Y A     Q ++  L 
Sbjct: 116 KAATQTLAAIGCDVSLFIDADLAQ--IDAAVACGAPTIELHTGAY-ADAATEQDQQAELA 172

Query: 181 KLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           ++    + A    L +NAGH L ++NI   I AI  I E+++GH+  A ++  G+ +AV 
Sbjct: 173 RIIKGVEYAASKGLVVNAGHGLNLKNIAP-IAAISQIHELNIGHSIIADSVFVGLVQAVK 231

Query: 241 CFRRA 245
             + A
Sbjct: 232 DMKAA 236


>gi|83721359|ref|YP_442268.1| pyridoxine 5'-phosphate synthase [Burkholderia thailandensis E264]
 gi|167619239|ref|ZP_02387870.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           thailandensis Bt4]
 gi|257138461|ref|ZP_05586723.1| pyridoxine 5'-phosphate synthase [Burkholderia thailandensis E264]
 gi|83655184|gb|ABC39247.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           thailandensis E264]
          Length = 257

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 126/238 (52%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +  + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R
Sbjct: 10  AIELGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLR 69

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+     K  +N+E       L++    +P    LVP+   +LT++ G D + +   + 
Sbjct: 70  PLV-----KTRMNLECAVTPEMLDIACEVRPHDACLVPEKRSELTTEGGLDVVGHFDAVR 124

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G R+SLF D   ++  ++AA  TGA  IEL+TG Y   ++  +Q+R F  +
Sbjct: 125 AACKQLADAGVRVSLFID--PDDAQIRAAHETGAPVIELHTGRYADAHDTAEQQREF-ER 181

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV
Sbjct: 182 IATGVDAGIALGLKVNAGHGLHYTNV-QAIAALPGIAELNIGHAIVAHAVFAGWDNAV 238


>gi|226943502|ref|YP_002798575.1| pyridoxine 5'-phosphate synthase [Azotobacter vinelandii DJ]
 gi|259530335|sp|C1DQS7|PDXJ_AZOVD RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|226718429|gb|ACO77600.1| pyridoxal phosphate biosynthetic protein PdxJ [Azotobacter
           vinelandii DJ]
          Length = 248

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 118/235 (50%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ +     A ++GA G+TVH R D+RHI+  D+  ++ ++
Sbjct: 9   LGVNIDHVATLRQARGTRYPDPLKAALDAEEAGADGITVHLREDRRHIQERDVRVLKEVL 68

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N E    E  L   E  +P     VP+   +LT++ G D    +A +   V
Sbjct: 69  -----QTRMNFEMGVTEEMLAFAELIRPAHACFVPETRQELTTEGGLDVAGQEARIRAAV 123

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            RL  +G  +SLF D    +  ++AA   GA  +EL+TG Y A    P +    L ++  
Sbjct: 124 ERLARIGCEVSLFIDAEPQQ--IEAAARIGAPAVELHTGRY-ADARTPAETARELARIRD 180

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             +      L +NAGH L   N+   + AIP + E+++GHA  A AL  G K AV
Sbjct: 181 GVEYGLSHGLIVNAGHGLHYHNVEP-VAAIPGMHELNIGHAIVAHALFVGFKAAV 234


>gi|37519672|ref|NP_923049.1| pyridoxine 5'-phosphate synthase [Gloeobacter violaceus PCC 7421]
 gi|81711536|sp|Q7NPF2|PDXJ_GLOVI RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|35210663|dbj|BAC88044.1| pyridoxal phosphate biosynthetic protein [Gloeobacter violaceus PCC
           7421]
          Length = 239

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 76/242 (31%), Positives = 128/242 (52%), Gaps = 9/242 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ VA +R  R    P+      +   +GA G+TVH R D+RHI+  D+  +RR 
Sbjct: 3   TLGVNIDHVATIRQARRTVEPDPAAAAVLVELAGADGITVHLREDRRHIQDRDVEILRRT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     +  LN+E       ++     +P+ +TLVP+   ++T++ G D     A +   
Sbjct: 63  V-----RTHLNLEMAATRAMVDFALDVRPDYVTLVPERREEVTTEGGLDVGGQIASVGLA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V +L   G  +SLF D +  +  LQA+  TGA  +EL+TG Y A     Q +R  L +LA
Sbjct: 118 VEQLQCAGIPVSLFVDPDAAQ--LQASARTGAKFVELHTGRY-AEARGEQAQRSELAQLA 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
                AQ + L++NAGH LT  N+  +   +  + E+++GH+  A A+  G++ AV   +
Sbjct: 175 AACDEAQALGLRVNAGHGLTYWNVAPVAR-LSGMEELNIGHSIIARAVLVGLERAVREMK 233

Query: 244 RA 245
           +A
Sbjct: 234 QA 235


>gi|293394832|ref|ZP_06639122.1| pyridoxal phosphate biosynthetic protein PdxJ [Serratia odorifera
           DSM 4582]
 gi|291422583|gb|EFE95822.1| pyridoxal phosphate biosynthetic protein PdxJ [Serratia odorifera
           DSM 4582]
          Length = 243

 Score =  115 bits (288), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 78/237 (32%), Positives = 124/237 (52%), Gaps = 13/237 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V     A Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTQYPDPVQAAFSAEQAGADGITVHLREDRRHITDRDVRILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  L++    +P    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMLDIACELRPHFCCLVPEKREEVTTEGGLDVAGQLDKMTLAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNKL 182
            RL   G ++SLF D +  +  + AA   GA  IE++TG Y         Q E   L ++
Sbjct: 121 ERLTQAGIQVSLFIDPDHRQ--IDAAVAVGAPYIEIHTGAYAQAQGELAVQAE---LKRI 175

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           A  A+ A +  L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV
Sbjct: 176 AQAARYAAQKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVIGGLSAAV 231


>gi|326576291|gb|EGE26206.1| pyridoxine 5'-phosphate synthase [Moraxella catarrhalis CO72]
          Length = 249

 Score =  115 bits (288), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 86/250 (34%), Positives = 133/250 (53%), Gaps = 18/250 (7%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R + +P  +    I  Q+GASG+T+H R D+RHI+  D+ E   LI
Sbjct: 6   LGVNIDHIATLRNARGVGYPCPIKGALICEQAGASGITLHLREDRRHIQDEDVYE---LI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N+E    +  LN+  + +P  + LVP+   +LT++ G D     A L+   
Sbjct: 63  GQLTTR--MNLEMAVTDEMLNIALKVRPAWVCLVPEKRQELTTEGGLDI----ANLSNIQ 116

Query: 125 ARLHNLGS---RISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFL 179
           A +H+L     ++SLF D   + H + AA   GAD IEL+TG Y      NN +     L
Sbjct: 117 AFIHSLQQADIKVSLFID--PDPHQIDAAIALGADAIELHTGAYAHATLQNNQKLVDKEL 174

Query: 180 NKLAITAQLAQKM-DLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           +++     +AQK   L INAGH LT  N+   I  I  I E+++GHA  + A+  G+  A
Sbjct: 175 DRIQKAVAMAQKKSSLLINAGHGLTRDNVAA-IAQIDGIHELNIGHALISDAIFMGLDNA 233

Query: 239 VFCFRRACGQ 248
           V   + A  Q
Sbjct: 234 VKAMKMAFVQ 243


>gi|326560588|gb|EGE10969.1| pyridoxine 5'-phosphate synthase [Moraxella catarrhalis 103P14B1]
 gi|326561461|gb|EGE11811.1| pyridoxine 5'-phosphate synthase [Moraxella catarrhalis 46P47B1]
 gi|326568469|gb|EGE18549.1| pyridoxine 5'-phosphate synthase [Moraxella catarrhalis BC7]
 gi|326572022|gb|EGE22024.1| pyridoxine 5'-phosphate synthase [Moraxella catarrhalis BC8]
 gi|326573969|gb|EGE23919.1| pyridoxine 5'-phosphate synthase [Moraxella catarrhalis O35E]
 gi|326574961|gb|EGE24891.1| pyridoxine 5'-phosphate synthase [Moraxella catarrhalis 101P30B1]
          Length = 249

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 86/250 (34%), Positives = 133/250 (53%), Gaps = 18/250 (7%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R + +P  +    I  Q+GASG+T+H R D+RHI+  D+ E   LI
Sbjct: 6   LGVNIDHIATLRNARGVGYPCPIKGALICEQAGASGITLHLREDRRHIQDEDVYE---LI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N+E    +  LN+  + +P  + LVP+   +LT++ G D     A L+   
Sbjct: 63  GQLTTR--MNLEMAVTDEMLNIALKVRPAWVCLVPEKRQELTTEGGLDI----ANLSNIQ 116

Query: 125 ARLHNLGS---RISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFL 179
           A +H+L     ++SLF D   + H + AA   GAD IEL+TG Y      NN +     L
Sbjct: 117 AFIHSLQQADIKVSLFID--PDPHQIDAAIALGADAIELHTGAYAQATLQNNQKLVDKEL 174

Query: 180 NKLAITAQLAQKM-DLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           +++     +AQK   L INAGH LT  N+   I  I  I E+++GHA  + A+  G+  A
Sbjct: 175 DRIQKAVAMAQKKSSLLINAGHGLTRDNVAA-IAQIDGIHELNIGHALISDAIFMGLDNA 233

Query: 239 VFCFRRACGQ 248
           V   + A  Q
Sbjct: 234 VKAMKMAFVQ 243


>gi|302039389|ref|YP_003799711.1| pyridoxine 5'-phosphate synthase [Candidatus Nitrospira defluvii]
 gi|300607453|emb|CBK43786.1| Pyridoxine 5'-phosphate synthase [Candidatus Nitrospira defluvii]
          Length = 237

 Score =  115 bits (287), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 128/235 (54%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R    P+ +    +   +GA GL VH R D+RHI+  DL  +R ++
Sbjct: 4   LGVNIDHVATLRQARGGTDPDPLTAAILVELAGADGLVVHLREDRRHIQDRDLTMLREIV 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                + +L++E   ++    +    KP+ +TLVP+   +LT++ G D   ++  + K V
Sbjct: 64  -----RTKLDLEMAADDAMAKIALSIKPDLVTLVPERRQELTTEGGLDVANHRDRIQKIV 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G   SLF + + ++  ++AA   GA  +EL+TG Y     + +++  F   +  
Sbjct: 119 DLLRDGGIPTSLFVEPSLDQ--IKAAHKIGAAYVELHTGRYSNAKRSKEEDEEF-EAITQ 175

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A+LA K+ L +NAGH LT +N+  L   +P I E ++GH+  A ++  G+ +AV
Sbjct: 176 AAKLAYKLGLGVNAGHGLTYKNVKRLAK-LPEIVEFNIGHSIIARSVMVGLVQAV 229


>gi|297182001|gb|ADI18176.1| pyridoxal phosphate biosynthesis protein [uncultured delta
           proteobacterium HF0200_39N20]
          Length = 240

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 67/236 (28%), Positives = 126/236 (53%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ +N++ VA +R  R +  P+ V    +   +GA G+T+H R D+RHI   D+  +R  
Sbjct: 3   ALHINIDHVATVRQARQISEPDPVTAAGLVELAGADGITIHLREDRRHIIDRDVRILR-- 60

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              Q  +  LN+E    E    +     P  +TLVP+   ++T++ G D +    ++   
Sbjct: 61  ---QTVQTRLNLEMAATEEMFGIALEIGPNIVTLVPEKREEITTEGGLDVIGASNIMRDG 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           + ++ + G R+SLF D    E  ++A++  GA+ +EL+TG Y     + + +R +  +L 
Sbjct: 118 IKQIRDAGIRVSLFID--PEEDQIKASREIGAEDVELHTGCYANAKISAELDREY-QRLV 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             A+ + +  LQ+NAGH L   N    I  +P++ E+++GH+  + A+  G+ +AV
Sbjct: 175 SGAETSHQQKLQVNAGHGLNYINTQR-ICGLPHLRELNIGHSIVSRAIFVGISQAV 229


>gi|326562233|gb|EGE12561.1| pyridoxine 5'-phosphate synthase [Moraxella catarrhalis 7169]
 gi|326567187|gb|EGE17309.1| pyridoxine 5'-phosphate synthase [Moraxella catarrhalis BC1]
          Length = 249

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 85/247 (34%), Positives = 132/247 (53%), Gaps = 18/247 (7%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R + +P  +    I  Q+GASG+T+H R D+RHI+  D+ E   LI
Sbjct: 6   LGVNIDHIATLRNARGVGYPCPIKGALICEQAGASGITLHLREDRRHIQDEDVYE---LI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N+E    +  LN+  + +P  + LVP+   +LT++ G D     A L+   
Sbjct: 63  GQLTTR--MNLEMAVTDEMLNIALKVRPAWVCLVPEKRQELTTEGGLDI----ANLSNIQ 116

Query: 125 ARLHNLGS---RISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFL 179
           A +H+L     ++SLF D   + H + AA   GAD IEL+TG Y      NN +     L
Sbjct: 117 AFIHSLQQADIKVSLFID--PDPHQIDAAIALGADAIELHTGAYAQATLQNNQKLVDKEL 174

Query: 180 NKLAITAQLAQKM-DLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           +++     +AQK   L INAGH LT  N+   I  I  I E+++GHA  + A+  G+  A
Sbjct: 175 DRIQKAVAMAQKKSSLLINAGHGLTRDNVAA-IAQIDGIHELNIGHALISDAIFMGLDNA 233

Query: 239 VFCFRRA 245
           V   + A
Sbjct: 234 VKAMKMA 240


>gi|110596843|ref|ZP_01385133.1| pyridoxal phosphate biosynthetic protein PdxJ [Chlorobium
           ferrooxidans DSM 13031]
 gi|110341530|gb|EAT59990.1| pyridoxal phosphate biosynthetic protein PdxJ [Chlorobium
           ferrooxidans DSM 13031]
          Length = 236

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 73/235 (31%), Positives = 125/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           ++VN++ +A LRN RN   P+ V    +A + GA+G+  H R D+RHIR  DL  +R  +
Sbjct: 3   LAVNIDHIATLRNARNEFEPDPVEAALLAEKCGAAGIVCHLREDRRHIRDLDLQRLREAV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                  +L++E         +  + +PE ITLVP+   +LT++ G+D  ++   L + +
Sbjct: 63  -----TTKLDLEMAMTPEMQQIALKTRPELITLVPEKREELTTEGGFDITRHFDTLVEFL 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             +   G   S+F + + +  +L A    GA+ +EL+TG Y    +  ++++ F  ++  
Sbjct: 118 KPIREAGIESSIFIEPSQSAITLAAQ--AGAEMVELHTGTYALKTDFAERDKEF-ERIRE 174

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A+ + L++ AGH L   NI      IP I E+S+GHA  A A+  G+  AV
Sbjct: 175 AASFAKSLGLKVVAGHGLNYLNIAPF-KTIPEIEEVSIGHAIIARAVLTGLDSAV 228


>gi|326565585|gb|EGE15748.1| pyridoxine 5'-phosphate synthase [Moraxella catarrhalis 12P80B1]
          Length = 249

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 86/250 (34%), Positives = 133/250 (53%), Gaps = 18/250 (7%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R + +P  +    I  Q+GASG+T+H R D+RHI+  D+ E   LI
Sbjct: 6   LGVNIDHIATLRNARGVGYPCPIKGALICEQAGASGITLHLREDRRHIQDEDVYE---LI 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +   +  +N+E    +  LN+  + +P  + LVP+   +LT++ G D     A L+   
Sbjct: 63  GQLTTR--MNLEMAVTDEMLNIALKVRPAWVCLVPEKRQELTTEGGLDI----ANLSNIQ 116

Query: 125 ARLHNLGS---RISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFL 179
           A +H+L     ++SLF D   + H + AA   GAD IEL+TG Y      NN +     L
Sbjct: 117 AFIHSLQQADIKVSLFID--PDLHQIDAAIALGADAIELHTGAYAQATLQNNQKLVDKEL 174

Query: 180 NKLAITAQLAQKM-DLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
           +++     +AQK   L INAGH LT  N+   I  I  I E+++GHA  + A+  G+  A
Sbjct: 175 DRIQKAVAMAQKKSSLLINAGHGLTRDNVAA-IAQIDGIHELNIGHALISDAIFMGLDNA 233

Query: 239 VFCFRRACGQ 248
           V   + A  Q
Sbjct: 234 VKAMKMAFVQ 243


>gi|58040667|ref|YP_192631.1| pyridoxine 5'-phosphate synthase [Gluconobacter oxydans 621H]
 gi|81556919|sp|Q5FNS2|PDXJ_GLUOX RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|58003081|gb|AAW61975.1| Pyridoxal phosphate biosynthetic protein PdxJ [Gluconobacter
           oxydans 621H]
          Length = 232

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 119/235 (50%), Gaps = 15/235 (6%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V   ++A+ SGA G+T H R D+RHIR  D+P +R L 
Sbjct: 4   LGVNIDHVATLRNARGGTFPDPVAAAELAIASGADGITAHLREDRRHIRDADMPRLRAL- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                 A LN E    +  + +    +P    LVP+   ++T++ G D +     L   +
Sbjct: 63  -----SAPLNFEMAATDEMVRIACDLRPHACCLVPEKRQEVTTEGGLDIVGQSEALKPKI 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           ARL + G R+SLF D    +  ++ A   GA  +EL+TG Y A   + + ER     L  
Sbjct: 118 ARLRDAGIRVSLFIDPEARQ--IETAAALGAPVVELHTGAY-ALGGSEELER-----LRS 169

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A       L+++AGH LT  N+   I  +  ++E+++GH     A+  G+   V
Sbjct: 170 AAGTVAACGLELHAGHGLTYDNV-GAIADLTGLAELNIGHFLIGQAIFDGLGPVV 223


>gi|73666902|ref|YP_302918.1| pyridoxal phosphate biosynthetic protein PdxJ [Ehrlichia canis str.
           Jake]
 gi|91207233|sp|Q3YSI5|PDXJ_EHRCJ RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|72394043|gb|AAZ68320.1| pyridoxine 5'-phosphate synthase [Ehrlichia canis str. Jake]
          Length = 238

 Score =  115 bits (287), Expect = 8e-24,   Method: Compositional matrix adjust.
 Identities = 71/244 (29%), Positives = 132/244 (54%), Gaps = 13/244 (5%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           S ++ VN++ +A LRN RN+ +P ++ +  IA+ +GA  +TVH R D+RHI   D+  ++
Sbjct: 3   SIALGVNIDHIATLRNARNVDYPCIIEVANIAVNNGADFITVHLREDRRHIMDDDVFRLK 62

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     K  LN+E    +  L++    KP+ + LVP+   +LT++ G D     + L 
Sbjct: 63  SSL-----KVPLNLEIAATDEMLSIAIEVKPKCVCLVPEKRQELTTEGGLDVGSIFSYLV 117

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
             + +LH+    ++LF + + ++  +  AK   A+ +EL+TG Y  C N  Q E   L+K
Sbjct: 118 SFIEKLHSYDIDVTLFIEPDISQ--IDLAKKLHANNVELHTGKY--CNNATQNE---LSK 170

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A+     ++  +AGH L  Q+    I  +PYIS +++GH     A+  G+ ++++ 
Sbjct: 171 IIKAAEHCHHQNITCHAGHGLNYQSAAT-IAKVPYISALNIGHFLICEAVLHGIGKSIYK 229

Query: 242 FRRA 245
            ++ 
Sbjct: 230 MKQV 233


>gi|237746713|ref|ZP_04577193.1| pyridoxine 5-phosphate synthase [Oxalobacter formigenes HOxBLS]
 gi|229378064|gb|EEO28155.1| pyridoxine 5-phosphate synthase [Oxalobacter formigenes HOxBLS]
          Length = 262

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 125/236 (52%), Gaps = 9/236 (3%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ +A LRN R   +P+ V    +A ++GA  +T+H R D+RHIR  D+  IR L
Sbjct: 12  ELGVNIDHIATLRNARGTSYPDPVVAALMAEEAGADAITLHLREDRRHIRDADVRAIRPL 71

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +        +N+E       ++     +P+ + LVP+   +LT++ G D ++   ++   
Sbjct: 72  L-----ATRMNLESAMTSEMIDFACDIRPQDVCLVPERREELTTEGGLDIVRYFDIVQSA 126

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL   G R+SLF D   +E  + A+   GA  IEL+TG Y   ++   +E   L ++ 
Sbjct: 127 VERLTQAGIRVSLFID--PDEEQIIASHEAGAPVIELHTGRYANAFDEASREH-ELERVR 183

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              +      L++NAGH L  +N+   I  I  I+E+++GH+  + A+  G K+A+
Sbjct: 184 QGVKEGIGHGLKVNAGHGLHYENVVP-IAEIEGIAELNIGHSIVSRAVFTGWKKAI 238


>gi|167837344|ref|ZP_02464227.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           thailandensis MSMB43]
          Length = 257

 Score =  115 bits (287), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 126/238 (52%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +  + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R
Sbjct: 10  AIELGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLR 69

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+     K  +N+E       L++    +P    LVP+   +LT++ G D + +   + 
Sbjct: 70  PLV-----KTRMNLECAVTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVR 124

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G R+SLF D   ++  ++AA  TGA  IEL+TG Y   ++  +Q+R F  +
Sbjct: 125 AACKQLADAGVRVSLFID--PDDAQIRAAHETGAPVIELHTGRYADAHDAAEQQREF-ER 181

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV
Sbjct: 182 IATGVDAGIALGLKVNAGHGLHYTNV-QAIAALPGIAELNIGHAIVAHAVFAGWDNAV 238


>gi|209884972|ref|YP_002288829.1| pyridoxal phosphate biosynthetic protein PdxJ [Oligotropha
           carboxidovorans OM5]
 gi|209873168|gb|ACI92964.1| pyridoxal phosphate biosynthetic protein PdxJ [Oligotropha
           carboxidovorans OM5]
          Length = 256

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 79/250 (31%), Positives = 127/250 (50%), Gaps = 19/250 (7%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R    P+ V    +A+++GA G+T H R D+RHIR  D+  ++R I
Sbjct: 8   LGVNVDHVATLRNARGGLLPDPVRAALLAIEAGADGITAHLREDRRHIRDDDMARLKREI 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
            +      LN E       + +    KP  + LVP+   ++T++ G D +  Q  L   +
Sbjct: 68  SKP-----LNFEMGATGEMIGIALATKPHAVCLVPERRLEITTEGGLDVVGQQGTLAPAI 122

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY------GACYNNPQQERIF 178
           A+ +  G R SLF   +  E    AA+L  A  IEL+TG +      G+   + + +RI 
Sbjct: 123 AQFNAAGIRTSLFISPD-REQIEMAAQLK-APVIELHTGTWCDALIAGSSKADAEWKRIV 180

Query: 179 LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEA 238
                  A+LA  + L+++AGH L   +    I A+P I E+++GH     AL  G+K+A
Sbjct: 181 EG-----AKLAHSLGLEVHAGHGLDYAS-AETIAALPQIVELNIGHFLMGEALFVGLKQA 234

Query: 239 VFCFRRACGQ 248
           +   R A  +
Sbjct: 235 IGTMRAAMAR 244


>gi|322834124|ref|YP_004214151.1| pyridoxal phosphate biosynthetic protein PdxJ [Rahnella sp. Y9602]
 gi|321169325|gb|ADW75024.1| pyridoxal phosphate biosynthetic protein PdxJ [Rahnella sp. Y9602]
          Length = 243

 Score =  114 bits (286), Expect = 9e-24,   Method: Compositional matrix adjust.
 Identities = 78/245 (31%), Positives = 124/245 (50%), Gaps = 13/245 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTAYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRLLRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +     P    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVGIACEVLPHFCCLVPEKREEVTTEGGLDVAGQLDKMTVAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
           +RL   G  +SLF D +  +  + AA   GA  IE++TG Y     + +++   L ++  
Sbjct: 121 SRLSEAGILVSLFIDPDMRQ--IDAAVAVGAPYIEIHTGAYAEAKTDLERQ-AELERIKQ 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATA----LECGVKEAVF 240
            A  A    L++NAGH LT  N+   I A+P + E+++GHA    A    L C V+E   
Sbjct: 178 GAAYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVIDGLSCAVREMKN 236

Query: 241 CFRRA 245
             R A
Sbjct: 237 LMREA 241


>gi|330981620|gb|EGH79723.1| pyridoxine 5'-phosphate synthase [Pseudomonas syringae pv. aptata
           str. DSM 50252]
          Length = 208

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/205 (35%), Positives = 106/205 (51%), Gaps = 9/205 (4%)

Query: 35  QSGASGLTVHPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQ 94
           ++GA G+TVH R D+RHI+  D+     L+ +   +  +N E    E  L   ER +P  
Sbjct: 1   EAGADGITVHLREDRRHIQERDV-----LLLKDVLQTRMNFEMGVTEEMLAFAERIRPAH 55

Query: 95  ITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTG 154
           I LVP+   +LT++ G D    +A +   V RL  +G  +SLF D   +E  + A+K  G
Sbjct: 56  ICLVPETRQELTTEGGLDVAGQEARIKAAVERLAKIGCEVSLFID--ADERQIAASKRVG 113

Query: 155 ADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAI 214
           A  IEL+TG Y A    P +    L ++A          L +NAGH L   N+   + AI
Sbjct: 114 APAIELHTGRY-ADAQTPTEVAEELQRVADGVAFGLAQGLIVNAGHGLHYHNVEA-VAAI 171

Query: 215 PYISEISVGHAFAATALECGVKEAV 239
             I+E+++GHA  A AL  G K AV
Sbjct: 172 KGINELNIGHALVAHALFVGFKAAV 196


>gi|238793770|ref|ZP_04637391.1| Pyridoxine 5'-phosphate synthase [Yersinia intermedia ATCC 29909]
 gi|238726834|gb|EEQ18367.1| Pyridoxine 5'-phosphate synthase [Yersinia intermedia ATCC 29909]
          Length = 243

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 123/237 (51%), Gaps = 13/237 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A LRN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R+ I
Sbjct: 6   LGVNIDHIATLRNARGTIYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRQTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  +++    +P    LVP+   ++T++ G D       +T  V
Sbjct: 66  -----QTRMNLEMAVTDEMVDIACELQPHFCCLVPEKRQEVTTEGGLDVAGQLDKMTIAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNN--PQQERIFLNKL 182
           +RL   G  +SLF D +  +  + AA   GA  IE++TG Y     +   Q E + + K 
Sbjct: 121 SRLSEAGILVSLFIDPDMRQ--IDAAVAVGAPYIEIHTGAYADATTDLVRQAELVRITK- 177

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
              A  A    L++NAGH LT  N+   I A+P + E+++GHA    A+  G+  AV
Sbjct: 178 --AATYAAGKGLKVNAGHGLTYHNVQP-IAALPEMHELNIGHAIIGQAVMTGLAAAV 231


>gi|307720889|ref|YP_003892029.1| pyridoxine 5'-phosphate synthase [Sulfurimonas autotrophica DSM
           16294]
 gi|306978982|gb|ADN09017.1| pyridoxine 5'-phosphate synthase [Sulfurimonas autotrophica DSM
           16294]
          Length = 263

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 136/257 (52%), Gaps = 30/257 (11%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VAVLR  R +  P+++    +A +SGA  +T+H R D+RHI+  D+  I    
Sbjct: 6   LGVNIDHVAVLREARQVNDPDILQALYVACESGAEQITIHLREDRRHIQDIDVKNIL--- 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             QF K  +N+E   N+  L++  R KP + TLVP+   ++T++ G D    +  +   +
Sbjct: 63  --QFSKLPVNLECSINKNILDIVSRVKPHRATLVPEKREEVTTEGGLDVFSYENEIAYAI 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY----------NNPQQ 174
            +LH+    +SLF D +    +++ +K  GA+ +EL+TG +   +          N+  +
Sbjct: 121 EQLHDSIIPVSLFVDPSIE--AMEQSKKLGAEMVELHTGLFANLFAMLNSSLPKSNHSVK 178

Query: 175 ERIF------------LNKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISV 222
           E  F            + +L ++A+ A K+ L++ AGH L   N+  ++  I  I+E+++
Sbjct: 179 ELEFPRYELSDRLEMAIEQLKLSARHADKLGLEVAAGHGLNYHNVHEMMQ-IKEITELNI 237

Query: 223 GHAFAATALECGVKEAV 239
           G +  A ++  G+ EA+
Sbjct: 238 GQSIIARSVFTGLSEAI 254


>gi|308187803|ref|YP_003931934.1| Pyridoxine 5'-phosphate synthase [Pantoea vagans C9-1]
 gi|308058313|gb|ADO10485.1| Pyridoxine 5'-phosphate synthase [Pantoea vagans C9-1]
          Length = 243

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 123/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATVRNARGTNYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRDTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    +P    LVP+   ++T++ G D    Q  +   V
Sbjct: 66  -----QTRMNLEMAVTDEMIGIACDIQPHFCCLVPEKRQEVTTEGGLDVAGQQEKMNAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G  +SLF D +  +  ++AA  TGA  IE++TG Y        ++   L ++  
Sbjct: 121 RLLRDAGILVSLFIDADHRQ--IEAAVATGAPYIEIHTGAYAEAPEGRARD-AELARIRH 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+ +AV
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLPDAV 231


>gi|170749858|ref|YP_001756118.1| pyridoxine 5'-phosphate synthase [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656380|gb|ACB25435.1| pyridoxal phosphate biosynthetic protein PdxJ [Methylobacterium
           radiotolerans JCM 2831]
          Length = 249

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/243 (30%), Positives = 126/243 (51%), Gaps = 10/243 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ V    +A+++GA G+T H R D+RHIR TD+  ++R +
Sbjct: 8   LGVNIDHVATVRNARGGDYPDPVRAALLAVEAGADGITAHLREDRRHIRDTDIAALKRGL 67

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   LN E    +  + +    +P    LVP+   + T++ G D +  +  L   +
Sbjct: 68  -----SVPLNFEMAATDEMVAIALDTRPHAACLVPEKREERTTEGGLDIVGGREHLAPRI 122

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPY--GACYNNPQQERIFLNKL 182
             L   G R+SLF +       + AA+  GA  +EL+TG Y   A  ++  +    L ++
Sbjct: 123 RALAEAGIRVSLFVE--PEPAIMDAARALGAPVVELHTGSYCEAALEDDDARTARELARI 180

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              A+    + L+I+AGH LT+ ++   + A+P I E+++GH+  A A+  G+  AV   
Sbjct: 181 RRAAEHGDGLGLEIHAGHGLTLGSV-GPVAALPQIRELNIGHSLIADAIFVGLDRAVRDM 239

Query: 243 RRA 245
           R A
Sbjct: 240 RAA 242


>gi|126728507|ref|ZP_01744323.1| pyridoxal phosphate biosynthetic protein [Sagittula stellata E-37]
 gi|126711472|gb|EBA10522.1| pyridoxal phosphate biosynthetic protein [Sagittula stellata E-37]
          Length = 249

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 75/243 (30%), Positives = 123/243 (50%), Gaps = 12/243 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R   +P+ +   ++A ++GA G+T H R D+RHI   D   I RL+
Sbjct: 9   LGVNIDHVATVRNARGSAYPDPIRAAQLAEEAGADGITAHLREDRRHISDGD---IERLM 65

Query: 65  DE-QFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           D    P   LN E         +  R+KP  + +VP+   + T++ G +  + +  L   
Sbjct: 66  DTLTLP---LNFEMAATPEMQAIALRHKPHAVCIVPEKREERTTEGGLEVAREENKLAHF 122

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP--QQERIFLNK 181
           +A L   G R+S+F     +   ++AA   GA  IEL+TG Y   +      Q    L +
Sbjct: 123 IAPLREAGCRVSIFI--AADRRQIEAAHRIGAQVIELHTGAYCDFHAEGAFDQRDAELER 180

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFC 241
           +   A LA  + L+++AGH LT + +   I A P + E+++GH     A+  G+K A+  
Sbjct: 181 MREMAGLAHSLGLEVHAGHGLTYETV-KPIAAFPEVMELNIGHFLIGEAIFLGLKPAIAE 239

Query: 242 FRR 244
            RR
Sbjct: 240 MRR 242


>gi|317049177|ref|YP_004116825.1| pyridoxal phosphate biosynthetic protein PdxJ [Pantoea sp. At-9b]
 gi|316950794|gb|ADU70269.1| pyridoxal phosphate biosynthetic protein PdxJ [Pantoea sp. At-9b]
          Length = 243

 Score =  114 bits (286), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 121/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    I+ Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATVRNARGTNYPDPVQAAFISEQAGADGITVHLREDRRHITDRDVRILRDTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    KP    LVP+   ++T++ G D    Q  +   V
Sbjct: 66  -----QTRMNLEMAVTDEMVGIACDIKPHFCCLVPEKRQEVTTEGGLDVAGQQDKINAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L   G  +SLF D   +   ++AA  +GA  IE++TG Y        ++   L ++  
Sbjct: 121 KLLSEAGILVSLFID--ADHRQIEAAVASGAPYIEIHTGAYAEAPEGLARD-AELERIRK 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+ EAV
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLAEAV 231


>gi|332994405|gb|AEF04460.1| pyridoxine 5'-phosphate synthase [Alteromonas sp. SN2]
          Length = 245

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 84/245 (34%), Positives = 130/245 (53%), Gaps = 10/245 (4%)

Query: 1   MSTSV-SVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPE 59
           MST +  VN++ +A LRN R   +P+ VH   +A ++GA G+TVH R D+RHI+  D+  
Sbjct: 1   MSTLLLGVNIDHIATLRNARGTNYPDPVHAADVAERAGADGITVHLREDRRHIKDRDVRI 60

Query: 60  IRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQAL 119
           + + I+ +     LN+E    +  L + E  KP    LVP+   +LT++ G D   N A+
Sbjct: 61  LAQTINTR-----LNLEMAVTDEMLAIAEEVKPVFCCLVPEKREELTTEGGLDVAGNLAV 115

Query: 120 LTKTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFL 179
           + +   RL      +SLF D   ++  + AA   GA  IE++TG Y A   +  +    L
Sbjct: 116 MKQACERLAAANILVSLFID--ADKQQIDAAVECGAPYIEIHTGQY-AEATSEAELEEEL 172

Query: 180 NKLAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            +L    + A K  L++NAGH L   N+   I AIP + E+++GHA  A A   G+  AV
Sbjct: 173 ARLVEGIEYADKRGLKVNAGHGLHYHNVKP-IAAIPQLIELNIGHAIIARAAFDGLATAV 231

Query: 240 FCFRR 244
              R+
Sbjct: 232 ADMRK 236


>gi|283780002|ref|YP_003370757.1| pyridoxal phosphate biosynthetic protein PdxJ [Pirellula staleyi
           DSM 6068]
 gi|283438455|gb|ADB16897.1| pyridoxal phosphate biosynthetic protein PdxJ [Pirellula staleyi
           DSM 6068]
          Length = 236

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/244 (29%), Positives = 127/244 (52%), Gaps = 10/244 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
            + VN++ VA +R  R    P+ V    +A   GA  +TVH R D RHI+  D+  +R  
Sbjct: 3   ELGVNIDHVATIRQARKTYEPDPVAAAVLAELGGADTITVHLREDMRHIQTRDVRVLRET 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +       +LN+E       + L  + KP+Q TLVP+   ++T++ G D + ++A + + 
Sbjct: 63  V-----HIKLNLELSVAPEIVELACQVKPDQATLVPERREEVTTEGGLDVVSHEAAVARA 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           + +L   G  +SLF D +  +  L+AAK  G++ +EL+TG Y       Q E +   KL 
Sbjct: 118 MEKLQKAGIPVSLFLDPDSRQ--LEAAKRLGSEAVELHTGQYALTKGAAQHEELV--KLT 173

Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
               L + + + ++AGH L   N+   + AI  + E+++GH+  A A+  G++ AV   +
Sbjct: 174 NAGALIRSLGMALHAGHGLNYYNVKP-VAAIDGMHELNIGHSIVARAVFVGLERAVREMK 232

Query: 244 RACG 247
           +  G
Sbjct: 233 QLIG 236


>gi|75908921|ref|YP_323217.1| pyridoxine 5'-phosphate synthase [Anabaena variabilis ATCC 29413]
 gi|75702646|gb|ABA22322.1| pyridoxine 5'-phosphate synthase [Anabaena variabilis ATCC 29413]
          Length = 248

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 129/246 (52%), Gaps = 15/246 (6%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R  
Sbjct: 12  TLGVNIDHIATIRQARRTVEPDPVAAAVLAELGGADGITVHLREDRRHIQDRDVQLLR-- 69

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              Q  +  LN+E    +  + +    KP+ +TLVP+   ++T++ G D +   A + + 
Sbjct: 70  ---QTVRTHLNLEMAATDEMVGIALDIKPDYVTLVPEKREEVTTEGGLDIVGQIARIGEV 126

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP--QQERIFLNK 181
           V++L N    +SLF D    +  ++A+    A  IEL+TG Y    +    QQE  F   
Sbjct: 127 VSKLQNAAIPVSLFIDAEPAQ--IEASVKVQAKFIELHTGRYAEATDETSRQQELAF--- 181

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNI-PNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           LA   + A K  L++NAGH LT  N+ P  + A+P + E+++GH   + A   G++ AV 
Sbjct: 182 LATGCEQAIKAGLRVNAGHGLTYWNVYP--VAALPGMEELNIGHTIISRAALVGIERAVR 239

Query: 241 CFRRAC 246
             ++A 
Sbjct: 240 EMKQAI 245


>gi|17227714|ref|NP_484262.1| pyridoxine 5'-phosphate synthase [Nostoc sp. PCC 7120]
 gi|20138999|sp|Q8Z080|PDXJ_ANASP RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|17135196|dbj|BAB77742.1| pyridoxal phosphate biosynthetic protein [Nostoc sp. PCC 7120]
          Length = 239

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 76/246 (30%), Positives = 130/246 (52%), Gaps = 15/246 (6%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R  
Sbjct: 3   TLGVNIDHIATIRQARRTVEPDPVAAAVLAELGGADGITVHLREDRRHIQDRDVQLLRHT 62

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           +     +  LN+E    +  + +    KP+ +TLVP+   ++T++ G D +   A + + 
Sbjct: 63  V-----RTHLNLEMAATDEMVGIALDIKPDYVTLVPEKREEVTTEGGLDIVGQIARIGEV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP--QQERIFLNK 181
           V++L N    +SLF D   ++  ++A+    A  IEL+TG Y    +    QQE  F   
Sbjct: 118 VSKLQNAAIPVSLFIDAEPSQ--IEASVKVQAKFIELHTGRYAEATDETSRQQELAF--- 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNI-PNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           LA   + A K  L++NAGH LT  N+ P  + A+P + E+++GH   + A   G++ AV 
Sbjct: 173 LAAGCEQAIKAGLRVNAGHGLTYWNVYP--VAALPGMEELNIGHTIISRAALVGIERAVR 230

Query: 241 CFRRAC 246
             ++A 
Sbjct: 231 EMKQAI 236


>gi|67922975|ref|ZP_00516470.1| Pyridoxal phosphate biosynthetic protein PdxJ [Crocosphaera
           watsonii WH 8501]
 gi|67855194|gb|EAM50458.1| Pyridoxal phosphate biosynthetic protein PdxJ [Crocosphaera
           watsonii WH 8501]
          Length = 240

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 128/237 (54%), Gaps = 11/237 (4%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ VA +R  R    P+ V    +A   GA+G+T H R D+RHI+  D+    RL
Sbjct: 3   TLGVNIDHVATVRQARRTVEPDPVAAAVLAELGGANGITAHLREDRRHIQDRDI----RL 58

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
           + E   +  LN+E    E  +++    KP+ +TLVP+   ++T++ G D   +   L   
Sbjct: 59  LRETV-RTHLNLEMAATEEMVSIALDVKPDYVTLVPEKREEVTTEGGLDIAGSLEKLKNV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLA 183
           V RL +    +SLF D   +E  ++A+  T A  IEL+TG Y A   NP+  +  L  L 
Sbjct: 118 VDRLQSANIPVSLFID--ADESQIKASADTQAKFIELHTGKY-ADAPNPEIRQKELESLK 174

Query: 184 ITAQLAQKMDLQINAGHDLTIQNI-PNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +  + A  + L++NAGH LT  N+ P  +  +P + E+++GH   + A+  G++ AV
Sbjct: 175 LGCEQALNLGLRVNAGHGLTYINVYP--VGCLPGMEELNIGHTIVSRAVLVGMERAV 229


>gi|91207219|sp|Q3M9L4|PDXJ_ANAVT RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
          Length = 239

 Score =  114 bits (285), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 77/246 (31%), Positives = 129/246 (52%), Gaps = 15/246 (6%)

Query: 4   SVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRL 63
           ++ VN++ +A +R  R    P+ V    +A   GA G+TVH R D+RHI+  D+  +R  
Sbjct: 3   TLGVNIDHIATIRQARRTVEPDPVAAAVLAELGGADGITVHLREDRRHIQDRDVQLLR-- 60

Query: 64  IDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKT 123
              Q  +  LN+E    +  + +    KP+ +TLVP+   ++T++ G D +   A + + 
Sbjct: 61  ---QTVRTHLNLEMAATDEMVGIALDIKPDYVTLVPEKREEVTTEGGLDIVGQIARIGEV 117

Query: 124 VARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNP--QQERIFLNK 181
           V++L N    +SLF D    +  ++A+    A  IEL+TG Y    +    QQE  F   
Sbjct: 118 VSKLQNAAIPVSLFIDAEPAQ--IEASVKVQAKFIELHTGRYAEATDETSRQQELAF--- 172

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNI-PNLINAIPYISEISVGHAFAATALECGVKEAVF 240
           LA   + A K  L++NAGH LT  N+ P  + A+P + E+++GH   + A   G++ AV 
Sbjct: 173 LATGCEQAIKAGLRVNAGHGLTYWNVYP--VAALPGMEELNIGHTIISRAALVGIERAVR 230

Query: 241 CFRRAC 246
             ++A 
Sbjct: 231 EMKQAI 236


>gi|116749596|ref|YP_846283.1| pyridoxine 5'-phosphate synthase [Syntrophobacter fumaroxidans
           MPOB]
 gi|166219114|sp|A0LK96|PDXJ_SYNFM RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|116698660|gb|ABK17848.1| pyridoxal phosphate biosynthetic protein PdxJ [Syntrophobacter
           fumaroxidans MPOB]
          Length = 238

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/237 (32%), Positives = 128/237 (54%), Gaps = 13/237 (5%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           +++N++ VA +R  R    P+ V    +A  +GA G+ VH R D+RHI+  D+  +R   
Sbjct: 4   LAINVDHVATVRQARRASEPDPVTAAALAELAGAHGIVVHLREDRRHIQDRDVQVLR--- 60

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
             Q  K++LN+E       + +    KPE +TLVP+   +LT++ G D +  +  L + +
Sbjct: 61  --QTVKSKLNLEMAATREMIQIALNIKPEMVTLVPEKRQELTTEGGLDVVSFEGALEEAI 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGAC--YNNPQQERIFLNKL 182
             LH  G  +SLF   N +   ++ A    A+ +E++TG +     Y   Q+E     ++
Sbjct: 119 KTLHEGGIAVSLFI--NPDPRHIKVAHRLEAEYVEIHTGMFAEADSYTRRQEE---YERV 173

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
             +A+LA+K+ L  +AGH +  QN+  L N IP I E S+GHA  A A+  G++ AV
Sbjct: 174 VTSAKLARKLGLGAHAGHGIGYQNVLWLRN-IPEIQEFSIGHAVIARAVLVGMERAV 229


>gi|34497525|ref|NP_901740.1| pyridoxine 5'-phosphate synthase [Chromobacterium violaceum ATCC
           12472]
 gi|81655791|sp|Q7NWC0|PDXJ_CHRVO RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|34103380|gb|AAQ59742.1| pyridoxal phosphate biosynthetic protein pdxJ [Chromobacterium
           violaceum ATCC 12472]
          Length = 242

 Score =  114 bits (285), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 122/235 (51%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LR  R   +P+ V    +A  SGA  +T+H R D+RHI+  D+  +R ++
Sbjct: 4   LGVNIDHVATLRQARGTRYPSPVEAALVAESSGADLITLHLREDRRHIQDADVKAMRPVL 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E       L    +  PE + LVP+   ++T++ G D   + A +    
Sbjct: 64  -----KTRMNLEMAMTPEMLAHALQVAPEDVCLVPEKREEVTTEGGLDVRGHYADVKHYT 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G R+S+F D +  +  +Q A   GA  IEL+TG Y    +  ++E   L ++  
Sbjct: 119 GKLTEAGIRVSIFIDPDREQ--IQKAFDAGARVIELHTGAYADAPHASERE-AELARIRE 175

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A+    + + +NAGH L   N+   I AIP I+E+++GHA  A AL  G  +AV
Sbjct: 176 AAEFGASLGMVVNAGHGLNYHNV-KPIAAIPQIAELNIGHAIVAHALFVGFPQAV 229


>gi|226940392|ref|YP_002795466.1| pyridoxine 5'-phosphate synthase [Laribacter hongkongensis HLHK9]
 gi|259530375|sp|C1D7L7|PDXJ_LARHH RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|226715319|gb|ACO74457.1| PdxJ [Laribacter hongkongensis HLHK9]
          Length = 244

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/235 (31%), Positives = 125/235 (53%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA LRN R   +P+ V    +A  +GA  +T+H R D+RHI+  DL  +R  I
Sbjct: 4   LGVNIDHVATLRNARGTRYPSPVEAALVAETAGADLITLHLREDRRHIKDDDLAVMRAAI 63

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                K  +N+E    +  L+   R  P+ + +VP+   +LT++ G D ++    +    
Sbjct: 64  -----KTRMNLEMALTDEMLDNALRVLPQDVCIVPEKREELTTEGGLDVIRYFDRIADFT 118

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
            +L   G R+SLF D   ++  ++A+  TGA  +EL+TG Y    ++  ++R  L ++  
Sbjct: 119 RQLQAKGIRVSLFID--PDDEQIKASHETGATVVELHTGRYADAESHDIRQR-ELTRIRH 175

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A +   + L +NAGH L+  N+   + AI  I E+++GHA  A AL  G   AV
Sbjct: 176 AAIVGVDLGLVVNAGHGLSYHNVQP-VAAIREIRELNIGHAIVAHALMVGFAPAV 229


>gi|304398617|ref|ZP_07380489.1| pyridoxal phosphate biosynthetic protein PdxJ [Pantoea sp. aB]
 gi|304353828|gb|EFM18203.1| pyridoxal phosphate biosynthetic protein PdxJ [Pantoea sp. aB]
          Length = 243

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 74/235 (31%), Positives = 123/235 (52%), Gaps = 9/235 (3%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ +A +RN R   +P+ V    IA Q+GA G+TVH R D+RHI   D+  +R  I
Sbjct: 6   LGVNIDHIATVRNARGTNYPDPVQAAFIAEQAGADGITVHLREDRRHITDRDVRILRDTI 65

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                +  +N+E    +  + +    +P    LVP+   ++T++ G D    Q  +   V
Sbjct: 66  -----QTRMNLEMAVTDEMIGIACDIQPHFCCLVPEKRQEVTTEGGLDVAGQQEKMNAAV 120

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G  +SLF D +  +  ++AA  TGA  IE++TG Y        ++   L ++  
Sbjct: 121 RLLKDAGILVSLFIDADHRQ--IEAAVATGAPYIEIHTGAYAEAPEGLARD-AELARIRH 177

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
            A  A  + L++NAGH LT  N+   I A+P + E+++GHA    A+  G+ +AV
Sbjct: 178 AATFAASLGLKVNAGHGLTYHNVLP-IAALPEMHELNIGHAIIGRAVMSGLPDAV 231


>gi|294084103|ref|YP_003550861.1| pyridoxal phosphate biosynthetic protein PdxJ [Candidatus
           Puniceispirillum marinum IMCC1322]
 gi|292663676|gb|ADE38777.1| pyridoxal phosphate biosynthetic protein PdxJ [Candidatus
           Puniceispirillum marinum IMCC1322]
          Length = 253

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/239 (31%), Positives = 123/239 (51%), Gaps = 11/239 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R    PN V    +A Q+GA G+T H R D+RHI   D+  I+  I
Sbjct: 14  LGVNIDHVATIRNARGGVHPNPVDAALLAEQAGADGITAHLREDRRHIHDDDIHAIKAAI 73

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                   LN E   N   +++    +P    +VP+   ++T++ G   + N+  L   +
Sbjct: 74  -----TVPLNFEMAANSEMIDMALAVRPNAACIVPERREEVTTEGGLAVVGNEDRLGTLL 128

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             L + G RISLF +   +E  + AA+  GAD IEL+TG Y  C+++  +   +  ++  
Sbjct: 129 QPLKDAGIRISLFIE--ASEAEIDAARSVGADIIELHTGRY--CHDDTNRNFEY-TRIRS 183

Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243
            A  A K  ++ +AGH LT   +   I AIP + E+++GH     ++  G+ EA+   R
Sbjct: 184 AATYAVKQGIECHAGHGLTFDTV-GAIAAIPEMEELNIGHFLIGESIFLGLPEAIRRMR 241


>gi|107022213|ref|YP_620540.1| pyridoxine 5'-phosphate synthase [Burkholderia cenocepacia AU 1054]
 gi|116689159|ref|YP_834782.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           cenocepacia HI2424]
 gi|105892402|gb|ABF75567.1| pyridoxine 5'-phosphate synthase [Burkholderia cenocepacia AU 1054]
 gi|116647248|gb|ABK07889.1| pyridoxine 5'-phosphate synthase [Burkholderia cenocepacia HI2424]
          Length = 258

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 75/238 (31%), Positives = 126/238 (52%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +  + VN++ VA LRN R   +P+ +     A ++GA  +T+H R D+RHI   D+ E+R
Sbjct: 10  AIDLGVNIDHVATLRNARGTRYPDPIRAALAAEEAGADAITLHLREDRRHIVDADVRELR 69

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
            L+     K  +N+E       L++    +P    LVP+   +LT++ G D   +   + 
Sbjct: 70  PLL-----KTRMNLECAVTAEMLDIACEVRPHDACLVPEKREELTTEGGLDVAGHFEAVR 124

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L ++G R+SLF D +  +  ++AA   GA  IEL+TG Y   ++  +Q+R +  +
Sbjct: 125 AACKQLADVGVRVSLFIDPDDTQ--IRAAHEAGAPVIELHTGRYAEAHDEAEQQREY-ER 181

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +    Q   ++ L++NAGH L   N+   I AI  I E+++GHA  A A+  G   AV
Sbjct: 182 IVAGVQAGARLGLKVNAGHGLHYTNVQQ-IAAIDGIVELNIGHAIVAHAIFAGWDNAV 238


>gi|12644683|sp|P72776|PDXJ_SYNY3 RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
          Length = 242

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/244 (31%), Positives = 131/244 (53%), Gaps = 10/244 (4%)

Query: 4   SVSVNLNAVAVLRN-RRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
           ++ VN++ VA +R  R+ +  P+ +    +A  +GA G+T H R D+RHI+  D+  +R+
Sbjct: 3   TLGVNIDHVATIRQARQTVMEPDPIAAAVLAELAGADGITAHLREDRRHIQERDVEILRK 62

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +     +  LN+E    +  + +    KP+ +TLVP+   ++T++ G D   N   L  
Sbjct: 63  TV-----RTHLNLEMAATKEMVEIALNLKPDYVTLVPERREEVTTEGGLDVAGNLNYLLG 117

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
            V +L +    +SLF D +  +  L+A+  TGA  IEL+TG Y        Q R  L  L
Sbjct: 118 VVEQLQSRHIPVSLFIDPDVAQ--LKASAQTGAKFIELHTGKYANAPTADDQAR-ELGSL 174

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           AI   +A ++ L+INAGH LT  N+   +  +P + E+++GH+  + A+  G++ AV   
Sbjct: 175 AIACDIALELGLRINAGHGLTYWNV-RPVAELPGMEELNIGHSIMSRAILVGMERAVREM 233

Query: 243 RRAC 246
           + A 
Sbjct: 234 KLAM 237


>gi|254476778|ref|ZP_05090164.1| pyridoxal phosphate biosynthetic protein PdxJ [Ruegeria sp. R11]
 gi|214031021|gb|EEB71856.1| pyridoxal phosphate biosynthetic protein PdxJ [Ruegeria sp. R11]
          Length = 253

 Score =  114 bits (284), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 71/242 (29%), Positives = 124/242 (51%), Gaps = 10/242 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           + VN++ VA +RN R    P+ V   K+A ++GA G+T H R D+RHI  TD+  +   +
Sbjct: 13  LGVNIDHVATVRNARGGQTPDPVRAAKLAEEAGADGITAHLREDRRHITDTDIDALMEAL 72

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
           +       LN E    E    +  R+KP  + +VP+   + T++ G +  +++  L   +
Sbjct: 73  N-----VPLNFEMAATEEMQKIALRHKPHAVCIVPEKREERTTEGGLEVARDENKLAHFI 127

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACY--NNPQQERIFLNKL 182
           A L + G R+S+F     ++  ++AA   GA+ IEL+TG Y   +   +  +    L  L
Sbjct: 128 APLRDAGCRVSIFI--AADQRQIEAAHRIGAEVIELHTGAYCDAHAEGDLAKRDAELAAL 185

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
              +  A  + L+++AGH LT + +   I A P + E+++GH     A+  G+  A+   
Sbjct: 186 REMSSFAHSLGLEVHAGHGLTYETV-QPIAAFPEVRELNIGHFLIGEAIFRGLTPAIAEM 244

Query: 243 RR 244
           RR
Sbjct: 245 RR 246


>gi|53720032|ref|YP_109018.1| pyridoxine 5'-phosphate synthase [Burkholderia pseudomallei K96243]
 gi|167816749|ref|ZP_02448429.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 91]
 gi|91207226|sp|Q3V7S9|PDXJ_BURPS RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|52210446|emb|CAH36429.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei K96243]
          Length = 257

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 125/238 (52%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +  + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R
Sbjct: 10  AIDLGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRALR 69

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     K  +N+E       L++    +P    LVP+   +LT++ G D + +   + 
Sbjct: 70  PRV-----KTRMNLECAVTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVR 124

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G R+SLF D   +E  ++AA  TGA  IEL+TG Y   ++  +Q+R F  +
Sbjct: 125 AACKQLADAGVRVSLFID--PDEAQIRAAHETGAPVIELHTGRYADAHDAAEQQREF-ER 181

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV
Sbjct: 182 IATGVDAGIALGLKVNAGHGLHYTNV-QAIAALPGIAELNIGHAIVAHAVFVGWDNAV 238


>gi|225698152|pdb|3GK0|A Chain A, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698153|pdb|3GK0|B Chain B, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698154|pdb|3GK0|C Chain C, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698155|pdb|3GK0|D Chain D, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698156|pdb|3GK0|E Chain E, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698157|pdb|3GK0|F Chain F, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698158|pdb|3GK0|G Chain G, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
 gi|225698159|pdb|3GK0|H Chain H, Crystal Structure Of Pyridoxal Phosphate Biosynthetic
           Protein From Burkholderia Pseudomallei
          Length = 278

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 125/238 (52%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +  + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R
Sbjct: 31  AIDLGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLR 90

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     K  +N+E       L++    +P    LVP+   +LT++ G D + +   + 
Sbjct: 91  PRV-----KTRMNLECAVTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVR 145

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G R+SLF D   +E  ++AA  TGA  IEL+TG Y   ++  +Q+R F  +
Sbjct: 146 AACKQLADAGVRVSLFID--PDEAQIRAAHETGAPVIELHTGRYADAHDAAEQQREF-ER 202

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV
Sbjct: 203 IATGVDAGIALGLKVNAGHGLHYTNV-QAIAALPGIAELNIGHAIVAHAVFVGWDNAV 259


>gi|53725348|ref|YP_102342.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei ATCC 23344]
 gi|67641139|ref|ZP_00439924.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei GB8 horse 4]
 gi|121599770|ref|YP_993767.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei SAVP1]
 gi|124383564|ref|YP_001028767.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei NCTC 10229]
 gi|126451108|ref|YP_001081325.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei NCTC 10247]
 gi|134277578|ref|ZP_01764293.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 305]
 gi|167911873|ref|ZP_02498964.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 112]
 gi|254178205|ref|ZP_04884860.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           ATCC 10399]
 gi|254195694|ref|ZP_04902120.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei S13]
 gi|254199235|ref|ZP_04905601.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           FMH]
 gi|254205542|ref|ZP_04911894.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           JHU]
 gi|254357709|ref|ZP_04973982.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           2002721280]
 gi|91207224|sp|Q3V7M2|PDXJ_BURMA RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|52428771|gb|AAU49364.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           ATCC 23344]
 gi|121228580|gb|ABM51098.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           SAVP1]
 gi|124291584|gb|ABN00853.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei NCTC 10229]
 gi|126243978|gb|ABO07071.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei NCTC 10247]
 gi|134251228|gb|EBA51307.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei 305]
 gi|147748831|gb|EDK55905.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           FMH]
 gi|147752985|gb|EDK60050.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           JHU]
 gi|148026836|gb|EDK84857.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           2002721280]
 gi|160699244|gb|EDP89214.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia mallei
           ATCC 10399]
 gi|169652439|gb|EDS85132.1| pyridoxal phosphate biosynthetic protein PdxJ [Burkholderia
           pseudomallei S13]
 gi|238522004|gb|EEP85451.1| pyridoxine 5'-phosphate synthase [Burkholderia mallei GB8 horse 4]
          Length = 257

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 77/238 (32%), Positives = 125/238 (52%), Gaps = 9/238 (3%)

Query: 2   STSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIR 61
           +  + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R
Sbjct: 10  AIDLGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLR 69

Query: 62  RLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLT 121
             +     K  +N+E       L++    +P    LVP+   +LT++ G D + +   + 
Sbjct: 70  PRV-----KTRMNLECAVTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVR 124

Query: 122 KTVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNK 181
               +L + G R+SLF D   +E  ++AA  TGA  IEL+TG Y   ++  +Q+R F  +
Sbjct: 125 AACKQLADAGVRVSLFID--PDEAQIRAAHETGAPVIELHTGRYADAHDAAEQQREF-ER 181

Query: 182 LAITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAV 239
           +A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV
Sbjct: 182 IATGVDAGIALGLKVNAGHGLHYTNV-QAIAALPGIAELNIGHAIVAHAVFVGWDNAV 238


>gi|145219309|ref|YP_001130018.1| pyridoxal phosphate biosynthetic protein PdxJ [Prosthecochloris
           vibrioformis DSM 265]
 gi|189036751|sp|A4SDF7|PDXJ_PROVI RecName: Full=Pyridoxine 5'-phosphate synthase; Short=PNP synthase
 gi|145205473|gb|ABP36516.1| pyridoxine 5'-phosphate synthase [Chlorobium phaeovibrioides DSM
           265]
          Length = 235

 Score =  113 bits (283), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 76/235 (32%), Positives = 123/235 (52%), Gaps = 10/235 (4%)

Query: 5   VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64
           ++VN++ +A LRN RN   P+ V    +A +SGA G+  H R D+RHIR  DL  +R+ +
Sbjct: 3   LAVNIDHIATLRNARNEHNPDPVEAALLAEKSGAVGIVCHLREDRRHIRDHDLAALRKAV 62

Query: 65  DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124
                  +L++E    +    +     PE ITLVP+   +LT++ G+   ++   L   +
Sbjct: 63  -----TTKLDLEMAMTDEMGAIAVATMPELITLVPEKREELTTEGGFAIERHFNRLVDFL 117

Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184
             +   G  ISLF +    + ++  A+  GAD +EL+TG Y