RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780438|ref|YP_003064851.1| pyridoxine 5'-phosphate synthase [Candidatus Liberibacter asiaticus str. psy62] (261 letters) >gnl|CDD|58644 cd00003, PNPsynthase, Pyridoxine 5'-phosphate (PNP) synthase domain; pyridoxal 5'-phosphate is the active form of vitamin B6 that acts as an essential, ubiquitous coenzyme in amino acid metabolism. In bacteria, formation of pyridoxine 5'-phosphate is a step in the biosynthesis of vitamin B6. PNP synthase, a homooctameric enzyme, catalyzes the final step in PNP biosynthesis, the condensation of 1-amino-acetone 3-phosphate and 1-deoxy-D-xylulose 5-phosphate. PNP synthase adopts a TIM barrel topology, intersubunit contacts are mediated by three ''extra'' helices, generating a tetramer of symmetric dimers with shared active sites; the open state has been proposed to accept substrates and to release products, while most of the catalytic events are likely to occur in the closed state; a hydrophilic channel running through the center of the barrel was identified as the essential structural feature that enables PNP synthase to release water molecules produced during the reaction from the closed, solvent-shielded active site.. Length = 234 Score = 264 bits (677), Expect = 1e-71 Identities = 92/242 (38%), Positives = 142/242 (58%), Gaps = 9/242 (3%) Query: 5 VSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLI 64 + VN++ VA LRN R +P+ V +A ++GA G+TVH R D+RHI+ D+ +R L+ Sbjct: 2 LGVNIDHVATLRNARGTNYPDPVEAALLAEKAGADGITVHLREDRRHIQDRDVRLLRELV 61 Query: 65 DEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTV 124 + ELN+E P E L + KP Q+TLVP+ +LT++ G D L + Sbjct: 62 -----RTELNLEMAPTEEMLEIALEVKPHQVTLVPEKREELTTEGGLDVAGQAEKLKPII 116 Query: 125 ARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAI 184 RL + G R+SLF D + ++AAK GAD +EL+TGPY Y+ ++E L ++A Sbjct: 117 ERLKDAGIRVSLFID--PDPEQIEAAKEVGADRVELHTGPYANAYDKAEREAE-LERIAK 173 Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244 A+LA+++ L +NAGH L +N+ I IP I+E+++GHA + AL G++EAV + Sbjct: 174 AAKLARELGLGVNAGHGLNYENVK-PIAKIPGIAELNIGHAIISRALFVGLEEAVREMKD 232 Query: 245 AC 246 Sbjct: 233 LI 234 >gnl|CDD|31195 COG0854, PdxJ, Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism]. Length = 243 Score = 259 bits (663), Expect = 6e-70 Identities = 96/245 (39%), Positives = 142/245 (57%), Gaps = 10/245 (4%) Query: 6 SVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLID 65 VN++ +A LRN R P+P+ V IA Q+GA G+TVH R D+RHI+ D+ +R LID Sbjct: 4 GVNIDHIATLRNARGTPYPDPVEAAFIAEQAGADGITVHLREDRRHIQDRDVRILRALID 63 Query: 66 EQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVA 125 N+E P E L + + KP Q+TLVP+ ++T++ G D L V Sbjct: 64 -----TRFNLEMAPTEEMLAIALKTKPHQVTLVPEKREEVTTEGGLDVAGQLDKLRDAVR 118 Query: 126 RLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIF--LNKLA 183 RL N G R+SLF D + ++AA GA IEL+TGPY ++ +Q R L +LA Sbjct: 119 RLKNAGIRVSLFID--PDPEQIEAAAEVGAPRIELHTGPYADAHDAAEQARADAELERLA 176 Query: 184 ITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFR 243 A+LA ++ L++NAGH LT N+ L AIP ++E+++GH+ A A+ G++EAV + Sbjct: 177 KAAKLAAELGLKVNAGHGLTYHNVKPLA-AIPPLAELNIGHSIIARAVFVGLEEAVREMK 235 Query: 244 RACGQ 248 R + Sbjct: 236 RLMKR 240 >gnl|CDD|112550 pfam03740, PdxJ, Pyridoxal phosphate biosynthesis protein PdxJ. Members of this family belong to the PdxJ family that catalyses the condensation of 1-deoxy-d-xylulose-5-phosphate (DXP) and 1-amino-3-oxo-4-(phosphohydroxy)propan-2-one to form pyridoxine 5'-phosphate (PNP). This reaction is involved in de novo synthesis of pyridoxine (vitamin B6) and pyridoxal phosphate. Length = 239 Score = 248 bits (635), Expect = 1e-66 Identities = 95/243 (39%), Positives = 139/243 (57%), Gaps = 9/243 (3%) Query: 6 SVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRRLID 65 VN++ +A LRN R P+P+ V IA ++GA G+TVH R D+RHI+ D+ ++ LI Sbjct: 4 GVNIDHIATLRNARGTPYPDPVEAALIAERAGADGITVHLREDRRHIQDRDVEVLKELIR 63 Query: 66 EQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVA 125 NIE P E L L + KP Q+TLVP+ ++T++ G D + L + Sbjct: 64 -----TRFNIEMAPTEEMLELALKTKPHQVTLVPEKREEITTEGGLDVVAQLEKLKPAIR 118 Query: 126 RLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQER-IFLNKLAI 184 RL N G R+SLF D + ++AAK+ GAD IEL+TGPY +N+ +Q R L +LA Sbjct: 119 RLKNAGIRVSLFID--PDPEQIEAAKIVGADRIELHTGPYADAHNDAEQAREELLERLAA 176 Query: 185 TAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCFRR 244 A LA + L +NAGH LT N+ + IP I+E+++GH+ A AL G+ +AV + Sbjct: 177 GAALAFDLGLVVNAGHGLTYHNVKPVA-KIPPIAELNIGHSLVAEALFVGLAKAVLEMKA 235 Query: 245 ACG 247 Sbjct: 236 LMK 238 >gnl|CDD|73368 cd02801, DUS_like_FMN, Dihydrouridine synthase-like (DUS-like) FMN-binding domain. Members of this family catalyze the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archaea. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. 1VHN, a putative flavin oxidoreductase, has high sequence similarity to DUS. The enzymatic mechanism of 1VHN is not known at the present.. Length = 231 Score = 32.4 bits (74), Expect = 0.14 Identities = 13/42 (30%), Positives = 20/42 (47%), Gaps = 1/42 (2%) Query: 25 NLVHIGKIALQSGASGLTVHPR-PDQRHIRYTDLPEIRRLID 65 + + K +GAS LTVH R +QR+ D I + + Sbjct: 139 ETLELAKALEDAGASALTVHGRTREQRYSGPADWDYIAEIKE 180 >gnl|CDD|110253 pfam01238, PMI_typeI, Phosphomannose isomerase type I. This is a family of Phosphomannose isomerase type I enzymes (EC 5.3.1.8). Length = 373 Score = 29.8 bits (67), Expect = 0.74 Identities = 16/51 (31%), Positives = 24/51 (47%), Gaps = 5/51 (9%) Query: 53 RYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPH 103 DLPE+ ++EQ+P + G FLN + E + L +DPH Sbjct: 223 NVYDLPELIDRLNEQYP----DDIGLF-RLFLNHVKLNPGEAMFLKANDPH 268 >gnl|CDD|144707 pfam01207, Dus, Dihydrouridine synthase (Dus). Members of this family catalyse the reduction of the 5,6-double bond of a uridine residue on tRNA. Dihydrouridine modification of tRNA is widely observed in prokaryotes and eukaryotes, and also in some archae. Most dihydrouridines are found in the D loop of t-RNAs. The role of dihydrouridine in tRNA is currently unknown, but may increase conformational flexibility of the tRNA. It is likely that different family members have different substrate specificities, which may overlap. Dus 1 from Saccharomyces cerevisiae acts on pre-tRNA-Phe, while Dus 2 acts on pre-tRNA-Tyr and pre-tRNA-Leu. Dus 1 is active as a single subunit, requiring NADPH or NADH, and is stimulated by the presence of FAD. Some family members may be targeted to the mitochondria and even have a role in mitochondria. Length = 309 Score = 29.6 bits (67), Expect = 0.83 Identities = 13/42 (30%), Positives = 19/42 (45%), Gaps = 1/42 (2%) Query: 25 NLVHIGKIALQSGASGLTVHPR-PDQRHIRYTDLPEIRRLID 65 N V I + +GA LTVH R Q + D I+++ Sbjct: 139 NAVEIARRVEDAGAQALTVHGRTRAQNYEGPADWDAIKQVKQ 180 >gnl|CDD|30391 COG0042, COG0042, tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]. Length = 323 Score = 28.8 bits (64), Expect = 1.5 Identities = 13/43 (30%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Query: 25 NLVHIGKIALQSGASGLTVHPR-PDQRHIRYTDLPEIRRLIDE 66 + I +I +GA LTVH R Q ++ D I+ L + Sbjct: 153 LALEIARILEDAGADALTVHGRTRAQGYLGPADWDYIKELKEA 195 >gnl|CDD|176084 cd08534, SAM_PNT-GABP-alpha, Sterile alpha motif (SAM)/Pointed domain of GA-binding protein alpha chain. SAM Pointed domain of GABP-alpha subfamily of ETS transcriptional regulators is a putative protein-protein interaction domain. This type of transcriptional regulators forms heterotetramers containing two alpha and two beta subunits. It interacts with GA repeats (purine rich repeats). GABP transcriptional factors control gene expression in cell cycle control, apoptosis, and cellular respiration. GABP participates in regulation of transmembrane receptors and key hormones especially in myeloid cells and at the neuromuscular junction. Length = 89 Score = 28.1 bits (63), Expect = 2.3 Identities = 9/25 (36%), Positives = 13/25 (52%), Gaps = 1/25 (4%) Query: 86 LCERYKPEQITL-VPDDPHQLTSDH 109 + Y+ EQ L +P DP + T D Sbjct: 2 VDSNYRKEQERLKIPYDPMEWTEDQ 26 >gnl|CDD|133235 cd05104, PTKc_Kit, Catalytic domain of the Protein Tyrosine Kinase, Kit. Protein Tyrosine Kinase (PTK) family; Kit (or c-Kit); catalytic (c) domain. The PTKc family is part of a larger superfamily that includes the catalytic domains of other kinases such as protein serine/threonine kinases, RIO kinases, and phosphoinositide 3-kinase (PI3K). PTKs catalyze the transfer of the gamma-phosphoryl group from ATP to tyrosine (tyr) residues in protein substrates. Kit is a member of the Platelet Derived Growth Factor Receptor (PDGFR) subfamily of proteins, which are receptor tyr kinases (RTKs) containing an extracellular ligand-binding region with five immunoglobulin-like domains, a transmembrane segment, and an intracellular catalytic domain. The binding of Kit to its ligand, the stem-cell factor (SCF), leads to receptor dimerization, trans phosphorylation and activation, and intracellular signaling. Kit is important in the development of melanocytes, germ cells, mast cells, hematopoietic stem cells, the interstitial cells of Cajal, and the pacemaker cells of the GI tract. Kit signaling is involved in major cellular functions including cell survival, proliferation, differentiation, adhesion, and chemotaxis. Mutations in Kit, which result in constitutive ligand-independent activation, are found in human cancers such as gastrointestinal stromal tumor (GIST) and testicular germ cell tumor (TGCT). The aberrant expression of Kit and/or SCF is associated with other tumor types such as systemic mastocytosis and cancers of the breast, neurons, lung, prostate, colon, and rectum. Although the structure of the human Kit catalytic domain is known, it is excluded from this specific alignment model because it contains a deletion in its sequence. Length = 375 Score = 27.9 bits (62), Expect = 3.0 Identities = 11/24 (45%), Positives = 15/24 (62%) Query: 101 DPHQLTSDHGWDFLQNQALLTKTV 124 DP QL DH W+F +N+ KT+ Sbjct: 20 DPTQLPYDHKWEFPRNRLSFGKTL 43 >gnl|CDD|144742 pfam01261, AP_endonuc_2, Xylose isomerase-like TIM barrel. This TIM alpha/beta barrel structure is found in xylose isomerase and in endonuclease IV (EC:3.1.21.2). This domain is also found in the N termini of bacterial myo-inositol catabolism proteins. These are involved in the myo-inositol catabolism pathway, and is required for growth on myo-inositol in Rhizobium leguminosarum bv. viciae. Length = 201 Score = 27.3 bits (61), Expect = 4.7 Identities = 10/54 (18%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Query: 147 LQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGH 200 L+ A G D +EL+ + + E + L ++ L+I + + Sbjct: 1 LELAAELGFDGVELFFDDPRPASDKLEIEEL--------KALLKEYGLEITSLN 46 >gnl|CDD|173691 cd05600, STKc_Sid2p_Dbf2p, Catalytic domain of Fungal Sid2p- and Dbf2p-like Protein Serine/Threonine Kinases. Serine/Threonine Kinases (STKs), ROCK- and NDR-like subfamily, fungal Sid2p- and Dbf2p-like proteins, catalytic (c) domain. STKs catalyze the transfer of the gamma-phosphoryl group from ATP to serine/threonine residues on protein substrates. The Sid2p- and Dbf2p-like group is part of a larger superfamily that includes the catalytic domains of other protein STKs, protein tyrosine kinases, RIO kinases, aminoglycoside phosphotransferase, choline kinase, and phosphoinositide 3-kinase. This group contains fungal kinases including Schizosaccharomyces pombe Sid2p and Saccharomyces cerevisiae Dbf2p. Group members show similarity to NDR kinases in that they contain an N-terminal regulatory (NTR) domain and an insert within the catalytic domain that contains an auto-inhibitory sequence. Sid2p plays a crucial role in the septum initiation network (SIN) and in the initiation of cytokinesis. Dbf2p is important in regulating the mitotic exit network (MEN) and in cytokinesis. Length = 333 Score = 27.0 bits (60), Expect = 5.4 Identities = 18/52 (34%), Positives = 24/52 (46%), Gaps = 3/52 (5%) Query: 79 PNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTKTVARLHNL 130 PNET+ NL + +K V DDP SD WD + L+ R +L Sbjct: 203 PNETWENL-KYWKETLQRPVYDDPRFNLSDEAWDLITK--LINDPSRRFGSL 251 >gnl|CDD|32798 COG2979, COG2979, Uncharacterized protein conserved in bacteria [Function unknown]. Length = 225 Score = 26.5 bits (58), Expect = 6.8 Identities = 13/62 (20%), Positives = 23/62 (37%), Gaps = 2/62 (3%) Query: 147 LQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKLAITAQLAQKMDLQINAGHDLTIQN 206 + AA +ELY A ++ + ER +LN LA L + + + Sbjct: 165 IAAAARNEEQALELYLASRLAIDDDSRMERSYLNALAGALGLPDALVDHLER--QVGQAK 222 Query: 207 IP 208 + Sbjct: 223 VT 224 >gnl|CDD|31617 COG1428, COG1428, Deoxynucleoside kinases [Nucleotide transport and metabolism]. Length = 216 Score = 26.4 bits (58), Expect = 8.1 Identities = 16/94 (17%), Positives = 29/94 (30%), Gaps = 1/94 (1%) Query: 44 HPRPDQRHIRYTDLPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPH 103 RPD L + R I ++ E++ + +L RY P Sbjct: 124 PGRPDLLIYLDASLETLLRRIAKRGRPFEIDNFDENKDYLKDLHRRYDDWFEN-YDACPV 182 Query: 104 QLTSDHGWDFLQNQALLTKTVARLHNLGSRISLF 137 DF+ N+ L K + ++ + Sbjct: 183 LGIDGDSIDFVNNEQDLEKVLDQILAKLKLLPKL 216 >gnl|CDD|31260 COG1060, ThiH, Thiamine biosynthesis enzyme ThiH and related uncharacterized enzymes [Coenzyme metabolism / General function prediction only]. Length = 370 Score = 26.4 bits (58), Expect = 9.1 Identities = 14/54 (25%), Positives = 21/54 (38%), Gaps = 8/54 (14%) Query: 22 PWPNL-VHIGKIALQSGASGL-------TVHPRPDQRHIRYTDLPEIRRLIDEQ 67 W V + + AL SGA+ L V+P + + E+ LI E Sbjct: 296 SWLRDGVILAQAALLSGANDLGGTGYEEKVNPAAGAFSGDWRSVEELAALIKEA 349 >gnl|CDD|30409 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]. Length = 933 Score = 26.3 bits (58), Expect = 9.7 Identities = 10/39 (25%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Query: 57 LPEIRRLIDEQFPKAELNIEGYPNETFLNLCERYKPEQI 95 LP I ++++ + +IE + E F C + EQ+ Sbjct: 100 LP-IELKVEKKLGIGKKDIESFGVEEFREKCREFALEQV 137 >gnl|CDD|37546 KOG2335, KOG2335, KOG2335, tRNA-dihydrouridine synthase [Translation, ribosomal structure and biogenesis]. Length = 358 Score = 26.0 bits (57), Expect = 10.0 Identities = 18/68 (26%), Positives = 32/68 (47%), Gaps = 3/68 (4%) Query: 1 MSTSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPR-PDQRHIRY--TDL 57 M ++V NLN ++ R + V K+ +G S LTVH R +Q+ ++ D Sbjct: 132 MVSAVRANLNVPVSVKIRIFVDLEKTVDYAKMLEDAGVSLLTVHGRTREQKGLKTGPADW 191 Query: 58 PEIRRLID 65 I+ + + Sbjct: 192 EAIKAVRE 199 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.320 0.136 0.412 Gapped Lambda K H 0.267 0.0706 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 3,130,662 Number of extensions: 159909 Number of successful extensions: 425 Number of sequences better than 10.0: 1 Number of HSP's gapped: 412 Number of HSP's successfully gapped: 20 Length of query: 261 Length of database: 6,263,737 Length adjustment: 92 Effective length of query: 169 Effective length of database: 4,275,709 Effective search space: 722594821 Effective search space used: 722594821 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 56 (25.4 bits)