RPSBLAST alignment of GI: 254780438 and MMDB domain: 3gk0_A_

>3gk0_A (A:) PNP synthase, pyridoxine 5'-phosphate synthase; decode, ssgcid, niaid, SBRI, cytoplasm, pyridoxine biosynthesis, transferase; HET: DXP; 2.28A {Burkholderia pseudomallei}Length = 278
 Score =  265 bits (679), Expect = 4e-72
 Identities = 76/246 (30%), Positives = 124/246 (50%), Gaps = 9/246 (3%)

Query: 3   TSVSVNLNAVAVLRNRRNLPWPNLVHIGKIALQSGASGLTVHPRPDQRHIRYTDLPEIRR 62
             + VN++ VA LRN R   +P+ V     A  +GA  +T+H R D+RHI   D+  +R 
Sbjct: 32  IDLGVNIDHVATLRNARGTAYPDPVRAALAAEDAGADAITLHLREDRRHIVDADVRTLRP 91

Query: 63  LIDEQFPKAELNIEGYPNETFLNLCERYKPEQITLVPDDPHQLTSDHGWDFLQNQALLTK 122
            +     K  +N+E       L++    +P    LVP+   +LT++ G D + +   +  
Sbjct: 92  RV-----KTRMNLECAVTPEMLDIACEIRPHDACLVPEKRSELTTEGGLDVVGHFDAVRA 146

Query: 123 TVARLHNLGSRISLFADGNGNEHSLQAAKLTGADCIELYTGPYGACYNNPQQERIFLNKL 182
              +L + G R+SLF D   +E  ++AA  TGA  IEL+TG Y   ++  +Q+R    ++
Sbjct: 147 ACKQLADAGVRVSLFID--PDEAQIRAAHETGAPVIELHTGRYADAHDAAEQQRE-FERI 203

Query: 183 AITAQLAQKMDLQINAGHDLTIQNIPNLINAIPYISEISVGHAFAATALECGVKEAVFCF 242
           A        + L++NAGH L   N+   I A+P I+E+++GHA  A A+  G   AV   
Sbjct: 204 ATGVDAGIALGLKVNAGHGLHYTNVQ-AIAALPGIAELNIGHAIVAHAVFVGWDNAVREM 262

Query: 243 RRACGQ 248
           +     
Sbjct: 263 KAIMVA 268