>TIGR01016 sucCoAbeta succinyl-CoA synthetase, beta subunit; InterPro: IPR005809 There are four different enzymes that share a similar catalytic mechanism which involves the phosphorylation by ATP (or GTP) of a specific histidine residue in the active site. These enzymes are: ATP citrate-lyase (4.1.3.8 from EC) , the primary enzyme responsible for the synthesis of cytosolic acetyl-CoA in many tissues, catalyzes the formation of acetyl-CoA and oxaloacetate from citrate and CoA with the concomitant hydrolysis of ATP to ADP and phosphate. ATP-citrate lyase is a tetramer of identical subunits; Succinyl-CoA ligase (GDP-forming) (6.2.1.4 from EC) is a mitochondrial enzyme that catalyzes the substrate level phosphorylation step of the tricarboxylic acid cycle: the formation of succinyl-CoA from succinate with a concomitant hydrolysis of GTP to GDP and phosphate. This enzyme is a dimer composed of an alpha and a beta subunits; Succinyl-CoA ligase (ADP-forming) (6.2.1.5 from EC) is a bacterial enzyme that during aerobic metabolism functions in the citric acid cycle, coupling the hydrolysis of succinyl-CoA to the synthesis of ATP. It can also function in the other direction for anabolic purposes. This enzyme is a tetramer composed of two alpha and two beta subunits; and Malate-CoA ligase (6.2.1.9 from EC) (malyl-CoA synthetase) , is a bacterial enzyme that forms malyl-CoA from malate and CoA with the concomitant hydrolysis of ATP to ADP and phosphate. Malate-CoA ligase is composed of two different subunits. This entry corresponds to a conserved region located in the first half of ATP citrate lyase and in the beta subunits of succinyl-CoA ligases and malate-CoA ligase. ; GO: 0003824 catalytic activity, 0008152 metabolic process.

Probab=97.22 E-value=0.0053 Score=41.58 Aligned_cols=101 Identities=23% Similarity=0.335 Sum_probs=87.5 Q ss_pred HHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHH Q ss_conf 99999998789888620002344333332333333344444444333322211111123344444445544489999999 Q gi|254780439|r 131 LFSKAMQNIPLATPKSILANATDIKEHDRKLHEEERENLKKTLSKEELDAALYALELKWNLEENDRKHRYICHAMAVAVQ 210 (1162) Q Consensus 131 ~F~~~l~~~gip~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~s~~ea~~ 210 (1162) T Consensus 7 qAK~if~~YGiPvp~g~v~~-----------------------------------------------------s~~e~~~ 33 (389) T TIGR01016 7 QAKEIFAKYGIPVPEGEVAT-----------------------------------------------------SVEEVEE 33 (389) T ss_pred HHHHHHHHCCCCCCCCCEEE-----------------------------------------------------CHHHHHH T ss_conf 58999984789678860041-----------------------------------------------------6789999 Q ss_pred HHHHCC-CCEEEEECCCCCCCC----CCCCCCHHHHHHHHHHHHH-----------HCCCCCEEEEEECCCCEEEEEEEE Q ss_conf 998719-969994132678664----5111699999999998998-----------579982798664499789999999 Q gi|254780439|r 211 ALDEIG-LPLIIRPSFTLGGTG----GGIAYNRSEFLEIVENGLH-----------ASPTTEVLIEESVLGWKEYELEMM 274 (1162) Q Consensus 211 ~a~~iG-yPvivRps~~lGG~G----~~iv~n~eeL~~~~~~al~-----------~s~~~~vlIeksl~g~kEiE~eVi 274 (1162) T Consensus 34 ~~~~~g~~~~VvKaQVhaGGRGKAGGv~~a~s~ee~~~~a~~llg~~l~t~Qt~~~g~~VnkiliE~~~~I~kEyY~s~v 113 (389) T TIGR01016 34 IAEELGEGKVVVKAQVHAGGRGKAGGVKVAKSKEEALKAAEKLLGKELKTFQTDPLGQPVNKILIEEKIDIDKEYYLSIV 113 (389) T ss_pred HHHHCCCCCEEEEEEEEECCCCCCCCEEEEECHHHHHHHHHHHHCCEEEEEECCCCCCEEEEEEECCCCCCCCEEEEEEE T ss_conf 99970799789998773267112157689708799999999870891578640788863447873267741200147799 Q ss_pred EECCCCEEEE Q ss_conf 7289988999 Q gi|254780439|r 275 RDIKGNCIVV 284 (1162) Q Consensus 275 rD~~gn~i~v 284 (1162) T Consensus 114 ~DR~~~~pv~ 123 (389) T TIGR01016 114 IDRSAKKPVI 123 (389) T ss_pred EEECCCCCEE T ss_conf 9804787179

HHsearch alignment for GI: 254780439 and conserved domain: TIGR01016