HHsearch alignment of GI: 254780440 and MMDB domain: 2p4v_A_83-158

>2p4v_A (A:83-158) Transcription elongation factor GREB; transcript cleavage, GRE-factors, RNA polymerase; 2.60A {Escherichia coli}
Probab=99.83  E-value=1.8e-20  Score=150.79  Aligned_cols=74  Identities=35%  Similarity=0.624  Sum_probs=71.4

Q ss_pred             CCCCCCCEEEEEECCCCCEEEEEEECHHHCCCCCCEECCCCHHHHHHCCCCCCCEEEEECCCCEEEEEEEEEEEC
Q ss_conf             211136579995347652359999631013345881501317899872888887899982897199999998979
Q gi|254780440|r   84 DRIAFGATVSLVEKNSGDKKNYQIVGDQEADVQSGLVSISSPIARALIGKELGDIISVNAPGGEKTYEILQVLWI  158 (158)
Q Consensus        84 ~~V~~Gs~V~l~d~~~~~~~~~~lVg~~e~d~~~~~IS~~SPlG~ALlG~~~Gd~V~v~~p~G~~~~~Il~I~yi  158 (158)
                      ++|.|||+|++.| +++++++|+||||+++|++.++||+.||||+||||+++||+|+|++|+|.++|+|++|+|+
T Consensus         1 G~V~~Gs~V~l~~-~~~~~~~~~iV~~~~a~~~~~~IS~~SPlG~ALlG~~~Gd~v~~~~p~g~~~~~I~~V~~~   74 (76)
T 2p4v_A            1 GKVFFGAWVEIEN-DDGVTHRFRIVGYDEIFGRKDYISIDSPMARALLKKEVGDLAVVNTPAGEASWYVNAIEYV   74 (76)
T ss_dssp             SSCSSSCEEEEEC-TTCCCEEEEBCCSTTCCSSSCCBCTTSHHHHHSTTCCTTCEEEEECSSCEEEEEEEEEECC
T ss_pred             CCCCCCEEEEEEE-CCCCCEEEEEECHHHHHCCCCCCCCCCHHHHHHHCCCCCCEEEEEECCCCEEEEEEEEEEC
T ss_conf             6435770999960-5776218987550543135776578898999970899999899980898789999999943