RPSBLAST alignment for GI: 254780440 and conserved domain: PRK01885

>gnl|CDD|179345 PRK01885, greB, transcription elongation factor GreB; Reviewed. Length = 157
 Score =  124 bits (313), Expect = 1e-29
 Identities = 56/151 (37%), Positives = 92/151 (60%), Gaps = 5/151 (3%)

Query: 7   VTSKGFDKIQQELRWRQQEERPRIIKAISEARAYGDLSENAEYQAAKELQNLNE--GRMA 64
           +T +G+ +++QEL +  +EERP + + +S A + GD SENA+Y   K+   L E   R+ 
Sbjct: 7   ITREGYARLKQELDYLWREERPEVTQKVSWAASLGDRSENADYIYGKKR--LREIDRRVR 64

Query: 65  ELENIITRAEVIDISTMSGDRIAFGATVSLVEKNSGDKKNYQIVGDQEADVQSGLVSISS 124
            L   +   +V+D S     ++ FGA V + E   G++K ++IVG  E D + G +SI S
Sbjct: 65  FLTKRLENLKVVDYSPQQEGKVFFGAWVEI-ENEDGEEKRFRIVGPDEIDGRKGYISIDS 123

Query: 125 PIARALIGKELGDIISVNAPGGEKTYEILQV 155
           P+ARAL+ KE+GD ++VN P GE  + + ++
Sbjct: 124 PMARALLKKEVGDEVTVNTPAGEAEWYVNEI 154