RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddA 21,609 sequences; 6,263,737 total letters Searching..................................................done Query= gi|254780443|ref|YP_003064856.1| hypothetical protein CLIBASIA_01640 [Candidatus Liberibacter asiaticus str. psy62] (141 letters) >gnl|CDD|35039 COG5480, COG5480, Predicted integral membrane protein [Function unknown]. Length = 147 Score = 139 bits (350), Expect = 3e-34 Identities = 58/112 (51%), Positives = 78/112 (69%), Gaps = 1/112 (0%) Query: 23 AGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVS 82 A FRVCN T+ L+GVA+GY A K GW+TEGWW + + C T+++G L SRYYYLYAE Sbjct: 33 ADFRVCNYTQTLVGVAIGYRA-KNGWVTEGWWVVEASECVTLIEGELTSRYYYLYAEDAK 91 Query: 83 HSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTEYDTGQHENWTVQLT 134 WAG++ MCV +D F I +++C+ RG+ GF EYDTG+ +W VQL+ Sbjct: 92 GGARWAGSINMCVAEDRFKIFGVQDCFARGFQAAGFNEYDTGEQASWMVQLS 143 >gnl|CDD|30666 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism]. Length = 534 Score = 27.8 bits (61), Expect = 1.1 Identities = 10/41 (24%), Positives = 17/41 (41%) Query: 27 VCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNTCETVVKG 67 V ++ VG V+G + +G+W P T E + Sbjct: 360 VDPDGGEVLPGEVGEIWVRGPNVMKGYWNRPEATAEAFDED 400 >gnl|CDD|38201 KOG2990, KOG2990, KOG2990, C2C2-type Zn-finger protein [Function unknown]. Length = 317 Score = 26.5 bits (58), Expect = 2.9 Identities = 10/18 (55%), Positives = 12/18 (66%) Query: 28 CNGTKNLIGVAVGYPAVK 45 C+G KN IG+ V Y A K Sbjct: 55 CDGCKNHIGMGVRYNAEK 72 >gnl|CDD|29267 cd00212, PTS_IIB_glc, PTS_IIB, PTS system, glucose/sucrose specific IIB subunit. The bacterial phosphoenolpyruvate: sugar phosphotransferase system (PTS) is a multi-protein system involved in the regulation of a variety of metabolic and transcriptional processes. This family is one of four structurally and functionally distinct group IIB PTS system cytoplasmic enzymes, necessary for the uptake of carbohydrates across the cytoplasmic membrane and their phosphorylation. Length = 78 Score = 25.1 bits (55), Expect = 6.8 Identities = 9/26 (34%), Positives = 16/26 (61%), Gaps = 4/26 (15%) Query: 91 VQMCVGQDEFNIVDIKNCYTRGYLRV 116 ++ G++ NIV + +C TR LR+ Sbjct: 8 LEALGGKE--NIVSLDHCATR--LRL 29 Database: CddA Posted date: Feb 4, 2011 9:38 PM Number of letters in database: 6,263,737 Number of sequences in database: 21,609 Lambda K H 0.325 0.139 0.478 Gapped Lambda K H 0.267 0.0893 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21609 Number of Hits to DB: 1,799,900 Number of extensions: 87039 Number of successful extensions: 194 Number of sequences better than 10.0: 1 Number of HSP's gapped: 193 Number of HSP's successfully gapped: 5 Length of query: 141 Length of database: 6,263,737 Length adjustment: 84 Effective length of query: 57 Effective length of database: 4,448,581 Effective search space: 253569117 Effective search space used: 253569117 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (23.5 bits)