RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780443|ref|YP_003064856.1| hypothetical protein CLIBASIA_01640 [Candidatus Liberibacter asiaticus str. psy62] (141 letters) >gnl|CDD|148096 pfam06282, DUF1036, Protein of unknown function (DUF1036). This family consists of several hypothetical bacterial proteins of unknown function. Length = 115 Score = 150 bits (382), Expect = 9e-38 Identities = 62/113 (54%), Positives = 79/113 (69%), Gaps = 1/113 (0%) Query: 23 AGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVS 82 AG RVCN T+N++GVA+GY GW +EGWW I CET+++G L SRYYYLYAE Sbjct: 4 AGLRVCNDTQNVVGVAIGYKD-GEGWTSEGWWTIDPGKCETLIEGPLKSRYYYLYAEDAD 62 Query: 83 HSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTEYDTGQHENWTVQLTE 135 W G++Q CV +DEF IV +++C RGY R GF E DTG+ ++WTVQLTE Sbjct: 63 GGGRWGGDIQFCVREDEFTIVGVEDCLARGYDRAGFFEVDTGEQKSWTVQLTE 115 >gnl|CDD|180453 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated. Length = 521 Score = 34.8 bits (81), Expect = 0.008 Identities = 15/36 (41%), Positives = 21/36 (58%) Query: 36 GVAVGYPAVKGGWMTEGWWQIPGNTCETVVKGALHS 71 G VG V+G W+ +G+W P T ET+ G LH+ Sbjct: 364 GGEVGEIIVRGPWLMQGYWNRPEATAETIDGGWLHT 399 >gnl|CDD|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated. Length = 496 Score = 27.5 bits (61), Expect = 1.2 Identities = 15/53 (28%), Positives = 26/53 (49%), Gaps = 1/53 (1%) Query: 20 VSFAGFRVCNGTKNLIGVA-VGYPAVKGGWMTEGWWQIPGNTCETVVKGALHS 71 V F + + + KN + V VG ++G + + +W P T ET+ G L + Sbjct: 323 VLFCDYELIDENKNKVEVGEVGELLIRGPNVMKEYWNRPDATEETIQDGWLCT 375 >gnl|CDD|184391 PRK13914, PRK13914, invasion associated secreted endopeptidase; Provisional. Length = 481 Score = 27.1 bits (59), Expect = 1.8 Identities = 17/47 (36%), Positives = 24/47 (51%), Gaps = 4/47 (8%) Query: 74 YYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLR--VGF 118 ++ Y G+SH + GN QM QD N V N + G+ + VGF Sbjct: 434 FFDYGSGISHVGIYVGNGQMINAQD--NGVKYDNIHGSGWGKYLVGF 478 >gnl|CDD|180666 PRK06710, PRK06710, long-chain-fatty-acid--CoA ligase; Validated. Length = 563 Score = 26.1 bits (57), Expect = 2.9 Identities = 11/33 (33%), Positives = 17/33 (51%) Query: 39 VGYPAVKGGWMTEGWWQIPGNTCETVVKGALHS 71 +G VKG + +G+W P T + G LH+ Sbjct: 403 IGEIVVKGPQIMKGYWNKPEETAAVLQDGWLHT 435 >gnl|CDD|152538 pfam12103, Lipl32, Surface lipoprotein of Spirochaetales order. Lipl32 is an outer membrane surface lipoprotein of Leptospira like bacteria. Length = 183 Score = 26.0 bits (57), Expect = 3.8 Identities = 8/18 (44%), Positives = 11/18 (61%) Query: 110 TRGYLRVGFTEYDTGQHE 127 RG R+ FT Y TG+ + Sbjct: 148 VRGLYRISFTTYKTGEVK 165 >gnl|CDD|182413 PRK10367, PRK10367, DNA-damage-inducible SOS response protein; Provisional. Length = 441 Score = 25.5 bits (56), Expect = 5.4 Identities = 9/14 (64%), Positives = 11/14 (78%) Query: 1 MLRSFLICFCFGAM 14 MLRS L+ CFGA+ Sbjct: 242 MLRSLLLQLCFGAI 255 >gnl|CDD|182738 PRK10795, PRK10795, penicillin-binding protein 2; Provisional. Length = 634 Score = 24.7 bits (54), Expect = 7.8 Identities = 6/7 (85%), Positives = 7/7 (100%) Query: 52 GWWQIPG 58 GWWQ+PG Sbjct: 357 GWWQLPG 363 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.325 0.139 0.478 Gapped Lambda K H 0.267 0.0725 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 2,282,680 Number of extensions: 128551 Number of successful extensions: 267 Number of sequences better than 10.0: 1 Number of HSP's gapped: 266 Number of HSP's successfully gapped: 13 Length of query: 141 Length of database: 5,994,473 Length adjustment: 84 Effective length of query: 57 Effective length of database: 4,179,401 Effective search space: 238225857 Effective search space used: 238225857 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (23.8 bits)