RPS-BLAST 2.2.22 [Sep-27-2009] Database: pdb70 24,244 sequences; 5,693,230 total letters Searching..................................................done Query= gi|254780443|ref|YP_003064856.1| hypothetical protein CLIBASIA_01640 [Candidatus Liberibacter asiaticus str. psy62] (141 letters) >2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Score = 29.8 bits (66), Expect = 0.22 Identities = 26/97 (26%), Positives = 34/97 (35%), Gaps = 25/97 (25%) Query: 34 LIGV----AVGYP-AVKGGWMTEGWWQIPGNTCETVVKGALHSRYYYLYAEGVSHSEHWA 88 +IGV G+P G WM G QI L+S G+ A Sbjct: 1373 VIGVFQKFLTGHPKGAAGAWMMNGALQI------------LNS--------GIIPGNRNA 1412 Query: 89 GNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTEYDTGQ 125 NV + Q E+ + K T G V T + GQ Sbjct: 1413 DNVDKILEQFEYVLYPSKTLKTDGVRAVSITSFGFGQ 1449 Score = 24.8 bits (53), Expect = 8.0 Identities = 6/12 (50%), Positives = 8/12 (66%) Query: 83 HSEHWAGNVQMC 94 HSE WA + +C Sbjct: 655 HSESWANQLTVC 666 >1ev1_1 Echovirus 1; viral coat protein, capsid, picornavirus, icosahedral virus; HET: MYR PLM; 3.55A {Human echovirus 1} SCOP: b.121.4.1 Length = 281 Score = 29.8 bits (67), Expect = 0.27 Identities = 15/44 (34%), Positives = 18/44 (40%), Gaps = 7/44 (15%) Query: 104 DIKNCYTRGYLRVGFTEYDTGQHE------NWTVQLTEPAQDRR 141 I+N R V + EY TG E NW + AQ RR Sbjct: 63 TIENFLARSAC-VFYLEYKTGTKEDSNSFNNWVITTRRVAQLRR 105 >1bev_1 Bovine enterovirus coat proteins VP1 to VP4; bovine enterovirus VG-5-27, picornavirus, icosahedral virus; HET: MYR; 3.00A {Bovine enterovirus} SCOP: b.121.4.1 Length = 281 Score = 29.0 bits (65), Expect = 0.39 Identities = 10/39 (25%), Positives = 16/39 (41%), Gaps = 2/39 (5%) Query: 104 DIKNCYTRGYLRVGFTEYDTGQ-HENWTVQLTEPAQDRR 141 +++ + R L VG TG +W + E Q R Sbjct: 70 SVESFFGRSSL-VGMPLLATGTSITHWRIDFREFVQLRA 107 >2zz8_A LIPL32 protein; outer-membrane protein, unknown function; 2.01A {Leptospira interrogans} PDB: 3frl_A* Length = 241 Score = 28.9 bits (64), Expect = 0.40 Identities = 10/30 (33%), Positives = 15/30 (50%) Query: 98 DEFNIVDIKNCYTRGYLRVGFTEYDTGQHE 127 D+ +D K RG R+ FT Y G+ + Sbjct: 174 DDLKNIDTKKLLVRGLYRISFTTYKPGEVK 203 >1mc3_A Glucose-1-phosphate thymidylyltransferase; glucose-1-phosphate thymidylytransferase, RFFH; HET: TTP; 2.60A {Escherichia coli} SCOP: c.68.1.6 Length = 296 Score = 27.8 bits (62), Expect = 1.0 Identities = 13/37 (35%), Positives = 15/37 (40%), Gaps = 6/37 (16%) Query: 99 EFNIVDIKNCYT-RGYLRV-----GFTEYDTGQHENW 129 E I I Y G L V GF DTG H++ Sbjct: 197 ELEITSINQMYLEAGNLTVELLGRGFAWLDTGTHDSL 233 >1z7s_1 Human coxsackievirus A21; picornavirus, capsid protein, viral protein, icosahedral virus; HET: MYR G; 3.20A {Human coxsackievirus A21} PDB: 1z7z_1* Length = 298 Score = 27.1 bits (60), Expect = 1.4 Identities = 7/46 (15%), Positives = 13/46 (28%), Gaps = 9/46 (19%) Query: 104 DIKNCYTRGYLRVGFTEYDTGQHEN--------WTVQLTEPAQDRR 141 +++ + R V W + T+ Q RR Sbjct: 71 CLESFFGRAAC-VTILSLTNSSKSGEEKKHFNIWNITYTDTVQLRR 115 >2w5f_A Endo-1,4-beta-xylanase Y; cellulosome, glycosidase, xylan degradation, hydrolase; HET: CE6; 1.90A {Clostridium thermocellum} Length = 540 Score = 26.3 bits (57), Expect = 2.6 Identities = 7/43 (16%), Positives = 15/43 (34%), Gaps = 2/43 (4%) Query: 50 TEGWWQIPGNTCETVVKGALHSRYYYLYAEGVSHSEHWAGNVQ 92 +GW + +T T V+ ++ + S + G Sbjct: 34 FDGWCNLGVDTYLTAVENEGNNGTRGMMVINRSSA--SDGAYS 74 >1aym_1 HRV16, human rhinovirus 16 coat protein; RNA, site-directed mutagenesis, icosahedral virus; HET: MYR DAO; 2.15A {Human rhinovirus SP} SCOP: b.121.4.1 PDB: 1ayn_1* 1c8m_1* 1ncr_A* 1nd2_A* 1nd3_A* 1qju_1* 1qjx_1* 1qjy_1* 1d3e_1 1fpn_1* 1v9u_1* 3dpr_A* 1r1a_1* 2hwd_1* 2hwe_1* 2hwf_1* Length = 285 Score = 26.3 bits (58), Expect = 2.6 Identities = 10/44 (22%), Positives = 17/44 (38%), Gaps = 7/44 (15%) Query: 104 DIKNCYTRGYLRVGFTEYDTGQHEN------WTVQLTEPAQDRR 141 +++ R + + D + N W + L E AQ RR Sbjct: 66 SVESFLGRSGC-IHESVLDIVDNYNDQSFTKWNINLQEMAQIRR 108 >3fe4_A Carbonic anhydrase 6; secretion, metal binding, structural genomics, structural genomics consortium, SGC, glycoprotein lyase, metal-binding; 1.90A {Homo sapiens} Length = 278 Score = 25.6 bits (55), Expect = 4.0 Identities = 14/49 (28%), Positives = 19/49 (38%), Gaps = 2/49 (4%) Query: 77 YAEGVSHSEHWAGNVQMCVG--QDEFNIVDIKNCYTRGYLRVGFTEYDT 123 Y+EG HW + C G Q N+ K Y + T Y+T Sbjct: 6 YSEGALDEAHWPQHYPACGGQRQSPINLQRTKVRYNPSLKGLNMTGYET 54 >3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Length = 549 Score = 24.9 bits (53), Expect = 6.2 Identities = 5/36 (13%), Positives = 14/36 (38%) Query: 39 VGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYY 74 G ++G + +G+W+ E +++ Sbjct: 383 SGEIVIRGPNIFKGYWKREKENQECWWYDEKGRKFF 418 >1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Length = 541 Score = 24.8 bits (53), Expect = 7.9 Identities = 9/31 (29%), Positives = 15/31 (48%) Query: 36 GVAVGYPAVKGGWMTEGWWQIPGNTCETVVK 66 G A+G +KG W+T G++ T + Sbjct: 380 GKALGEVQLKGPWITGGYYGNEEATRSALTP 410 >3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Length = 536 Score = 24.5 bits (53), Expect = 8.3 Identities = 7/37 (18%), Positives = 15/37 (40%), Gaps = 4/37 (10%) Query: 39 VGYPAVKGGWMTEGWWQIPGNTCETVVKGALHSRYYY 75 G ++G + +G+ P T T+ K + + Sbjct: 382 PGEICIRGDQIMKGYLNDPEATSRTIDKE----GWLH 414 Database: pdb70 Posted date: Jan 26, 2011 11:21 AM Number of letters in database: 5,693,230 Number of sequences in database: 24,244 Lambda K H 0.325 0.139 0.478 Gapped Lambda K H 0.267 0.0584 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 24244 Number of Hits to DB: 1,311,677 Number of extensions: 55058 Number of successful extensions: 193 Number of sequences better than 10.0: 1 Number of HSP's gapped: 192 Number of HSP's successfully gapped: 22 Length of query: 141 Length of database: 5,693,230 Length adjustment: 83 Effective length of query: 58 Effective length of database: 3,680,978 Effective search space: 213496724 Effective search space used: 213496724 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 52 (24.1 bits)