BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780443|ref|YP_003064856.1| hypothetical protein CLIBASIA_01640 [Candidatus Liberibacter asiaticus str. psy62] (141 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780443|ref|YP_003064856.1| hypothetical protein CLIBASIA_01640 [Candidatus Liberibacter asiaticus str. psy62] Length = 141 Score = 298 bits (762), Expect = 4e-83, Method: Compositional matrix adjust. Identities = 141/141 (100%), Positives = 141/141 (100%) Query: 1 MLRSFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNT 60 MLRSFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNT Sbjct: 1 MLRSFLICFCFGAMIFCSNVSFAGFRVCNGTKNLIGVAVGYPAVKGGWMTEGWWQIPGNT 60 Query: 61 CETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTE 120 CETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTE Sbjct: 61 CETVVKGALHSRYYYLYAEGVSHSEHWAGNVQMCVGQDEFNIVDIKNCYTRGYLRVGFTE 120 Query: 121 YDTGQHENWTVQLTEPAQDRR 141 YDTGQHENWTVQLTEPAQDRR Sbjct: 121 YDTGQHENWTVQLTEPAQDRR 141 >gi|254781033|ref|YP_003065446.1| HemY domain-containing protein [Candidatus Liberibacter asiaticus str. psy62] Length = 492 Score = 20.8 bits (42), Expect = 9.1, Method: Composition-based stats. Identities = 8/32 (25%), Positives = 17/32 (53%) Query: 108 CYTRGYLRVGFTEYDTGQHENWTVQLTEPAQD 139 CY + EY + ++ N+++++ PA D Sbjct: 416 CYFEWKIPTKSPEYISSENINFSLEMAYPADD 447 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.325 0.139 0.478 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 98,476 Number of Sequences: 1233 Number of extensions: 3987 Number of successful extensions: 8 Number of sequences better than 100.0: 4 Number of HSP's better than 100.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 4 Number of HSP's gapped (non-prelim): 4 length of query: 141 length of database: 328,796 effective HSP length: 66 effective length of query: 75 effective length of database: 247,418 effective search space: 18556350 effective search space used: 18556350 T: 11 A: 40 X1: 15 ( 7.0 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.6 bits) S2: 34 (17.7 bits)