HHsearch alignment for GI: 254780444 and conserved domain: COG1396

>COG1396 HipB Predicted transcriptional regulators [Transcription].
Probab=95.65  E-value=0.054  Score=32.97  Aligned_cols=61  Identities=25%  Similarity=0.364  Sum_probs=51.3

Q ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCC
Q ss_conf             99999999996499988999982899879889975157887557798999998732187521000
Q gi|254780444|r    9 IWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLL   73 (223)
Q Consensus         9 i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~   73 (223)
T Consensus         2 ~~~~~~~~r~~~~~s~~~~a~~~~~~~~~~~~~e~~~~~----~~~~~~~~~~~~~~~~~~~~~~   62 (120)
T COG1396           2 IGERLKELRKKKGLSQEELAERLGVSRSTISRIERGRSE----SPSLELLARLAAALGVSLDELL   62 (120)
T ss_pred             HHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCC----CCCHHHHHHHHHHHCCCHHHHH
T ss_conf             789999999986999999998939889999999807877----8469999999999697899884