HHsearch alignment for GI: 254780444 and conserved domain: COG2524

>COG2524 Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription].
Probab=90.62  E-value=1.4  Score=23.78  Aligned_cols=41  Identities=15%  Similarity=0.288  Sum_probs=29.5

Q ss_pred             CCCCC--HHHHHHHH-HHHHHHCCC-CHHHHHHHHCCCHHHHHHH
Q ss_conf             97755--89999999-999996499-9889999828998798899
Q gi|254780444|r    1 MTSFS--HKKIWEAI-DRMAERHNL-TPSGLARKAGLDPTSFNKS   41 (223)
Q Consensus         1 ~~~~~--~~~i~~~i-~~l~~~~gl-s~~~lA~~~Gv~~~ti~~~   41 (223)
T Consensus         1 ~~~LT~~QkeIL~aLi~LY~~~~r~IKgeeIA~~l~rnpGTVRNq   45 (294)
T COG2524           1 MKELTSSQKEILQALINLYRRKKRPIKGEEIAEVLNRNPGTVRNQ   45 (294)
T ss_pred             CCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCCCHHHHH
T ss_conf             964218899999999999985378855599999874596169999