HHsearch alignment for GI: 254780444 and conserved domain: COG3093

>COG3093 VapI Plasmid maintenance system antidote protein [General function prediction only].
Probab=97.06  E-value=0.0011  Score=44.02  Aligned_cols=63  Identities=14%  Similarity=0.076  Sum_probs=50.4

Q ss_pred             HHHH-HHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCCC
Q ss_conf             9999-9999996499988999982899879889975157887557798999998732187521000011
Q gi|254780444|r    9 IWEA-IDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDLP   76 (223)
Q Consensus         9 i~~~-i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~~   76 (223)
T Consensus        10 PGEiL~eeflep~glt~~~lA~~lgV~r~~is~ling~~-----~iT~dmAlrL~k~fGtspefWlNlQ   73 (104)
T COG3093          10 PGEILREEFLEPLGLTQTELAEALGVTRNTISELINGRR-----AITADMALRLAKVFGTSPEFWLNLQ   73 (104)
T ss_pred             CHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHHCCCHHHHHHHH
T ss_conf             418899998452169899999993998999999983776-----7899999999999299899999999