HHsearch alignment for GI: 254780444 and conserved domain: COG5606

>COG5606 Uncharacterized conserved small protein [Function unknown].
Probab=94.47  E-value=0.056  Score=32.88  Aligned_cols=64  Identities=17%  Similarity=0.158  Sum_probs=50.6

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCC
Q ss_conf             75589999999999996499988999982899879889975157887557798999998732187521
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETIC   70 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~   70 (223)
T Consensus        23 m~ir~~l~~~i~~~i~q~~l~Q~qiae~lgV~qprvS~l~~g----k~~~fs~dkLvtml~~~g~ei~   86 (91)
T COG5606          23 MKIRSALMMAIKQWIEQAALSQAQIAELLGVTQPRVSDLARG----KIQDFSIDKLVTMLARAGQEID   86 (91)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHC----CHHHHHHHHHHHHHHHCCCCCC
T ss_conf             999999999999999997877999999838887318899836----1457669999999997598552