HHsearch alignment for GI: 254780444 and conserved domain: PRK00215

>PRK00215 LexA repressor; Validated.
Probab=99.92  E-value=3.2e-23  Score=170.46  Aligned_cols=190  Identities=16%  Similarity=0.207  Sum_probs=132.2

Q ss_pred             CCC--HHHHHHHHHHHHHHCCCCH--HHHHHHHCCC-HHHHHHHHHC-CCCCCC-CCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             755--8999999999999649998--8999982899-8798899751-578875-5779899999873218752100001
Q gi|254780444|r    3 SFS--HKKIWEAIDRMAERHNLTP--SGLARKAGLD-PTSFNKSKRF-GIEGRN-RWPSTESIFKILAATNETICQLLDL   75 (223)
Q Consensus         3 ~~~--~~~i~~~i~~l~~~~gls~--~~lA~~~Gv~-~~ti~~~~~~-~~~g~~-r~p~~~~l~kia~~~~v~~~~l~~~   75 (223)
T Consensus         1 mLT~kQ~~il~fI~~~~~~~g~~Ps~rEI~~~~g~~S~~tV~~~l~~Le~kG~i~r~~~~~R~i~i~-----------~~   69 (204)
T PRK00215          1 MLTARQQEILDFIKDRIEETGYPPSRREIADALGLRSPSAVHEHLKALERKGFIRRDPGRSRAIEVL-----------PA   69 (204)
T ss_pred             CCCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCHHHHHHHHHHHHCCCEECCCCCCCEEEEE-----------CC
T ss_conf             9898999999999999997488998999999809998189999999998797887069997338971-----------57


Q ss_pred             CCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCEEEEEECCCCC-CCCCCCC
Q ss_conf             111244454422122024310113452221112544464035643721135454200368559999628332-4214878
Q gi|254780444|r   76 PFSDGRTTEKKEKEIPLLYFPPSGSGGFFDSGVFPTGNKWNTVGVPEIRSPHNGIYAIQTQDTRHKTQDTSM-LPLYRKG  154 (223)
Q Consensus        76 ~~~~~~~~~~~~~~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~l~V~GDSM-~P~i~~G  154 (223)
T Consensus        70 ~~~-~~~~~~~~~~iPi~G~IaAG~pi~a~------e~~~~~i~vp~~~~-------~~~~~F~LrV~GdSMi~~~I~dG  135 (204)
T PRK00215         70 EAA-DEDAAEEALGLPLVGRVAAGEPILAE------EHIEDHFPLPPSLF-------GPGEDFLLRVRGDSMIDAGILDG  135 (204)
T ss_pred             CCC-CCCCCCCCCCCCEEEEECCCCCCCCC------CCCCCCEECCHHHC-------CCCCEEEEEECCCCCCCCCCCCC
T ss_conf             665-44456665226546676589976131------03034371687677-------87676999963787665798999


Q ss_pred             CEEEEECCCCCCCCCEEEEEEECCCEEEEEEEEECCCEEEEEECCCCCCCEEECHHHEEEEEEEE
Q ss_conf             68999368974058889999717968999999977987999968589887585478659997799
Q gi|254780444|r  155 DILILNSAIQVNCGDRLLIKPRTGDIVAKVLISRRGRSIDLMSLNCCYPVDTVEMSDIEWIARIL  219 (223)
Q Consensus       155 d~vlVd~~~~~~~g~~v~~~~~~~~~~iKrl~~~~~~~~~l~s~Np~y~~~~i~~~~i~iigrVv  219 (223)
T Consensus       136 D~viV~~~~~~~~G~Ivva~i-~~e~tlKr~~~~-~~~i~L~p~N~~y~pi~~~~~~~~I~G~vv  198 (204)
T PRK00215        136 DLVIVRKQQTARNGQIVVALI-DDEATVKRFRRE-GGHIRLLPENPAYEPIIVDPDDVTIEGKVV  198 (204)
T ss_pred             CEEEEECCCCCCCCCEEEEEE-CCCCEEEEEEEE-CCEEEEECCCCCCCCEEECCCCEEEEEEEE
T ss_conf             999995789688996999997-377589999997-999999848999998772778379999999