HHsearch alignment for GI: 254780444 and conserved domain: PRK04140

>PRK04140 hypothetical protein; Provisional.
Probab=97.56  E-value=0.0003  Score=47.55  Aligned_cols=61  Identities=20%  Similarity=0.322  Sum_probs=52.5

Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCCCCCC
Q ss_conf             999999999649998899998289987988997515788755779899999873218752100001
Q gi|254780444|r   10 WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQLLDL   75 (223)
Q Consensus        10 ~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~l~~~   75 (223)
T Consensus       127 g~~Lr~~Re~~g~SlG~LA~~LGVSRrtv~~YE~g~~~-----~sievA~kLeeif~~~i~~~Idi  187 (319)
T PRK04140        127 GDLLRELREKLGLSLGELASELGVSRRTISKYENGGMN-----ASIEVAIKLEEILDEPLTKPIDI  187 (319)
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCC-----CCHHHHHHHHHHHCCCCCCCCCC
T ss_conf             79999999981988889999849869999999706886-----64999999999838732355202