HHsearch alignment for GI: 254780444 and conserved domain: PRK09726

>PRK09726 DNA-binding transcriptional regulator HipB; Provisional.
Probab=98.52  E-value=4.7e-07  Score=65.75  Aligned_cols=65  Identities=18%  Similarity=0.265  Sum_probs=56.2

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHCCCCCCC
Q ss_conf             7755899999999999964999889999828998798899751578875577989999987321875210
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRFGIEGRNRWPSTESIFKILAATNETICQ   71 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~~~~g~~r~p~~~~l~kia~~~~v~~~~   71 (223)
T Consensus         6 ki~sp~qLa~~Lr~~Rk~~gLsQ~~lA~~vGi~Q~TiS~~E~~p~-----~~~leTLFkiL~aL~Lel~i   70 (88)
T PRK09726          6 KIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPD-----NTTLTTFFKILQSLELSMTL   70 (88)
T ss_pred             CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHCCCC-----CCCHHHHHHHHHHCCCEEEE
T ss_conf             028999999999999998598799999981974999999975998-----78699999999967876887