HHsearch results for GI: 254780444 and protein with PDBid: 1hlv_A

>1hlv_A CENP-B, major centromere autoantigen B; helix-turn-helix, protein-DNA complex, riken structural genomics/proteomics initiative, RSGI; 2.50A {Homo sapiens} SCOP: a.4.1.7 a.4.1.7 PDB: 1bw6_A
Probab=95.10  E-value=0.11  Score=29.57  Aligned_cols=43  Identities=14%  Similarity=0.298  Sum_probs=37.5

Q ss_pred             CCCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             7755899999999999964999889999828998798899751
Q gi|254780444|r    2 TSFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         2 ~~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      +.+|.++-.++|+.+.+...+++.++|+..||+.+||++|.+.
T Consensus         6 k~~t~~~K~~vi~~~~~~~~~~~~~iAk~fgv~~sTi~~~~k~   48 (131)
T 1hlv_A            6 RQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKN   48 (131)
T ss_dssp             CCCCHHHHHHHHHHHHHCTTSCHHHHHHHHTCCHHHHHHHHHT
T ss_pred             CCCCHHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             3189999999999999778888999999989199999999924