HHsearch results for GI: 254780444 and protein with PDBid: 1r71_A

>1r71_A Transcriptional repressor protein KORB; INCP, plasmid partitioning, protein-DNA complex, heilx-turn- helix motif, transcription factor; HET: BRU; 2.20A {Escherichia coli} SCOP: a.4.14.1
Probab=94.34  E-value=0.082  Score=30.38  Aligned_cols=41  Identities=15%  Similarity=0.290  Sum_probs=34.8

Q ss_pred             CCCHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHC
Q ss_conf             755899999999999964999889999828998798899751
Q gi|254780444|r    3 SFSHKKIWEAIDRMAERHNLTPSGLARKAGLDPTSFNKSKRF   44 (223)
Q Consensus         3 ~~~~~~i~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~~~   44 (223)
                      .||--++..++++|+++ |+|+.++|+++|.+.++|+++.+-
T Consensus        35 ~l~~~e~A~~~~~l~~~-g~t~~~iA~~lg~s~~~V~~~l~l   75 (178)
T 1r71_A           35 ELTPREIADFIGRELAK-GKKKGDIAKEIGKSPAFITQHVTL   75 (178)
T ss_dssp             CCCHHHHHHHHHHHHHT-TCCHHHHHHHHTCCHHHHHHHHGG
T ss_pred             CCCHHHHHHHHHHHHHC-CCCHHHHHHHHCCCHHHHHHHHHH
T ss_conf             89999999999999981-788999999969999999999998