HHsearch results for GI: 254780444 and protein with PDBid: 1umq_A

>1umq_A Photosynthetic apparatus regulatory protein; DNA-binding protein, response regulator, DNA binding domain, helix-turn-helix; NMR {Rhodobacter sphaeroides} SCOP: a.4.1.12
Probab=90.57  E-value=0.57  Score=24.95  Aligned_cols=39  Identities=23%  Similarity=0.426  Sum_probs=31.9

Q ss_pred             CCHHHH-HHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHH
Q ss_conf             558999-999999999649998899998289987988997
Q gi|254780444|r    4 FSHKKI-WEAIDRMAERHNLTPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         4 ~~~~~i-~~~i~~l~~~~gls~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++-+++ .+.|.+.+++.+.+.++.|+.+||+.+|+.+-.
T Consensus        36 ~~L~~~Er~~I~~aL~~~~GN~s~AAr~LGIsR~TLyrkl   75 (81)
T 1umq_A           36 MSADRVRWEHIQRIYEMCDRNVSETARRLNMHRRTLQRIL   75 (81)
T ss_dssp             SCHHHHHHHHHHHHHHHTTSCHHHHHHHHTSCHHHHHHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCHHHHHHHH
T ss_conf             8999999999999999972779999999798999999999