HHsearch results for GI: 254780444 and protein with PDBid: 1vi0_A

>1vi0_A Transcriptional regulator; structural genomics; HET: MSE DCC; 1.65A {Bacillus subtilis} SCOP: a.4.1.9 a.121.1.1
Probab=90.42  E-value=0.62  Score=24.71  Aligned_cols=38  Identities=16%  Similarity=0.142  Sum_probs=30.9

Q ss_pred             CHHHHHHHHHHHHHHCCC---CHHHHHHHHCCCHHHHHHHH
Q ss_conf             589999999999996499---98899998289987988997
Q gi|254780444|r    5 SHKKIWEAIDRMAERHNL---TPSGLARKAGLDPTSFNKSK   42 (223)
Q Consensus         5 ~~~~i~~~i~~l~~~~gl---s~~~lA~~~Gv~~~ti~~~~   42 (223)
                      ++++|.++--.+..+.|+   |-.++|+.+|++.+|+.++.
T Consensus         9 rr~~Il~aa~~lf~~~G~~~~s~~~Ia~~agvs~~t~Y~~F   49 (206)
T 1vi0_A            9 KYMQIIDAAVEVIAENGYHQSQVSKIAKQAGVADGTIYLYF   49 (206)
T ss_dssp             HHHHHHHHHHHHHHHHCGGGCCHHHHHHHHTSCHHHHHHHC
T ss_pred             HHHHHHHHHHHHHHHHCCCCCCHHHHHHHHCCCHHHHHHHH
T ss_conf             99999999999998739030679999999794999999991